Search Results

Search found 5623 results on 225 pages for 'inline assembly'.

Page 83/225 | < Previous Page | 79 80 81 82 83 84 85 86 87 88 89 90  | Next Page >

  • Problem using psexec to remotely GAC a file

    - by Andrew Dunaway
    As part of a deployment process I am trying to GAC a series of files. The actual build process occurs on a build server, and I am trying to use psexec to GAC the files on whichever machine has requested the build. The current line I am trying to execute is: C:\PsToolspsexec.exe \COMPUTER -u USER -p PASS gacutil.exe -i Assembly.dll -f The error that I am getting back is: Failure adding assembly to the cache: The system cannot find the file specified. So apparently the dll reference is on the remote box, and unfortunately the dll is sitting on the build box. Is there any way to just do this with psexec somehow, or do I need to copy it to some temporary location on the \\COMPUTER? I know there are commands to copy the executable as part of the psexec process, but I can't seem to find anything similar for supporting files.

    Read the article

  • Downloading file from server (asp.net) to IE8 Content-Disposition problem with file name

    - by David
    I am downloading a file from the server/database via aspx page. When using the content-disposition inline the document opens in correct application but the file name is the same as the web page. I want the document to open in say MS Word but with the correct file name. Here is the code that I am using Response.Buffer = true; Response.ClearContent(); Response.ClearHeaders(); Response.Clear(); Response.ContentType = MimeType(fileName); //function to return the correct MIME TYPE Response.AddHeader("Content-Disposition", @"inline;filename=" + fileName); Response.AddHeader("Content-Length", image.Length.ToString()); Response.BinaryWrite(image); Response.Flush(); Response.Close(); So again, I want the file to open in MS Word with the correct document file name so that the user can properly save/view. Ideas? thanks

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • How to Access a descendant object's internal method in C#

    - by Giovanni Galbo
    I'm trying to access a method that is marked as internal in the parent class (in its own assembly) in an object that inherits from the same parent. Let me explain what I'm trying to do... I want to create Service classes that return IEnumberable with an underlying List to non-Service classes (e.g. the UI) and optionally return an IEnumerable with an underlying IQueryable to other services. I wrote some sample code to demonstrate what I'm trying to accomplish, shown below. The example is not real life, so please remember that when commenting. All services would inherit from something like this (only relevant code shown): public class ServiceBase<T> { protected readonly ObjectContext _context; protected string _setName = String.Empty; public ServiceBase(ObjectContext context) { _context = context; } public IEnumerable<T> GetAll() { return GetAll(false); } //These are not the correct access modifiers.. I want something //that is accessible to children classes AND between descendant classes internal protected IEnumerable<T> GetAll(bool returnQueryable) { var query = _context.CreateQuery<T>(GetSetName()); if(returnQueryable) { return query; } else { return query.ToList(); } } private string GetSetName() { //Some code... return _setName; } } Inherited services would look like this: public class EmployeeService : ServiceBase<Employees> { public EmployeeService(ObjectContext context) : base(context) { } } public class DepartmentService : ServiceBase<Departments> { private readonly EmployeeService _employeeService; public DepartmentService(ObjectContext context, EmployeeService employeeService) : base(context) { _employeeService = employeeService; } public IList<Departments> DoSomethingWithEmployees(string lastName) { //won't work because method with this signature is not visible to this class var emps = _employeeService.GetAll(true); //more code... } } Because the parent class lives is reusable, it would live in a different assembly than the child services. With GetAll(bool returnQueryable) being marked internal, the children would not be able to see each other's GetAll(bool) method, just the public GetAll() method. I know that I can add a new internal GetAll method to each service (or perhaps an intermediary parent class within the same assembly) so that each child service within the assembly can see each other's method; but it seems unnecessary since the functionality is already available in the parent class. For example: internal IEnumerable<Employees> GetAll(bool returnIQueryable) { return base.GetAll(returnIQueryable); } Essentially what I want is for services to be able to access other service methods as IQueryable so that they can further refine the uncommitted results, while everyone else gets plain old lists. Any ideas? EDIT You know what, I had some fun playing a little code golf with this... but ultimately I wouldn't be able to use this scheme anyway because I pass interfaces around, not classes. So in my example GetAll(bool returnIQueryable) would not be in the interface, meaning I'd have to do casting, which goes against what I'm trying to accomplish. I'm not sure if I had a brain fart or if I was just too excited trying to get something that I thought was neat to work. Either way, thanks for the responses.

    Read the article

  • jqmodal IE (7 or 8) flashes black before modal loaded

    - by brad
    This is killing me. In both IE7 and 8, using jqModal, the screen flashes black before the modal content is loaded. I've set up a test app to show you what's happening. I've taken jqModal EXACTLY from the site, no changes whatsoever, no external css that could be affecting my app. It works perfectly in every other browser (including IE6). http://jqmtest.heroku.com/ So, first two links are ajax calls, second is straight up inline HTML. (I originally thought it was the ajax that was affecting it, but that doesn't seem to be the case, I then thought it was slow loading ajax, hence to two differen ajax links) What's crazy is that the jqmodal site itself works perfectly in IE, no flashing of black, but I can't see what I'm doing wrong. Code is straight forward html: <body> <div id="ajaxModal" class="jqmWindow"></div> <div id="inlineModal" class="jqmWindow"> <div style="height:300px;position:relative;"> <p>Here's some inline content</p> <a href="#" onclick='$("#inlineModal").jqmHide();return false;' style="position:absolute;bottom:10px;right:10px">Close</a> </div> </div> <div style="width:600px;height:400px;margin:auto;background:#eee;"> <p><a href="/ajax/short" class="jqModal">Short loading modal</a></p> <br /> <p><a href="/ajax/long" class="jqModal">Longer loading modal</a></p> <br /> <p><a href="#" class="jqInline">inline modal</a></p> </div> </body> Javascript: <script type="text/javascript"> $(function(){ $("#ajaxModal").jqm({ajax:'@href', modal:true}); $("#inlineModal").jqm({modal:true, trigger:'.jqInline'}); }); </script> CSS is exactly the same as the one downloaded from jqModal's site so I'll omit it, but you can see it on my app Has anyone experienced this? I don't get how his works and mine doesn't.

    Read the article

  • Ul Li last element not aligning properly

    - by Chase
    I am having a problem where the last li element in a ul is pushing itself to the left further than the rest of all my pieces. Attached is a screen shot and my code. I have tried using the last-child element but it doesn't work in Safari or Chrome. #attending ul { display: inline; margin: 0 5px 0 0; padding-left: 0px; } #attending ul li { display: inline; list-style-image:none; padding: 5px; } #attending li:last-child { margin-right:-4px; } Suggestions? TIA, Chase http://desmond.yfrog.com/Himg338/scaled.php?tn=0&server=338&filename=screenshot20100526at808.jpg&xsize=640&ysize=640

    Read the article

  • Excel Smart Find and Replace only specific characters

    - by Asim
    I want to change INT to INTERNATIONAL and NA to NATIONAL ASSEMBLY in whole excel workbook through an excel Macro or Find and Replace dialogue box. But when I run the macro or change it through Find and Replace dialogue box it also replace NA from CHINA last 2 characters and it became CHINATIONAL ASSEMBLY and INTERIOR to INTERNATIONALERIOR. Now, I want that Excel should only smartly find the character NA in the workbook which is not included with any other character likewise character INT which is not attach to any other character. I would be grateful if anyone give any formula, Excel Macro or anything else to overcome this issue. Thanks,

    Read the article

  • mingw spitting countless warnings about ignoring "dll import" attribute

    - by hasen j
    I'm using mingw32-make to compile a qt project that uses opengl, it compiles correctly and everything, but it spits countless warning messages of the form: c:/qt3/include/qcolor.h:67: warning: inline function `int qGray(int, int, int)' declared as dllimport: attribute ignored For this particular instance, the function declaration is: Q_EXPORT inline int qGray( int r, int g, int b )// convert R,G,B to gray 0..255 { return (r*11+g*16+b*5)/32; } My question is, why is it spitting all these warning? how can I silence them without silencing other legitimate warnings (i.e. warnings that are related directly to my code and could be potential problems)? More importantly, why is mingw ignoring the dll import attribute in the first place?

    Read the article

  • Colorbox class don't work with ajax/dom object

    - by almal
    i usually use colorbox tool for open "popup windows" in my page and all are fine. In my new project the situation is little different because i use js/ajax/dom for create dinamically my objects in handleRequestStateChange() function. After import js,jquery and css for colorbox, in the head of my js page i write: $(document).ready(function () { $(window).scroll(function () { //oP1 = document.createTextNode(posizione_menu.offsetTop); //divIpt.appendChild(oMtx1); $(".divHcss").css("position", "fixed").css("top", "0px").css("z-index", "999"); }); //Examples of how to assign the Colorbox event to elements $(".group1").colorbox({rel:'group1'}); $(".group2").colorbox({rel:'group2', transition:"fade"}); $(".group3").colorbox({rel:'group3', transition:"none", width:"75%", height:"75%"}); $(".group4").colorbox({rel:'group4', slideshow:true}); $(".ajax").colorbox(); $(".youtube").colorbox({iframe:true, innerWidth:640, innerHeight:390}); $(".vimeo").colorbox({iframe:true, innerWidth:500, innerHeight:409}); $(".iframe").colorbox({iframe:true, width:"80%", height:"80%"}); $(".inline").colorbox({inline:true, width:"50%"}); $(".callbacks").colorbox({ onOpen:function(){ alert('onOpen: colorbox is about to open'); }, onLoad:function(){ alert('onLoad: colorbox has started to load the targeted content'); }, onComplete:function(){ alert('onComplete: colorbox has displayed the loaded content'); }, onCleanup:function(){ alert('onCleanup: colorbox has begun the close process'); }, onClosed:function(){ alert('onClosed: colorbox has completely closed'); } }); $('.non-retina').colorbox({rel:'group5', transition:'none'}) $('.retina').colorbox({rel:'group5', transition:'none', retinaImage:true, retinaUrl:true}); //Example of preserving a JavaScript event for inline calls. $("#click").click(function(){ $('#click').css({"background-color":"#f00", "color":"#fff", "cursor":"inherit"}).text("Open this window again and this message will still be here."); return false; }); }); and after in handleRequestStateChange() i create my a element and assign to a div: var a = createElement('a'); //a.style.display = "block"; a.setAttribute('class','iframe'); a.setAttribute('href',"php/whois.php?P1="+oStxt.value); var divIp3 = createElement('div', 'divIp3', 'divIp3css'); var divIp31 = createElement('div', 'divIp31', 'divIp31css'); divIp3.appendChild(divIp31); divIp3.appendChild(a); a.appendChild(divIp31); The divIp31 become linkable but the href open page in a normal browser tab and not using attribute class for colorbox. Someone have an idea about? Thanks in advance AM

    Read the article

  • how to open a .pdf file in a panel or iframe using asp.net c#

    - by rahul
    I am trying to open a .pdf file on a button click. I want to open a .pdf file into a panel or some iframe. With the following code i can only open .pdf file in a separate window or in a save as mode. string filepath = Server.MapPath("News.pdf"); FileInfo file = new FileInfo(filepath); if (file.Exists) { Response.ClearContent(); Response.AddHeader("Content-Disposition", "inline; filename=" + file.Name); Response.AddHeader("Content-Length", file.Length.ToString()); Response.ContentType = ReturnExtension(file.Extension.ToLower()); Response.TransmitFile(file.FullName); Response.End(); } how to assign a iframe to the below line Response.AddHeader("Content-Disposition", "inline; filename=" + file.Name);

    Read the article

  • Is possible to make mt.exe embed manifest files correctly in Visual Studio 2008?

    - by Sorin Sbarnea
    I found that mt.exe fails to correctly create and embed manifest files into executables when run inside a VCPROJ. For example the same executable load well on Windows 7 but failed to load on Windows XP. The manifest was embedded and correct. After I spend lots of hours searching for possible reasons and solution I modified the project settings to generate the manifest outside the exe file. Now it works on both systems. Here are the examples for debug builds. With embed disabled: <?xml version="1.0" encoding="UTF-8" standalone="yes"?> <assembly xmlns="urn:schemas-microsoft-com:asm.v1" manifestVersion="1.0"> <trustInfo xmlns="urn:schemas-microsoft-com:asm.v3"> <security> <requestedPrivileges> <requestedExecutionLevel level="asInvoker" uiAccess="false"></requestedExecutionLevel> </requestedPrivileges> </security> </trustInfo> <dependency> <dependentAssembly> <assemblyIdentity type="win32" name="Microsoft.VC90.DebugCRT" version="9.0.21022.8" processorArchitecture="x86" publicKeyToken="1fc8b3b9a1e18e3b"></assemblyIdentity> </dependentAssembly> </dependency> <dependency> <dependentAssembly> <assemblyIdentity type="win32" name="Microsoft.VC90.DebugMFC" version="9.0.21022.8" processorArchitecture="x86" publicKeyToken="1fc8b3b9a1e18e3b"></assemblyIdentity> </dependentAssembly> </dependency> </assembly> This is with embed enabled: <?xml version="1.0" encoding="UTF-8" standalone="yes" ?> <assembly xmlns="urn:schemas-microsoft-com:asm.v1" manifestVersion="1.0"> <trustInfo xmlns="urn:schemas-microsoft-com:asm.v3"> <security> <requestedPrivileges> <requestedExecutionLevel level="asInvoker" uiAccess="false" /> </requestedPrivileges> </security> </trustInfo> <dependency> <dependentAssembly> <assemblyIdentity type="win32" name="Microsoft.VC90.DebugCRT" version="9.0.21022.8" processorArchitecture="x86" publicKeyToken="1fc8b3b9a1e18e3b" /> </dependentAssembly> </dependency> <dependency> <dependentAssembly> <assemblyIdentity type="win32" name="Microsoft.VC90.DebugMFC" version="9.0.21022.8" processorArchitecture="x86" publicKeyToken="1fc8b3b9a1e18e3b" /> </dependentAssembly> </dependency> <dependency> <dependentAssembly> <assemblyIdentity type="win32" name="Microsoft.Windows.Common-Controls" version="6.0.0.0" processorArchitecture="x86" publicKeyToken="6595b64144ccf1df" language="*" /> </dependentAssembly> </dependency> </assembly> If you compare them the second one adds common controls (I don't know from where) and also it is a small difference with the syntax of requestedExecutionLevel tag.

    Read the article

  • C++ template partial specialization error

    - by JP19
    Hi, The following code is giving me a compilation error: class Q64 is not a valid type for a template constant parameter template<int GRIDD, class T> INLINE T grid_residue(T amount) { T rem = amount%(GRIDD); if (rem > GRIDD/2) rem -= GRIDD; return rem; } template<int GRIDD, Q64> INLINE Q64 grid_residue(Q64 amount) { return Q64(grid_residue<GRIDD, int64_t>(to_int(amount))); } Whats wrong? I am trying to specialize grid_residue for class Q64. thanks

    Read the article

  • Can't update textbox in TinyMCE

    - by Michael Tot Korsgaard
    I'm using TinyMCE, the text area is replaced with a TextBox, but when I try to update the database with the new text from my textbox, it wont update. Can anyone help me? My code looks like this <%@ Page Title="" Language="C#" MasterPageFile="~/Main.Master" AutoEventWireup="true" CodeBehind="default.aspx.cs" Inherits="Test_TinyMCE._default" ValidateRequest="false" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" runat="server"> <script src="JavaScript/tiny_mce/tiny_mce.js" type="text/javascript"></script> <script type="text/javascript"> tinyMCE.init({ // General options mode: "textareas", theme: "advanced", plugins: "pagebreak,style,layer,table,save,advhr,advimage,advlink,emotions,iespell,insertdatetime,pre view,media,searchreplace,print,contextmenu,paste,directionality,fullscreen,noneditable,visualchars,no nbreaking,xhtmlxtras,template,wordcount,advlist,autosave", // Theme options theme_advanced_buttons1: "save,newdocument,|,bold,italic,underline,strikethrough,|,justifyleft,justifycenter,justifyright,justifyfull,styleselect,formatselect,fontselect,fontsizeselect", theme_advanced_buttons2: "cut,copy,paste,pastetext,pasteword,|,search,replace,|,bullist,numlist,|,outdent,indent,blockquote,|,undo,redo,|,link,unlink,anchor,image,cleanup,help,code,|,insertdate,inserttime,preview,|,forecolor,backcolor", theme_advanced_buttons3: "tablecontrols,|,hr,removeformat,visualaid,|,sub,sup,|,charmap,emotions,iespell,media,advhr,|,print,|,ltr,rtl,|,fullscreen", theme_advanced_buttons4: "insertlayer,moveforward,movebackward,absolute,|,styleprops,|,cite,abbr,acronym,del,ins,attribs,|,visualchars,nonbreaking,template,pagebreak,restoredraft", theme_advanced_toolbar_location: "top", theme_advanced_toolbar_align: "left", theme_advanced_statusbar_location: "bottom", theme_advanced_resizing: true, // Example content CSS (should be your site CSS) // using false to ensure that the default browser settings are used for best Accessibility // ACCESSIBILITY SETTINGS content_css: false, // Use browser preferred colors for dialogs. browser_preferred_colors: true, detect_highcontrast: true, // Drop lists for link/image/media/template dialogs template_external_list_url: "lists/template_list.js", external_link_list_url: "lists/link_list.js", external_image_list_url: "lists/image_list.js", media_external_list_url: "lists/media_list.js", // Style formats style_formats: [ { title: 'Bold text', inline: 'b' }, { title: 'Red text', inline: 'span', styles: { color: '#ff0000'} }, { title: 'Red header', block: 'h1', styles: { color: '#ff0000'} }, { title: 'Example 1', inline: 'span', classes: 'example1' }, { title: 'Example 2', inline: 'span', classes: 'example2' }, { title: 'Table styles' }, { title: 'Table row 1', selector: 'tr', classes: 'tablerow1' } ], // Replace values for the template plugin template_replace_values: { username: "Some User", staffid: "991234" } }); </script> </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="ContentPlaceHolder1" runat="server"> <div> <asp:TextBox ID="TextBox1" runat="server" TextMode="MultiLine"></asp:TextBox> <br /> <asp:LinkButton ID="LinkButton1" runat="server" onclick="LinkButton1_Click">Update</asp:LinkButton> </div> </asp:Content> My codebhind looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Web.UI; using System.Web.UI.WebControls; namespace Test_TinyMCE { public partial class _default : System.Web.UI.Page { protected void Page_Load(object sender, EventArgs e) { TextBox1.Text = Database.GetFirst().Text; } protected void LinkButton1_Click(object sender, EventArgs e) { Database.Update(Database.GetFirst().ID, TextBox1.Text); TextBox1.Text = Database.GetFirst().Text; } } } And finally the "Database" class im using looks like this using System; using System.Collections.Generic; using System.Linq; using System.Web; using System.Configuration; using System.Data.SqlClient; namespace Test_TinyMCE { public class Database { public int ID { get; set; } public string Text { get; set; } public static void Update(int ID, string Text) { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Update Text set Text=@text where ID=@id"); command.Connection = connection; command.Parameters.Add(new SqlParameter("id", ID)); command.Parameters.Add(new SqlParameter("text", Text)); command.ExecuteNonQuery(); } finally { connection.Close(); } } public static Database GetFirst() { SqlConnection connection = new SqlConnection(ConfigurationManager.AppSettings["DatabaseConnection"]); connection.Open(); try { SqlCommand command = new SqlCommand("Select Top 1 ID, Text from Text order by ID asc"); command.Connection = connection; SqlDataReader reader = command.ExecuteReader(); if (reader.Read()) { Database item = new Database(); item.ID = reader.GetInt32(0); item.Text = reader.GetString(1); return item; } else { return null; } } finally { connection.Close(); } } } } I really hope that someone out there can help me

    Read the article

  • JQGrid and JQuery Autocomplete

    - by Neff
    When implementing JQGrid 4.3.0, Jquery 1.6.2, and JQuery UI 1.8.16 Ive come across an issue with the Inline edit. When the inline edit is activated, some of the elements get assigned an auto complete. When the inline edit is canceld or saved, the auto complete does not always go away (selecting text by double clicking it then hitting delete, then hitting escape to exit row edit). Leaving the auto complete controls in edit mode when the row is no longer considered in edit mode. Perhaps you can tell me if there is a problem with the initialization or if I you are aware of an event post-"afterrestorefunc" that the fields can be returned to their "original" state. Original state being displayed as data in the JQGrid row. I've tried removing the DOM after row close, .remove() and .empty(): ... "afterrestorefunc": function(){ $('.ui-autocomplete-input').remove(); } ... but that causes other issues, such as the jqgrid is not able to find the cell when serializing the row for data or edit, and requires a refresh of the page, not just jqgrid, to be able to once again see the data from that row. Auto complete functionality for the element is created on the double click of the row: function CreateCustomSearchElement(value, options, selectiontype) { ... var el; el = document.createElement("input"); ... $(el).autocomplete({ source: function (request, response) { $.ajax({ url: '<%=ResolveUrl("~/Services/AutoCompleteService.asmx/GetAutoCompleteResponse") %>', data: "{ 'prefixText': '" + request.term + "', 'contextKey': '" + options.name + "'}", dataType: "json", type: "POST", contentType: "application/json; charset=utf-8", success: function (data) { response($.map(data.d, function (item) { return { label: Trim(item), value: Trim(item), searchVal: Trim(item) } })) } }); }, select: function (e, item) { //Select is on the event of selection where the value and label have already been determined. }, minLength: 1, change: function (event, ui) { //if the active element was not the search button //... } }).keyup(function (e) { if (e.keyCode == 8 || e.keyCode == 46) { //If the user hits backspace or delete, check the value of the textbox before setting the searchValue //... } }).keydown(function (e) { //if keycode is enter key and there is a value, you need to validate the data through select or change(onblur) if (e.keyCode == '13' && ($(el).val())) { return false; } if (e.keyCode == '220') { return false } }); } Other Sources: http://www.trirand.com/jqgridwiki/doku.php?id=wiki:inline_editing http://api.jqueryui.com/autocomplete/ Update: I tried only creating the autocomplete when the element was focused, and removing it when onblur. That did not resolve the issue either. It seems to just need the autocomplete dropdown to be triggered.

    Read the article

  • Turn off enclosing <p> tags in CKEditor 3.0

    - by Kosi2801
    Is there a possibility to turn off the automatic enclosing of all written content within <p></p> in CKEditor 3.x? I tried CKEDITOR.config.enterMode = CKEDITOR.ENTER_BR; but this just changes the inline linebreaks to <br /> while leaving the enclosing paragraph. Currently writing "Test" produces this output <p> Test</p> but I want it to be simply Test Is there a configuration property for this or would another inline editor to be better suited for this?

    Read the article

  • pure-specifier on function-definition

    - by bebul
    While compiling on GCC I get the error: pure-specifier on function-definition, but not when I compile the same code using VS2005. class Dummy { //error: pure-specifier on function-definition, VS2005 compiles virtual void Process() = 0 {}; }; But when the definition of this pure virtual function is not inline, it works: class Dummy { virtual void Process() = 0; }; void Dummy::Process() {} //compiles on both GCC and VS2005 What does the error means? Why cannot I do it inline? Is it legal to evade the compile issue as shown in the second code sample?

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

< Previous Page | 79 80 81 82 83 84 85 86 87 88 89 90  | Next Page >