compiling from source - Page 832

flex and bison: wrong output

- by user2972227

I am doing a homework using flex and bison to make a complex number calculator. But my program cannot give a correct output. .lex file: %option noyywrap %{ #include<stdio.h> #include<stdlib.h> #include "complex_cal.h" #define YYSTYPE complex #include "complex_cal.tab.h" void RmWs(char* str); %} /* Add your Flex definitions here */ /* Some definitions are already provided to you*/ ws [ \t]+ digits [0-9] number (0|[1-9]+{digits}*)\.?{digits}* im [i] complexnum {ws}*[-]*{ws}*{number}{ws}*[+|-]{ws}*{number}{ws}*{im}{ws}* op [-+*/()] %% {complexnum} {RmWs(yytext); sscanf(yytext,"%lf %lf",&(yylval.real),&(yylval.img)); return CNUMBER;} {ws} /**/ {op} return *yytext; %% /* function provided to student to remove */ /* all the whitespaces from a string. */ void RmWs(char* str){ int i=0,j=0; char temp[strlen(str)+1]; strcpy(temp,str); while (temp[i]!='\0'){ while (temp[i]==' '){i++;} str[j]=temp[i]; i++; j++; } str[j]='\0'; } .y file: %{ #include <stdio.h> #include <stdlib.h> #include "complex_cal.h" /* prototypes of the provided functions */ complex complex_add (complex, complex); complex complex_sub (complex, complex); complex complex_mul (complex, complex); complex complex_div (complex, complex); /* prototypes of the provided functions */ int yylex(void); int yyerror(const char*); %} %token CNUMBER %left '+' '-' %left '*' '/' %nonassoc '(' ')' %% /* start: Add your grammar rules and actions here */ complexexp: complexexp '+' complexexpmultidiv {$$=complex_add($1, $3);} | complexexp '-' complexexpmultidiv {$$=complex_sub($1, $3);} | complexexpmultidiv {$$.real=$1.real;$$.img=$1.img;} ; complexexpmultidiv: complexexpmultidiv '*' complexsimple {$$=complex_mul($1, $3);} | complexexpmultidiv '/' complexsimple {$$=complex_div($1, $3);} | complexsimple {$$.real=$1.real;$$.img=$1.img;} ; complexsimple: '(' complexexp ')' {$$.real=$2.real;$$.img=$2.img;} | '(' CNUMBER ')' {$$.real=$2.real;$$.img=$2.img;} ; /* end: Add your grammar rules and actions here */ %% int main(){ return yyparse(); } int yyerror(const char* s){ printf("%s\n", s); return 0; } /* function provided to do complex addition */ /* input : complex numbers c1, c2 */ /* output: nothing */ /* side effect : none */ /* return value: result of addition in c3 */ complex complex_add (complex c1, complex c2){ /* c1 + c2 */ complex c3; c3.real = c1.real + c2.real; c3.img = c1.img + c2.img; return c3; } /* function provided to do complex subtraction */ /* input : complex numbers c1, c2 */ /* output: nothing */ /* side effect : none */ /* return value: result of subtraction in c3 */ complex complex_sub (complex c1, complex c2){ /* c1 - c2 */ complex c3; c3.real = c1.real - c2.real; c3.img = c1.img - c2.img; return c3; } /* function provided to do complex multiplication */ /* input : complex numbers c1, c2 */ /* output: nothing */ /* side effect : none */ /* return value: result of multiplication in c3 */ complex complex_mul (complex c1, complex c2){ /* c1 * c2 */ complex c3; c3.real = c1.real*c2.real - c1.img*c2.img; c3.img = c1.img*c2.real + c1.real*c2.img; return c3; } /* function provided to do complex division */ /* input : complex numbers c1, c2 */ /* output: nothing */ /* side effect : none */ /* return value: result of c1/c2 in c3 */ complex complex_div (complex c1, complex c2){ /* c1 / c2 (i.e. c1 divided by c2 ) */ complex c3; double d; /*divisor calculation using the conjugate of c2*/ d = c2.real*c2.real + c2.img*c2.img; c3.real = (c1.real*c2.real + c1.img*c2.img)/d; c3.img = (c1.img*c2.real - c1.real*c2.img)/d; return c3; } .h file: #include <string.h> /* struct for holding a complex number */ typedef struct { double real; double img; } complex; /* define the return type of FLEX */ #define YYSTYPE complex Script for compiling the file: bison -d -v complex_cal.y flex -ocomplex_cal.lex.yy.c complex_cal.lex gcc -o complex_cal complex_cal.lex.yy.c complex_cal.tab.c ./complex_cal Some correct sample run of the program: input:(5+6i)*(6+1i) output:24.000000+41.000000i input:(7+8i)/(-3-4i)*(5+7i) output:-11.720000-14.040000i input:(7+8i)/((-3-4i)*(5+7i)) output:-0.128108+0.211351i But when I run this program, the program only give an output which is identical to my input. For example, when I input (5+6i)(6+1i), it just gives (5+6i)(6+1i). Even if I input any other things, for example, input "abc" it just gives "abc" and is not syntax error. I don't know where the problem is and I hope to know how to solve it.

Read the article

sqlite no such table

- by Graham B

can anyone please help. I've seen many people with the same problem and looked at all suggestions but still cannot get this to work. I have tried to unistall the application and install again, I have tried to change the version number and start again. I've debugged the code and it does go into the onCreate function, but when I go to make a select query it says the users table does not exist. Any help would greatly be appreciated. Thanks guys DatabaseHandler Class public class DatabaseHandler extends SQLiteOpenHelper { // Variables protected static final int DATABASE_VERSION = 1; protected static final String DATABASE_NAME = "MyUser.db"; // Constructor public DatabaseHandler(Context context) { super(context, DATABASE_NAME, null, DATABASE_VERSION); } // Creating Tables @Override public void onCreate(SQLiteDatabase db) { // Create the Users table // NOTE: I have the column variables saved above String CREATE_USERS_TABLE = "CREATE TABLE IF NOT EXISTS Users(" + KEY_PRIMARY_ID + " " + INTEGER + " " + PRIMARY_KEY + " " + AUTO_INCREMENT + " " + NOT_NULL + "," + USERS_KEY_EMAIL + " " + NVARCHAR+"(1000)" + " " + UNIQUE + " " + NOT_NULL + "," + USERS_KEY_PIN + " " + NVARCHAR+"(10)" + " " + NOT_NULL + ")"; db.execSQL(CREATE_USERS_TABLE); } // Upgrading database @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { db.execSQL("DROP TABLE IF EXISTS Users"); onCreate(db); } UserDataSource class public class UserDataSource { private SQLiteDatabase db; private DatabaseHandler dbHandler; public UserDataSource(Context context) { dbHandler = new DatabaseHandler(context); } public void OpenWriteable() throws SQLException { db = dbHandler.getWritableDatabase(); } public void Close() { dbHandler.close(); } // Validate the user login with the username and password provided public void ValidateLogin(String username, String pin) throws CustomException { Cursor cursor = db.rawQuery( "select * from Users where " + DatabaseHandler.USERS_KEY_EMAIL + " = '" + username + "'" + " and " + DatabaseHandler.USERS_KEY_PIN + " = '" + pin + "'" , null); ........ } Then in the activity class, I'm calling UserDataSource uds = new UserDataSource (this); uds.OpenWriteable(); uds.ValidateLogin("name", "pin"); Any help would be great, thanks very much Graham The following is the attached log from the error report 11-23 17:47:46.414: I/SqliteDatabaseCpp(26717): sqlite returned: error code = 1, msg = no such table: Users, db=/data/data/prometric.myitemwriter/databases/MyUser.db 11-23 17:47:57.085: D/AndroidRuntime(26717): Shutting down VM 11-23 17:47:57.085: W/dalvikvm(26717): threadid=1: thread exiting with uncaught exception (group=0x40bec1f8) 11-23 17:47:57.171: D/dalvikvm(26717): GC_CONCURRENT freed 575K, 8% free 8649K/9351K, paused 2ms+6ms 11-23 17:47:57.179: E/AndroidRuntime(26717): FATAL EXCEPTION: main 11-23 17:47:57.179: E/AndroidRuntime(26717): java.lang.IllegalStateException: Could not execute method of the activity 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.view.View$1.onClick(View.java:3091) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.view.View.performClick(View.java:3558) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.view.View$PerformClick.run(View.java:14152) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.os.Handler.handleCallback(Handler.java:605) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.os.Handler.dispatchMessage(Handler.java:92) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.os.Looper.loop(Looper.java:137) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.app.ActivityThread.main(ActivityThread.java:4514) 11-23 17:47:57.179: E/AndroidRuntime(26717): at java.lang.reflect.Method.invokeNative(Native Method) 11-23 17:47:57.179: E/AndroidRuntime(26717): at java.lang.reflect.Method.invoke(Method.java:511) 11-23 17:47:57.179: E/AndroidRuntime(26717): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:790) 11-23 17:47:57.179: E/AndroidRuntime(26717): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:557) 11-23 17:47:57.179: E/AndroidRuntime(26717): at dalvik.system.NativeStart.main(Native Method) 11-23 17:47:57.179: E/AndroidRuntime(26717): Caused by: java.lang.reflect.InvocationTargetException 11-23 17:47:57.179: E/AndroidRuntime(26717): at java.lang.reflect.Method.invokeNative(Native Method) 11-23 17:47:57.179: E/AndroidRuntime(26717): at java.lang.reflect.Method.invoke(Method.java:511) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.view.View$1.onClick(View.java:3086) 11-23 17:47:57.179: E/AndroidRuntime(26717): ... 11 more 11-23 17:47:57.179: E/AndroidRuntime(26717): Caused by: android.database.sqlite.SQLiteException: no such table: Users: , while compiling: select * from Users where email = '' and pin = '' 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteCompiledSql.native_compile(Native Method) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteCompiledSql.<init>(SQLiteCompiledSql.java:68) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteProgram.compileSql(SQLiteProgram.java:143) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteProgram.compileAndbindAllArgs(SQLiteProgram.java:361) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteProgram.<init>(SQLiteProgram.java:127) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteProgram.<init>(SQLiteProgram.java:94) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteQuery.<init>(SQLiteQuery.java:53) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteDirectCursorDriver.query(SQLiteDirectCursorDriver.java:47) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteDatabase.rawQueryWithFactory(SQLiteDatabase.java:1685) 11-23 17:47:57.179: E/AndroidRuntime(26717): at android.database.sqlite.SQLiteDatabase.rawQuery(SQLiteDatabase.java:1659) 11-23 17:47:57.179: E/AndroidRuntime(26717): at projectname.database.UserDataSource.ValidateLogin(UserDataSource.java:73) 11-23 17:47:57.179: E/AndroidRuntime(26717): at projectname.LoginActivity.btn_login_Click(LoginActivity.java:47) 11-23 17:47:57.179: E/AndroidRuntime(26717): ... 14 more

Read the article

Repeated Squaring - Matrix Multiplication using NEWMAT

- by Dinakar Kulkarni

I'm trying to use the repeated squaring algorithm (using recursion) to perform matrix exponentiation. I've included header files from the NEWMAT library instead of using arrays. The original matrix has elements in the range (-5,5), all numbers being of type float. # include "C:\User\newmat10\newmat.h" # include "C:\User\newmat10\newmatio.h" # include "C:\User\newmat10\newmatap.h" # include <iostream> # include <time.h> # include <ctime> # include <cstdlib> # include <iomanip> using namespace std; Matrix repeated_squaring(Matrix A, int exponent, int n) //Recursive function { A(n,n); IdentityMatrix I(n); if (exponent == 0) //Matrix raised to zero returns an Identity Matrix return I; else { if ( exponent%2 == 1 ) // if exponent is odd return (A * repeated_squaring (A*A, (exponent-1)/2, n)); else //if exponent is even return (A * repeated_squaring( A*A, exponent/2, n)); } } Matrix direct_squaring(Matrix B, int k, int no) //Brute Force Multiplication { B(no,no); Matrix C = B; for (int i = 1; i <= k; i++) C = B*C; return C; } //----Creating a matrix with elements b/w (-5,5)---- float unifRandom() { int a = -5; int b = 5; float temp = (float)((b-a)*( rand()/RAND_MAX) + a); return temp; } Matrix initialize_mat(Matrix H, int ord) { H(ord,ord); for (int y = 1; y <= ord; y++) for(int z = 1; z<= ord; z++) H(y,z) = unifRandom(); return(H); } //--------------------------------------------------- void main() { int exponent, dimension; cout<<"Insert exponent:"<<endl; cin>>exponent; cout<< "Insert dimension:"<<endl; cin>>dimension; cout<<"The number of rows/columns in the square matrix is: "<<dimension<<endl; cout<<"The exponent is: "<<exponent<<endl; Matrix A(dimension,dimension),B(dimension,dimension); Matrix C(dimension,dimension),D(dimension,dimension); B= initialize_mat(A,dimension); cout<<"Initial Matrix: "<<endl; cout<<setw(5)<<setprecision(2)<<B<<endl; //----------------------------------------------------------------------------- cout<<"Repeated Squaring Result: "<<endl; clock_t time_before1 = clock(); C = repeated_squaring (B, exponent , dimension); cout<< setw(5) <<setprecision(2) <<C; clock_t time_after1 = clock(); float diff1 = ((float) time_after1 - (float) time_before1); cout << "It took " << diff1/CLOCKS_PER_SEC << " seconds to complete" << endl<<endl; //--------------------------------------------------------------------------------- cout<<"Direct Squaring Result:"<<endl; clock_t time_before2 = clock(); D = direct_squaring (B, exponent , dimension); cout<<setw(5)<<setprecision(2)<<D; clock_t time_after2 = clock(); float diff2 = ((float) time_after2 - (float) time_before2); cout << "It took " << diff2/CLOCKS_PER_SEC << " seconds to complete" << endl<<endl; } I face the following problems: The random number generator returns only "-5" as each element in the output. The Matrix multiplication yield different results with brute force multiplication and using the repeated squaring algorithm. I'm timing the execution time of my code to compare the times taken by brute force multiplication and by repeated squaring. Could someone please find out what's wrong with the recursion and with the matrix initialization? NOTE: While compiling this program, make sure you've imported the NEWMAT library. Thanks in advance!

Read the article

Confusion testing fftw3 - poisson equation 2d test

- by user3699736

I am having trouble explaining/understanding the following phenomenon: To test fftw3 i am using the 2d poisson test case: laplacian(f(x,y)) = - g(x,y) with periodic boundary conditions. After applying the fourier transform to the equation we obtain : F(kx,ky) = G(kx,ky) /(kx² + ky²) (1) if i take g(x,y) = sin (x) + sin(y) , (x,y) \in [0,2 \pi] i have immediately f(x,y) = g(x,y) which is what i am trying to obtain with the fft : i compute G from g with a forward Fourier transform From this i can compute the Fourier transform of f with (1). Finally, i compute f with the backward Fourier transform (without forgetting to normalize by 1/(nx*ny)). In practice, the results are pretty bad? (For instance, the amplitude for N = 256 is twice the amplitude obtained with N = 512) Even worse, if i try g(x,y) = sin(x)*sin(y) , the curve has not even the same form of the solution. (note that i must change the equation; i divide by two the laplacian in this case : (1) becomes F(kx,ky) = 2*G(kx,ky)/(kx²+ky²) Here is the code: /* * fftw test -- double precision */ #include <iostream> #include <stdio.h> #include <stdlib.h> #include <math.h> #include <fftw3.h> using namespace std; int main() { int N = 128; int i, j ; double pi = 3.14159265359; double *X, *Y ; X = (double*) malloc(N*sizeof(double)); Y = (double*) malloc(N*sizeof(double)); fftw_complex *out1, *in2, *out2, *in1; fftw_plan p1, p2; double L = 2.*pi; double dx = L/((N - 1)*1.0); in1 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); out2 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); out1 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); in2 = (fftw_complex*) fftw_malloc(sizeof(fftw_complex)*(N*N) ); p1 = fftw_plan_dft_2d(N, N, in1, out1, FFTW_FORWARD,FFTW_MEASURE ); p2 = fftw_plan_dft_2d(N, N, in2, out2, FFTW_BACKWARD,FFTW_MEASURE); for(i = 0; i < N; i++){ X[i] = -pi + (i*1.0)*2.*pi/((N - 1)*1.0) ; for(j = 0; j < N; j++){ Y[j] = -pi + (j*1.0)*2.*pi/((N - 1)*1.0) ; in1[i*N + j][0] = sin(X[i]) + sin(Y[j]) ; // row major ordering //in1[i*N + j][0] = sin(X[i]) * sin(Y[j]) ; // 2nd test case in1[i*N + j][1] = 0 ; } } fftw_execute(p1); // FFT forward for ( i = 0; i < N; i++){ // f = g / ( kx² + ky² ) for( j = 0; j < N; j++){ in2[i*N + j][0] = out1[i*N + j][0]/ (i*i+j*j+1e-16); in2[i*N + j][1] = out1[i*N + j][1]/ (i*i+j*j+1e-16); //in2[i*N + j][0] = 2*out1[i*N + j][0]/ (i*i+j*j+1e-16); // 2nd test case //in2[i*N + j][1] = 2*out1[i*N + j][1]/ (i*i+j*j+1e-16); } } fftw_execute(p2); //FFT backward // checking the results computed double erl1 = 0.; for ( i = 0; i < N; i++) { for( j = 0; j < N; j++){ erl1 += fabs( in1[i*N + j][0] - out2[i*N + j][0]/N/N )*dx*dx; cout<< i <<" "<< j<<" "<< sin(X[i])+sin(Y[j])<<" "<< out2[i*N+j][0]/N/N <<" "<< endl; // > output } } cout<< erl1 << endl ; // L1 error fftw_destroy_plan(p1); fftw_destroy_plan(p2); fftw_free(out1); fftw_free(out2); fftw_free(in1); fftw_free(in2); return 0; } I can't find any (more) mistakes in my code (i installed the fftw3 library last week) and i don't see a problem with the maths either but i don't think it's the fft's fault. Hence my predicament. I am all out of ideas and all out of google as well. Any help solving this puzzle would be greatly appreciated. note : compiling : g++ test.cpp -lfftw3 -lm executing : ./a.out output and i use gnuplot in order to plot the curves : (in gnuplot ) splot "output" u 1:2:4 ( for the computed solution )

Read the article

Intellij Idea 13.x and ASM 5.x library incompatible?

- by Jarrod Roberson

I can't get Intellij Idea 13.0 to compile my code against ASM 5.0.3 I have a multi-module Maven project. It compiles and installs successfully. Apparently com.google.findbugs:findbugs has a dependency on asm:asm:3.3 and I want to use org.ow2.asm:asm:5.0.3 to manipulate some bytecode. So in the parent pom.xml I exclude the asm:asm:3.3 dependencies from the classpath. This works fine when I run mvn install from the command line. I can't get the Build - Make Project menu selection to work in Intellij Idea. Here is the relevant parts of my pom.xml files. parent.pom <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-tree</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-util</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-commons</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>com.google.code.findbugs</groupId> <artifactId>findbugs</artifactId> <version>2.0.3</version> <exclusions> <exclusion> <groupId>asm</groupId> <artifactId>asm</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-commons</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-tree</artifactId> </exclusion> </exclusions> </dependency> Here is the code that is failing 18 public static void main(final String[] args) throws IOException 19 { 20 final InputStream is = NotEmptyTest.class.getResourceAsStream("/com/vertigrated/annotation/NotEmptyTest.class"); 21 final ClassReader cr = new ClassReader(is); 22 final ClassNode cn = new ClassNode(); 23 cr.accept(cn, 0); 24 for (final MethodNode mn : cn.methods) 25 { 26 - 38 snipped for brevity 39 } 40 } 41 } Here is the error message: Information:Using javac 1.7.0_25 to compile java sources Information:java: Errors occurred while compiling module 'tests' Information:Compilation completed with 1 error and 2 warnings in 2 sec Information:1 error Information:2 warnings /<path to my source code>/NotEmptyTest.java Error:Error:line (24)java: incompatible types required: org.objectweb.asm.tree.MethodNode found: java.lang.Object Warning:Warning:java: /<path to my project>//NotEmptyTest.java uses unchecked or unsafe operations. Warning:Warning:java: Recompile with -Xlint:unchecked for details. As you can see in the screen capture, it reports the correct version of the libraries in the Javadoc but the AutoComplete shows the old 3.3 non-typesafe return value of List instead of List<MethodNode>: Here is what Maven knows, which is correct: [INFO] --- maven-dependency-plugin:2.8:list (default-cli) @ tests --- [INFO] [INFO] The following files have been resolved: [INFO] com.google.code.findbugs:bcel:jar:2.0.1:compile [INFO] junit:junit:jar:4.11:test [INFO] xml-apis:xml-apis:jar:1.0.b2:compile [INFO] com.apple:AppleJavaExtensions:jar:1.4:compile [INFO] javax.inject:javax.inject:jar:1:compile [INFO] jaxen:jaxen:jar:1.1.6:compile [INFO] org.ow2.asm:asm-util:jar:5.0.3:compile [INFO] com.google.inject:guice:jar:3.0:compile [INFO] dom4j:dom4j:jar:1.6.1:compile [INFO] com.google.code.findbugs:jFormatString:jar:2.0.1:compile [INFO] net.jcip:jcip-annotations:jar:1.0:compile [INFO] org.ow2.asm:asm-tree:jar:5.0.3:compile [INFO] commons-lang:commons-lang:jar:2.6:compile [INFO] com.google.code.findbugs:jsr305:jar:2.0.1:compile [INFO] org.hamcrest:hamcrest-core:jar:1.3:test [INFO] aopalliance:aopalliance:jar:1.0:compile [INFO] com.google.code.findbugs:findbugs:jar:2.0.3:compile [INFO] org.ow2.asm:asm-commons:jar:5.0.3:compile [INFO] org.ow2.asm:asm:jar:5.0.3:compile How do I get Intellij Idea to use the correct dependency internally?

Read the article

how to run/compile java code from JTextArea at Runtime? ----urgent!!! college project

- by Lokesh Kumar

I have a JInternalFrame painted with a BufferedImage and contained in the JDesktopPane of a JFrame.I also have a JTextArea where i want to write some java code (function) that takes the current JInternalFrame's painted BufferedImage as an input and after doing some manipulation on this input it returns another manipulated BufferedImage that paints the JInternalFrame with new manipulated Image again!!. Manipulation java code of JTextArea:- public BufferedImage customOperation(BufferedImage CurrentInputImg) { Color colOld; Color colNew; BufferedImage manipulated=new BufferedImage(CurrentInputImg.getWidth(),CurrentInputImg.getHeight(),BufferedImage.TYPE_INT_ARGB); //make all Red pixels of current image black for(int i=0;i< CurrentInputImg.getWidth();i++) { for(int j=0;j< CurrentInputImg.getHeight(),j++) { colOld=new Color(CurrentInputImg.getRGB(i,j)); colNew=new Color(0,colOld.getGreen(),colOld.getBlue(),colOld.getAlpha()); manipulated.setRGB(i,j,colNew.getRGB()); } } return manipulated; } so,how can i run/compile this JTextArea java code at runtime and get a new manipulated image for painting on JInternalFrame??????? Here is my Main class: (This class is not actual one but i have created it for u for basic interfacing containing JTextArea,JInternalFrame,Apply Button) import java.awt.*; import java.awt.event.*; import javax.swing.*; import javax.swing.event.*; import javax.swing.JInternalFrame; import javax.swing.JDesktopPane; import java.awt.image.*; import javax.imageio.*; import java.io.*; import java.io.File; import java.util.*; class MyCustomOperationSystem extends JFrame **{** public JInternalFrame ImageFrame; public BufferedImage CurrenFrameImage; public MyCustomOperationSystem() **{** setTitle("My Custom Image Operations"); setSize((int)Toolkit.getDefaultToolkit().getScreenSize().getWidth(),(int)Toolkit.getDefaultToolkit().getScreenSize().getHeight()); JDesktopPane desktop=new JDesktopPane(); desktop.setPreferredSize(new Dimension((int)Toolkit.getDefaultToolkit().getScreenSize().getWidth(),(int)Toolkit.getDefaultToolkit().getScreenSize().getHeight())); try{ CurrenFrameImage=ImageIO.read(new File("c:/Lokesh.png")); }catch(Exception exp) { System.out.println("Error in Loading Image"); } ImageFrame=new JInternalFrame("Image Frame",true,true,false,true); ImageFrame.setMinimumSize(new Dimension(CurrenFrameImage.getWidth()+10,CurrenFrameImage.getHeight()+10)); ImageFrame.getContentPane().add(CreateImagePanel()); ImageFrame.setLayer(1); ImageFrame.setLocation(100,100); ImageFrame.setVisible(true); desktop.setOpaque(true); desktop.setBackground(Color.darkGray); desktop.add(ImageFrame); this.getContentPane().setLayout(new BorderLayout()); this.getContentPane().add("Center",desktop); this.getContentPane().add("South",ControlPanel()); pack(); setVisible(true); **}** public JPanel CreateImagePanel(){ JPanel tempPanel=new JPanel(){ public void paintComponent(Graphics g) { g.drawImage(CurrenFrameImage,0,0,this); } }; tempPanel.setPreferredSize(new Dimension(CurrenFrameImage.getWidth(),CurrenFrameImage.getHeight())); return tempPanel; } public JPanel ControlPanel(){ JPanel controlPan=new JPanel(new FlowLayout(FlowLayout.LEFT)); JButton customOP=new JButton("Custom Operation"); customOP.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent evnt){ JFrame CodeFrame=new JFrame("Write your Code Here"); JTextArea codeArea=new JTextArea("Your Java Code Here",100,70); JScrollPane codeScrollPan=new JScrollPane(codeArea,ScrollPaneConstants.VERTICAL_SCROLLBAR_ALWAYS, ScrollPaneConstants.HORIZONTAL_SCROLLBAR_ALWAYS); CodeFrame.add(codeScrollPan); CodeFrame.setVisible(true); } }); JButton Apply=new JButton("Apply Code"); Apply.addActionListener(new ActionListener(){ public void actionPerformed(ActionEvent event){ // What should I do!!! Here!!!!!!!!!!!!!!! } }); controlPan.add(customOP); controlPan.add(Apply); return controlPan; } public static void main(String s[]) { new MyCustomOperationSystem(); } } Note: in above class JInternalFrame (ImageFrame) is not visible even i have declared it visible. so, ImageFrame is not visible while compiling and running above class. U have to identify this problem before running it.

Read the article

C++ destructor seems to be called 'early'

- by suicideducky

Please see the "edit" section for the updated information. Sorry for yet another C++ dtor question... However I can't seem to find one exactly like mine as all the others are assigning to STL containers (that will delete objects itself) whereas mine is to an array of pointers. So I have the following code fragment #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } }; template <class T> class Octree{ T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(){ for( int i=0; i<8; i++ ) children[i] = new T; } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Looking through the output I notice that the destructor is being called many times before I think it should (as Octree is still in scope), the end of the output also shows: del:0 del:0 del:1 del:2 del:3 Process returned -1073741819 (0xC0000005) execution time : 1.685 s Press any key to continue. For some reason the destructor is going through the same point in the loop twice (0) and then dying. All of this occures before the "nothing seems to have gone wrong" line which I expected before any dtor was called. Thanks in advance :) EDIT The code I posted has some things removed that I thought were unnecessary but after copying and compiling the code I pasted I no longer get the error. What I removed was other integer attributes of the code. Here is the origional: #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } Block(int xx, int yy, int zz, int ty){ x=xx; y=yy; z=zz; type=ty; } Block(int xx, int yy, int zz){ x=xx; y=yy; z=zz; type=0; } }; template <class T> class Octree{ int x, y, z; int size; T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(int xx, int yy, int zz, int size){ x=xx; y=yy; z=zz; size=size; for( int i=0; i<8; i++ ) children[i] = new T; } Octree(){ Octree(0, 0, 0, 10); } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Also, as for the problems with set_child, get_child and swap_child leading to possible memory leaks this will be solved as a wrapper class will either use get before set or use swap to get the old child and write this out to disk before freeing the memory itself. I am glad that it is not my memory management failing but rather another error. I have not made a copy and/or assignment operator yet as I was just testing the block tree out, I will almost certainly make them all private very soon. This version spits out -1073741819. Thank you all for your suggestions and I apologise for highjacking my own thread :$

Read the article

Parse a text file into multiple text file

- by Vijay Kumar Singh

I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\$",""); b[i][j]=b[i][j].replaceAll("\$",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

Read the article

Hard to append a table with many records into another without generating duplicates

- by Bill Mudry

I may seem to be a bit wordy at first but for the hope it will be easier for all of you to understand what I am doing in the first place. I have an uncommon but enjoyable activity of collecting as many species of wood from around the world as I can (over 2,900 so far). Ok, that is the real world. Meanwhile I have spent over 8 years compiling over 5.8 meg of text data on all the woods of the world. That got so large that learning some basic PHP and MySQL was most welcome so I could build a new database driven home for all this research. I am still slow at it but getting there. The original premise was to find evidence of as many species of woods in the world I can. The more names identified, the more successful the project. I have named the project TAXA for ease of conversation (short for Taxonomy). You are most welcome to take a look at what I have so far at www.prowebcanada.com/taxa. It is 95% dynamically driven. So far I am reporting about 6,500 botanical wood names and, as said above, the more I can report, the more successful is the project. I have a file of all the woods in the second largest wood collection in the world, the Tervuren wood collection in the Netherlands with over 11,300 wood names even after cleaning out all duplicates. That is almost twice the number I am reporting now so porting all the new wood names from Tervuren to the 'species' table where I keep the reported data would be a major desirable advancement in the project. At one point I was able to add all the Tervuren records to the species table but over 3,000 duplicates also formed. They were not in the Tervuren file in the first place but represent the same wood names common to both files. It is common sense that there would be woods common to both that when merged would create new duplicates. At one point and with the help of others from another forum, I may very well have finally got the proper SQL statement. When I ran it, though, the system said (semi-amusingly at first) ----- that it had gone away! After looking up on the Net what could have have done this, one reason is that the MySQL timeout lapses and probably because of the large size of files I am running. I am running this on a rented account on Godaddy so I cannot go about trying to adjust any config file. For safety, I copied the tervuren.sql file as tervuren_target.sql and the species.sql file as species_master.sql tp use as working files just to make sure I protect the original files from destruction or damage. Later I can name the species_master back to just species.sql once I am happy all worked well. The species file has about 18 columns in it but only 5 columns match the columns in the Tervuren file (name for name and collation also). The rest of the columns are just along for the ride, so to speak. The common key in both is the 'species_name" columns in both. I am not sure it is at all proper to call one a primary key and the other a foreign key since there really is no relational connection to them. One is just more data for the other and can disappear after, never to be referred to the working code in the application. I have been very surprised and flabbergasted on how hard it can be to append records from one large table into another (with same column names plus others) without generating NEW duplicates in the first place. Watch out thinking that a SELECT DISTINCT statement may do the job because absolutely NO records in the species table must get destroyed in the process and there is no way (well, that I know of) to tell the 'DISTINCT" command this. Yes, the original 'species' table has duplicates in it even before all this but, trust me ---- they have to be removed the long hard way manually record by record or I will lose precious information. It is more important to just make sure no NEW duplicates form through bringing in new names in the tervuren_target.species_name into species.species_name. I am hoping and thinking that a straight SQL solution should work --- except for that nasty timeout. How do I get past that? Could it mean that I may have to turn to a PHP plus SQL method?? Or ..... would I have to break up the Tervuren files into a few smaller ones and run them independently (hope not....)" So far, what seems should be easy has proven to be unexpectedly tricky. I appreciate any help you can give but start from the assumption that this may be harder to do right than it may seem on the surface. By the way --- I am running a quad 64 bit system with Windows 7, so at least I have some fairly hefty power on the client end. I have a direct ethernet cable feeding a cable connection to the Internet. Once I get an algorithm and code working for this, I also have many other lists to process that could make the 'species' table grow even more. It could be equivalent to (ahem) lighting a rocket under my project (especially compared to do this record by record manually)! This is my first time in this forum, so I do not know how I can receive any replies. Do I have to to come back here periodically or are replies emailed out also? It would be great if you CC'd copies to me at billmudry at rogers.com :-) Much thanks for your patience and help, Bill Mudry Mississauga, Ontario Canada (next to Toronto).

Read the article

Embedding mercurial revision information in Visual Studio c# projects automatically

- by Mark Booth

Original Problem In building our projects, I want the mercurial id of each repository to be embedded within the product(s) of that repository (the library, application or test application). I find it makes it so much easier to debug an application ebing run by custiomers 8 timezones away if you know precisely what went into building the particular version of the application they are using. As such, every project (application or library) in our systems implement a way of getting at the associated revision information. I also find it very useful to be able to see if an application has been compiled with clean (un-modified) changesets from the repository. 'Hg id' usefully appends a + to the changeset id when there are uncommitted changes in a repository, so this allows is to easily see if people are running a clean or a modified version of the code. My current solution is detailed below, and fulfills the basic requirements, but there are a number of problems with it. Current Solution At the moment, to each and every Visual Studio solution, I add the following "Pre-build event command line" commands: cd $(ProjectDir) HgID I also add an HgID.bat file to the Project directory: @echo off type HgId.pre > HgId.cs For /F "delims=" %%a in ('hg id') Do <nul >>HgID.cs set /p = @"%%a" echo ; >> HgId.cs echo } >> HgId.cs echo } >> HgId.cs along with an HgId.pre file, which is defined as: namespace My.Namespace { /// <summary> Auto generated Mercurial ID class. </summary> internal class HgID { /// <summary> Mercurial version ID [+ is modified] [Named branch]</summary> public const string Version = When I build my application, the pre-build event is triggered on all libraries, creating a new HgId.cs file (which is not kept under revision control) and causing the library to be re-compiled with with the new 'hg id' string in 'Version'. Problems with the current solution The main problem is that since the HgId.cs is re-created at each pre-build, every time we need to compile anything, all projects in the current solution are re-compiled. Since we want to be able to easily debug into our libraries, we usually keep many libraries referenced in our main application solution. This can result in build times which are significantly longer than I would like. Ideally I would like the libraries to compile only if the contents of the HgId.cs file has actually changed, as opposed to having been re-created with exactly the same contents. The second problem with this method is it's dependence on specific behaviour of the windows shell. I've already had to modify the batch file several times, since the original worked under XP but not Vista, the next version worked under Vista but not XP and finally I managed to make it work with both. Whether it will work with Windows 7 however is anyones guess and as time goes on, I see it more likely that contractors will expect to be able to build our apps on their Windows 7 boxen. Finally, I have an aesthetic problem with this solution, batch files and bodged together template files feel like the wrong way to do this. My actual questions How would you solve/how are you solving the problem I'm trying to solve? What better options are out there than what I'm currently doing? Rejected Solutions to these problems Before I implemented the current solution, I looked at Mercurials Keyword extension, since it seemed like the obvious solution. However the more I looked at it and read peoples opinions, the more that I came to the conclusion that it wasn't the right thing to do. I also remember the problems that keyword substitution has caused me in projects at previous companies (just the thought of ever having to use Source Safe again fills me with a feeling of dread *8'). Also, I don't particularly want to have to enable Mercurial extensions to get the build to complete. I want the solution to be self contained, so that it isn't easy for the application to be accidentally compiled without the embedded version information just because an extension isn't enabled or the right helper software hasn't been installed. I also thought of writing this in a better scripting language, one where I would only write HgId.cs file if the content had actually changed, but all of the options I could think of would require my co-workers, contractors and possibly customers to have to install software they might not otherwise want (for example cygwin). Any other options people can think of would be appreciated. Update Partial solution Having played around with it for a while, I've managed to get the HgId.bat file to only overwrite the HgId.cs file if it changes: @echo off type HgId.pre > HgId.cst For /F "delims=" %%a in ('hg id') Do <nul >>HgId.cst set /p = @"%%a" echo ; >> HgId.cst echo } >> HgId.cst echo } >> HgId.cst fc HgId.cs HgId.cst >NUL if %errorlevel%==0 goto :ok copy HgId.cst HgId.cs :ok del HgId.cst Problems with this solution Even though HgId.cs is no longer being re-created every time, Visual Studio still insists on compiling everything every time. I've tried looking for solutions and tried checking "Only build startup projects and dependencies on Run" in Tools|Options|Projects and Solutions|Build and Run but it makes no difference. The second problem also remains, and now I have no way to test if it will work with Vista, since that contractor is no longer with us. If anyone can test this batch file on a Windows 7 and/or Vista box, I would appreciate hearing how it went. Finally, my aesthetic problem with this solution, is even strnger than it was before, since the batch file is more complex and this there is now more to go wrong. If you can think of any better solution, I would love to hear about them.

Read the article

C++: Declaration of template class member specialization (+ Doxygen bonus question!)

- by Ziv

When I specialize a (static) member function/constant in a template class, I'm confused as to where the declaration is meant to go. Here's an example of what I what to do - yoinked directly from IBM's reference on template specialization: template<class T> class X { public: static T v; static void f(T); }; template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } template<> char* X<char*>::v = "Hello"; template<> void X<float>::f(float arg) { v = arg * 2; } int main() { X<char*> a, b; X<float> c; c.f(10); // X<float>::v now set to 20 } The question is, how do I divide this into header/cpp files? The generic implementation is obviously in the header, but what about the specialization? It can't go in the header file, because it's concrete, leading to multiple definition. But if it goes into the .cpp file, is code which calls X::f() aware of the specialization, or might it rely on the generic X::f()? So far I've got the specialization in the .cpp only, with no declaration in the header. I'm not having trouble compiling or even running my code (on gcc, don't remember the version at the moment), and it behaves as expected - recognizing the specialization. But A) I'm not sure this is correct, and I'd like to know what is, and B) my Doxygen documentation comes out wonky and very misleading (more on that in a moment). What seems most natural to me would be something like this, declaring the specialization in the header and defining it in the .cpp: ===XClass.hpp=== #ifndef XCLASS_HPP #define XCLASS_HPP template<class T> class X { public: static T v; static void f(T); }; template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } /* declaration of specialized functions */ template<> char* X<char*>::v; template<> void X<float>::f(float arg); #endif ===XClass.cpp=== #include <XClass.hpp> /* concrete implementation of specialized functions */ template<> char* X<char*>::v = "Hello"; template<> void X<float>::f(float arg) { v = arg * 2; } ...but I have no idea if this is correct. The most immediate consequence of this issue, as I mentioned, is my Doxygen documentation, which doesn't seem to warm to the idea of member specialization, at least the way I'm defining it at the moment. It will always present only the first definition it finds of a function/constant, and I really need to be able to present the specializations as well. If I go so far as to re-declare the entire class, i.e. in the header: /* template declaration */ template<class T> class X { public: static T v; static void f(T); }; /* template member definition */ template<class T> T X<T>::v = 0; template<class T> void X<T>::f(T arg) { v = arg; } /* declaration of specialized CLASS (with definitions in .cpp) */ template<> class X<float> { public: static float v; static void f(float); }; then it will display the different variations of X as different classes (which is fine by me), but I don't know how to get the same effect when specializing only a few select members of the class. I don't know if this is a mistake of mine, or a limitation of Doxygen - any ideas? Thanks much, Ziv

Read the article

Ado.Net Entity produces "namespace cannot be found"

- by Dave

I've seen several possible solutions to this, but none have worked for me. After adding a ADO.NET Entity Data Model to my .Net Forms C# web project, I am unable to use it. Perhaps I made a mistake adding it? The name of the file added is QcFormData.edmx. In my code, perhaps I'm instantiating it incorrectly? I tried adding the line: QcFormDataContainer db = new QcFormDataContainer(); It appears in Intellisense, but when compiling I get the error : Error 13 The type or namespace name 'QcFormDataContainer' could not be found (are you missing a using directive or an assembly reference?) I've followed the suggestions that I found online that did not help: 1) made sure there is "using System.Data.Entity" 2) made sure the dll exists. 3) made sure the reference exists. 4) one post said use using System.Web.Data.Entity; but I do not see that available. What am I missing? QcFormData.edmx <?xml version="1.0" encoding="utf-8"?> <edmx:Edmx Version="3.0" xmlns:edmx="http://schemas.microsoft.com/ado/2009/11/edmx">  <edmx:Runtime>  <edmx:StorageModels> <Schema Namespace="MyCocoModel.Store" Alias="Self" Provider="System.Data.SqlClient" ProviderManifestToken="2008" xmlns:store="http://schemas.microsoft.com/ado/2007/12/edm/EntityStoreSchemaGenerator" xmlns="http://schemas.microsoft.com/ado/2009/11/edm/ssdl"> <EntityContainer Name="MyCocoModelStoreContainer"> <EntitySet Name="QcFieldValues" EntityType="MyCocoModel.Store.QcFieldValues" store:Type="Tables" Schema="dbo" /> </EntityContainer> <EntityType Name="QcFieldValues"> <Key> <PropertyRef Name="ID" /> </Key> <Property Name="ID" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="FieldID" Type="nvarchar" MaxLength="100" /> <Property Name="FieldValue" Type="nvarchar" MaxLength="100" /> <Property Name="DateTimeAdded" Type="datetime" /> <Property Name="OrderReserveNumber" Type="nvarchar" MaxLength="50" /> </EntityType> </Schema> </edmx:StorageModels>  <edmx:ConceptualModels> <Schema Namespace="MyCocoModel" Alias="Self" p1:UseStrongSpatialTypes="false" xmlns:annotation="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns:p1="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns="http://schemas.microsoft.com/ado/2009/11/edm"> <EntityContainer Name="MyCocoEntities" p1:LazyLoadingEnabled="true"> <EntitySet Name="QcFieldValues" EntityType="MyCocoModel.QcFieldValue" /> </EntityContainer> <EntityType Name="QcFieldValue"> <Key> <PropertyRef Name="ID" /> </Key> <Property Name="ID" Type="Int32" Nullable="false" p1:StoreGeneratedPattern="Identity" /> <Property Name="FieldID" Type="String" MaxLength="100" Unicode="true" FixedLength="false" /> <Property Name="FieldValue" Type="String" MaxLength="100" Unicode="true" FixedLength="false" /> <Property Name="DateTimeAdded" Type="DateTime" Precision="3" /> <Property Name="OrderReserveNumber" Type="String" MaxLength="50" Unicode="true" FixedLength="false" /> </EntityType> </Schema> </edmx:ConceptualModels>  <edmx:Mappings> <Mapping Space="C-S" xmlns="http://schemas.microsoft.com/ado/2009/11/mapping/cs"> <EntityContainerMapping StorageEntityContainer="MyCocoModelStoreContainer" CdmEntityContainer="MyCocoEntities"> <EntitySetMapping Name="QcFieldValues"> <EntityTypeMapping TypeName="MyCocoModel.QcFieldValue"> <MappingFragment StoreEntitySet="QcFieldValues"> <ScalarProperty Name="ID" ColumnName="ID" /> <ScalarProperty Name="FieldID" ColumnName="FieldID" /> <ScalarProperty Name="FieldValue" ColumnName="FieldValue" /> <ScalarProperty Name="DateTimeAdded" ColumnName="DateTimeAdded" /> <ScalarProperty Name="OrderReserveNumber" ColumnName="OrderReserveNumber" /> </MappingFragment> </EntityTypeMapping> </EntitySetMapping> </EntityContainerMapping> </Mapping> </edmx:Mappings> </edmx:Runtime>  <Designer xmlns="http://schemas.microsoft.com/ado/2009/11/edmx"> <Connection> <DesignerInfoPropertySet> <DesignerProperty Name="MetadataArtifactProcessing" Value="EmbedInOutputAssembly" /> </DesignerInfoPropertySet> </Connection> <Options> <DesignerInfoPropertySet> <DesignerProperty Name="ValidateOnBuild" Value="true" /> <DesignerProperty Name="EnablePluralization" Value="True" /> <DesignerProperty Name="IncludeForeignKeysInModel" Value="True" /> <DesignerProperty Name="CodeGenerationStrategy" Value="None" /> </DesignerInfoPropertySet> </Options>  <Diagrams></Diagrams> </Designer> </edmx:Edmx>

Read the article

Database file is inexplicably locked during SQLite commit

- by sweeney

Hello, I'm performing a large number of INSERTS to a SQLite database. I'm using just one thread. I batch the writes to improve performance and have a bit of security in case of a crash. Basically I cache up a bunch of data in memory and then when I deem appropriate, I loop over all of that data and perform the INSERTS. The code for this is shown below: public void Commit() { using (SQLiteConnection conn = new SQLiteConnection(this.connString)) { conn.Open(); using (SQLiteTransaction trans = conn.BeginTransaction()) { using (SQLiteCommand command = conn.CreateCommand()) { command.CommandText = "INSERT OR IGNORE INTO [MY_TABLE] (col1, col2) VALUES (?,?)"; command.Parameters.Add(this.col1Param); command.Parameters.Add(this.col2Param); foreach (Data o in this.dataTemp) { this.col1Param.Value = o.Col1Prop; this. col2Param.Value = o.Col2Prop; command.ExecuteNonQuery(); } } this.TryHandleCommit(trans); } conn.Close(); } } I now employ the following gimmick to get the thing to eventually work: private void TryHandleCommit(SQLiteTransaction trans) { try { trans.Commit(); } catch (Exception e) { Console.WriteLine("Trying again..."); this.TryHandleCommit(trans); } } I create my DB like so: public DataBase(String path) { //build connection string SQLiteConnectionStringBuilder connString = new SQLiteConnectionStringBuilder(); connString.DataSource = path; connString.Version = 3; connString.DefaultTimeout = 5; connString.JournalMode = SQLiteJournalModeEnum.Persist; connString.UseUTF16Encoding = true; using (connection = new SQLiteConnection(connString.ToString())) { //check for existence of db FileInfo f = new FileInfo(path); if (!f.Exists) //build new blank db { SQLiteConnection.CreateFile(path); connection.Open(); using (SQLiteTransaction trans = connection.BeginTransaction()) { using (SQLiteCommand command = connection.CreateCommand()) { command.CommandText = DataBase.CREATE_MATCHES; command.ExecuteNonQuery(); command.CommandText = DataBase.CREATE_STRING_DATA; command.ExecuteNonQuery(); //TODO add logging } trans.Commit(); } connection.Close(); } } } I then export the connection string and use it to obtain new connections in different parts of the program. At seemingly random intervals, though at far too great a rate to ignore or otherwise workaround this problem, I get unhandled SQLiteException: Database file is locked. This occurs when I attempt to commit the transaction. No errors seem to occur prior to then. This does not always happen. Sometimes the whole thing runs without a hitch. No reads are being performed on these files before the commits finish. I have the very latest SQLite binary. I'm compiling for .NET 2.0. I'm using VS 2008. The db is a local file. All of this activity is encapsulated within one thread / process. Virus protection is off (though I think that was only relevant if you were connecting over a network?). As per Scotsman's post I have implemented the following changes: Journal Mode set to Persist DB files stored in C:\Docs + Settings\ApplicationData via System.Windows.Forms.Application.AppData windows call No inner exception Witnessed on two distinct machines (albeit very similar hardware and software) Have been running Process Monitor - no extraneous processes are attaching themselves to the DB files - the problem is definitely in my code... Does anyone have any idea whats going on here? I know I just dropped a whole mess of code, but I've been trying to figure this out for way too long. My thanks to anyone who makes it to the end of this question! brian UPDATES: Thanks for the suggestions so far! I've implemented many of the suggested changes. I feel that we are getting closer to the answer...however... The code above technically works however it is non-deterministic! It is not guaranteed to do anything aside from spin in neutral forever. In practice it seems to work somewhere between the 1st and 10th iteration. If i batch my commits at a reasonable interval damage will be mitigated but I really do not want to leave things in this state... More suggestions welcome!

Read the article

Java programming accessing object variables

- by Haxed

Helo, there are 3 files, CustomerClient.java, CustomerServer.java and Customer.java PROBLEM: In the CustomerServer.java file, i get an error when I compile the CustomerServer.java at line : System.out.println(a[k].getName()); ERROR: init: deps-jar: Compiling 1 source file to C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\build\classes C:\Documents and Settings\TLNA\My Documents\NetBeansProjects\Server\src\CustomerServer.java:44: cannot find symbol symbol : method getName() location: class Customer System.out.println(a[k].getName()); 1 error BUILD FAILED (total time: 0 seconds) CustomerClient.java import java.io.*; import java.net.*; import java.awt.*; import java.awt.event.*; import javax.swing.*; import javax.swing.border.*; public class CustomerClient extends JApplet { private JTextField jtfName = new JTextField(32); private JTextField jtfSeatNo = new JTextField(32); // Button for sending a student to the server private JButton jbtRegister = new JButton("Register to the Server"); // Indicate if it runs as application private boolean isStandAlone = false; // Host name or ip String host = "localhost"; public void init() { JPanel p1 = new JPanel(); p1.setLayout(new GridLayout(2, 1)); p1.add(new JLabel("Name")); p1.add(jtfName); p1.add(new JLabel("Seat No.")); p1.add(jtfSeatNo); add(p1, BorderLayout.CENTER); add(jbtRegister, BorderLayout.SOUTH); // Register listener jbtRegister.addActionListener(new ButtonListener()); // Find the IP address of the Web server if (!isStandAlone) { host = getCodeBase().getHost(); } } /** Handle button action */ private class ButtonListener implements ActionListener { public void actionPerformed(ActionEvent e) { try { // Establish connection with the server Socket socket = new Socket(host, 8000); // Create an output stream to the server ObjectOutputStream toServer = new ObjectOutputStream(socket.getOutputStream()); // Get text field String name = jtfName.getText().trim(); String seatNo = jtfSeatNo.getText().trim(); // Create a Student object and send to the server Customer s = new Customer(name, seatNo); toServer.writeObject(s); } catch (IOException ex) { System.err.println(ex); } } } /** Run the applet as an application */ public static void main(String[] args) { // Create a frame JFrame frame = new JFrame("Register Student Client"); // Create an instance of the applet CustomerClient applet = new CustomerClient(); applet.isStandAlone = true; // Get host if (args.length == 1) { applet.host = args[0]; // Add the applet instance to the frame } frame.add(applet, BorderLayout.CENTER); // Invoke init() and start() applet.init(); applet.start(); // Display the frame frame.pack(); frame.setVisible(true); } } CustomerServer.java import java.io.*; import java.net.*; public class CustomerServer { private String name; private int i; private ObjectOutputStream outputToFile; private ObjectInputStream inputFromClient; public static void main(String[] args) { new CustomerServer(); } public CustomerServer() { Customer[] a = new Customer[30]; try { // Create a server socket ServerSocket serverSocket = new ServerSocket(8000); System.out.println("Server started "); // Create an object ouput stream outputToFile = new ObjectOutputStream( new FileOutputStream("student.dat", true)); while (true) { // Listen for a new connection request Socket socket = serverSocket.accept(); // Create an input stream from the socket inputFromClient = new ObjectInputStream(socket.getInputStream()); // Read from input //Object object = inputFromClient.readObject(); for (int k = 0; k <= 2; k++) { if (a[k] == null) { a[k] = (Customer) inputFromClient.readObject(); // Write to the file outputToFile.writeObject(a[k]); //System.out.println("A new student object is stored"); System.out.println(a[k].getName()); break; } if (k == 2) { //fully booked outputToFile.writeObject("All seats are booked"); break; } } } } catch (ClassNotFoundException ex) { ex.printStackTrace(); } catch (IOException ex) { ex.printStackTrace(); } finally { try { inputFromClient.close(); outputToFile.close(); } catch (Exception ex) { ex.printStackTrace(); } } } } Customer.java public class Customer implements java.io.Serializable { private String name; private String seatno; public Customer(String name, String seatno) { this.name = name; this.seatno = seatno; } public String getName() { return name; } public String getSeatNo() { return seatno; } }

Read the article

Loop crashing program having to do with 2D arrays

- by user450062

I am creating an encoding program and when I instruct the program to create a 5X5 grid based on the alphabet while skipping over letters that match up to certain pre-defined variables(which are given values by user input during runtime). I have a loop that instructs the loop to keep running until the values that access the array are out of bounds, the loop seems to cause the problem. This code is standardized so there shouldn't be much trouble compiling it in another compiler. Also would it be better to seperate my program into functions? here is the code: #include<iostream> #include<fstream> #include<cstdlib> #include<string> #include<limits> using namespace std; int main(){ while (!cin.fail()) { char type[81]; char filename[20]; char key [5]; char f[2] = "q"; char g[2] = "q"; char h[2] = "q"; char i[2] = "q"; char j[2] = "q"; char k[2] = "q"; char l[2] = "q"; int a = 1; int b = 1; int c = 1; int d = 1; int e = 1; string cipherarraytemplate[5][5]= { {"a","b","c","d","e"}, {"f","g","h","i","j"}, {"k","l","m","n","o"}, {"p","r","s","t","u"}, {"v","w","x","y","z"} }; string cipherarray[5][5]= { {"a","b","c","d","e"}, {"f","g","h","i","j"}, {"k","l","m","n","o"}, {"p","r","s","t","u"}, {"v","w","x","y","z"} }; cout<<"Enter the name of a file you want to create.\n"; cin>>filename; ofstream outFile; outFile.open(filename); outFile<<fixed; outFile.precision(2); outFile.setf(ios_base::showpoint); cin.ignore(std::numeric_limits<int>::max(),'\n'); cout<<"enter your codeword(codeword can have no repeating letters)\n"; cin>>key; while (key[a] != '\0' ){ while(b < 6){ cipherarray[b][c] = key[a]; if ( f == "q" ) { cipherarray[b][c] = f; } if ( f != "q" && g == "q" ) { cipherarray[b][c] = g; } if ( g != "q" && h == "q" ) { cipherarray[b][c] = h; } if ( h != "q" && i == "q" ) { cipherarray[b][c] = i; } if ( i != "q" && j == "q" ) { cipherarray[b][c] = j; } if ( j != "q" && k == "q" ) { cipherarray[b][c] = k; } if ( k != "q" && l == "q" ) { cipherarray[b][c] = l; } a++; b++; } c++; b = 1; } while (c < 6 || b < 6){ if (cipherarraytemplate[d][e] == f || cipherarraytemplate[d][e] == g || cipherarraytemplate[d][e] == h || cipherarraytemplate[d][e] == i || cipherarraytemplate[d][e] == j || cipherarraytemplate[d][e] == k || cipherarraytemplate[d][e] == l){ d++; } else { cipherarray[b][c] = cipherarraytemplate[d][e]; d++; b++; } if (d == 6){ d = 1; e++; } if (b == 6){ c++; b = 1; } } cout<<"now enter some text."<<endl<<"To end this program press Crtl-Z\n"; while(!cin.fail()){ cin.getline(type,81); outFile<<type<<endl; } outFile.close(); } } I know there is going to be some mid-forties guy out there who is going to stumble on to this post, he's have been programming for 20-some years and he's going to look at my code and say: "what is this guy doing".

Read the article

Rendering ASP.NET MVC Views to String

- by Rick Strahl

It's not uncommon in my applications that I require longish text output that does not have to be rendered into the HTTP output stream. The most common scenario I have for 'template driven' non-Web text is for emails of all sorts. Logon confirmations and verifications, email confirmations for things like orders, status updates or scheduler notifications - all of which require merged text output both within and sometimes outside of Web applications. On other occasions I also need to capture the output from certain views for logging purposes. Rather than creating text output in code, it's much nicer to use the rendering mechanism that ASP.NET MVC already provides by way of it's ViewEngines - using Razor or WebForms views - to render output to a string. This is nice because it uses the same familiar rendering mechanism that I already use for my HTTP output and it also solves the problem of where to store the templates for rendering this content in nothing more than perhaps a separate view folder. The good news is that ASP.NET MVC's rendering engine is much more modular than the full ASP.NET runtime engine which was a real pain in the butt to coerce into rendering output to string. With MVC the rendering engine has been separated out from core ASP.NET runtime, so it's actually a lot easier to get View output into a string. Getting View Output from within an MVC Application If you need to generate string output from an MVC and pass some model data to it, the process to capture this output is fairly straight forward and involves only a handful of lines of code. The catch is that this particular approach requires that you have an active ControllerContext that can be passed to the view. This means that the following approach is limited to access from within Controller methods. Here's a class that wraps the process and provides both instance and static methods to handle the rendering:/// <summary> /// Class that renders MVC views to a string using the /// standard MVC View Engine to render the view. /// /// Note: This class can only be used within MVC /// applications that have an active ControllerContext. /// </summary> public class ViewRenderer { /// <summary> /// Required Controller Context /// </summary> protected ControllerContext Context { get; set; } public ViewRenderer(ControllerContext controllerContext) { Context = controllerContext; } /// <summary> /// Renders a full MVC view to a string. Will render with the full MVC /// View engine including running _ViewStart and merging into _Layout /// </summary> /// <param name="viewPath"> /// The path to the view to render. Either in same controller, shared by /// name or as fully qualified ~/ path including extension /// </param> /// <param name="model">The model to render the view with</param> /// <returns>String of the rendered view or null on error</returns> public string RenderView(string viewPath, object model) { return RenderViewToStringInternal(viewPath, model, false); } /// <summary> /// Renders a partial MVC view to string. Use this method to render /// a partial view that doesn't merge with _Layout and doesn't fire /// _ViewStart. /// </summary> /// <param name="viewPath"> /// The path to the view to render. Either in same controller, shared by /// name or as fully qualified ~/ path including extension /// </param> /// <param name="model">The model to pass to the viewRenderer</param> /// <returns>String of the rendered view or null on error</returns> public string RenderPartialView(string viewPath, object model) { return RenderViewToStringInternal(viewPath, model, true); } public static string RenderView(string viewPath, object model, ControllerContext controllerContext) { ViewRenderer renderer = new ViewRenderer(controllerContext); return renderer.RenderView(viewPath, model); } public static string RenderPartialView(string viewPath, object model, ControllerContext controllerContext) { ViewRenderer renderer = new ViewRenderer(controllerContext); return renderer.RenderPartialView(viewPath, model); } protected string RenderViewToStringInternal(string viewPath, object model, bool partial = false) { // first find the ViewEngine for this view ViewEngineResult viewEngineResult = null; if (partial) viewEngineResult = ViewEngines.Engines.FindPartialView(Context, viewPath); else viewEngineResult = ViewEngines.Engines.FindView(Context, viewPath, null); if (viewEngineResult == null) throw new FileNotFoundException(Properties.Resources.ViewCouldNotBeFound); // get the view and attach the model to view data var view = viewEngineResult.View; Context.Controller.ViewData.Model = model; string result = null; using (var sw = new StringWriter()) { var ctx = new ViewContext(Context, view, Context.Controller.ViewData, Context.Controller.TempData, sw); view.Render(ctx, sw); result = sw.ToString(); } return result; } } The key is the RenderViewToStringInternal method. The method first tries to find the view to render based on its path which can either be in the current controller's view path or the shared view path using its simple name (PasswordRecovery) or alternately by its full virtual path (~/Views/Templates/PasswordRecovery.cshtml). This code should work both for Razor and WebForms views although I've only tried it with Razor Views. Note that WebForms Views might actually be better for plain text as Razor adds all sorts of white space into its output when there are code blocks in the template. The Web Forms engine provides more accurate rendering for raw text scenarios. Once a view engine is found the view to render can be retrieved. Views in MVC render based on data that comes off the controller like the ViewData which contains the model along with the actual ViewData and ViewBag. From the View and some of the Context data a ViewContext is created which is then used to render the view with. The View picks up the Model and other data from the ViewContext internally and processes the View the same it would be processed if it were to send its output into the HTTP output stream. The difference is that we can override the ViewContext's output stream which we provide and capture into a StringWriter(). After rendering completes the result holds the output string. If an error occurs the error behavior is similar what you see with regular MVC errors - you get a full yellow screen of death including the view error information with the line of error highlighted. It's your responsibility to handle the error - or let it bubble up to your regular Controller Error filter if you have one. To use the simple class you only need a single line of code if you call the static methods. Here's an example of some Controller code that is used to send a user notification to a customer via email in one of my applications:[HttpPost] public ActionResult ContactSeller(ContactSellerViewModel model) { InitializeViewModel(model); var entryBus = new busEntry(); var entry = entryBus.LoadByDisplayId(model.EntryId); if ( string.IsNullOrEmpty(model.Email) ) entryBus.ValidationErrors.Add("Email address can't be empty.","Email"); if ( string.IsNullOrEmpty(model.Message)) entryBus.ValidationErrors.Add("Message can't be empty.","Message"); model.EntryId = entry.DisplayId; model.EntryTitle = entry.Title; if (entryBus.ValidationErrors.Count > 0) { ErrorDisplay.AddMessages(entryBus.ValidationErrors); ErrorDisplay.ShowError("Please correct the following:"); } else { string message = ViewRenderer.RenderView("~/views/template/ContactSellerEmail.cshtml",model, ControllerContext); string title = entry.Title + " (" + entry.DisplayId + ") - " + App.Configuration.ApplicationName; AppUtils.SendEmail(title, message, model.Email, entry.User.Email, false, false)) } return View(model); } Simple! The view in this case is just a plain MVC view and in this case it's a very simple plain text email message (edited for brevity here) that is created and sent off:@model ContactSellerViewModel @{ Layout = null; }re: @Model.EntryTitle @Model.ListingUrl @Model.Message ** SECURITY ADVISORY - AVOID SCAMS ** Avoid: wiring money, cross-border deals, work-at-home ** Beware: cashier checks, money orders, escrow, shipping ** More Info: @(App.Configuration.ApplicationBaseUrl)scams.html Obviously this is a very simple view (I edited out more from this page to keep it brief) - but other template views are much more complex HTML documents or long messages that are occasionally updated and they are a perfect fit for Razor rendering. It even works with nested partial views and _layout pages. Partial Rendering Notice that I'm rendering a full View here. In the view I explicitly set the Layout=null to avoid pulling in _layout.cshtml for this view. This can also be controlled externally by calling the RenderPartial method instead: string message = ViewRenderer.RenderPartialView("~/views/template/ContactSellerEmail.cshtml",model, ControllerContext); with this line of code no layout page (or _viewstart) will be loaded, so the output generated is just what's in the view. I find myself using Partials most of the time when rendering templates, since the target of templates usually tend to be emails or other HTML fragment like output, so the RenderPartialView() method is definitely useful to me. Rendering without a ControllerContext The preceding class is great when you're need template rendering from within MVC controller actions or anywhere where you have access to the request Controller. But if you don't have a controller context handy - maybe inside a utility function that is static, a non-Web application, or an operation that runs asynchronously in ASP.NET - which makes using the above code impossible. I haven't found a way to manually create a Controller context to provide the ViewContext() what it needs from outside of the MVC infrastructure. However, there are ways to accomplish this, but they are a bit more complex. It's possible to host the RazorEngine on your own, which side steps all of the MVC framework and HTTP and just deals with the raw rendering engine. I wrote about this process in Hosting the Razor Engine in Non-Web Applications a long while back. It's quite a process to create a custom Razor engine and runtime, but it allows for all sorts of flexibility. There's also a RazorEngine CodePlex project that does something similar. I've been meaning to check out the latter but haven't gotten around to it since I have my own code to do this. The trick to hosting the RazorEngine to have it behave properly inside of an ASP.NET application and properly cache content so templates aren't constantly rebuild and reparsed. Anyway, in the same app as above I have one scenario where no ControllerContext is available: I have a background scheduler running inside of the app that fires on timed intervals. This process could be external but because it's lightweight we decided to fire it right inside of the ASP.NET app on a separate thread. In my app the code that renders these templates does something like this:var model = new SearchNotificationViewModel() { Entries = entries, Notification = notification, User = user }; // TODO: Need logging for errors sending string razorError = null; var result = AppUtils.RenderRazorTemplate("~/views/template/SearchNotificationTemplate.cshtml", model, razorError); which references a couple of helper functions that set up my RazorFolderHostContainer class:public static string RenderRazorTemplate(string virtualPath, object model,string errorMessage = null) { var razor = AppUtils.CreateRazorHost(); var path = virtualPath.Replace("~/", "").Replace("~", "").Replace("/", "\\"); var merged = razor.RenderTemplateToString(path, model); if (merged == null) errorMessage = razor.ErrorMessage; return merged; } /// <summary> /// Creates a RazorStringHostContainer and starts it /// Call .Stop() when you're done with it. /// /// This is a static instance /// </summary> /// <param name="virtualPath"></param> /// <param name="binBasePath"></param> /// <param name="forceLoad"></param> /// <returns></returns> public static RazorFolderHostContainer CreateRazorHost(string binBasePath = null, bool forceLoad = false) { if (binBasePath == null) { if (HttpContext.Current != null) binBasePath = HttpContext.Current.Server.MapPath("~/"); else binBasePath = AppDomain.CurrentDomain.BaseDirectory; } if (_RazorHost == null || forceLoad) { if (!binBasePath.EndsWith("\\")) binBasePath += "\\"; //var razor = new RazorStringHostContainer(); var razor = new RazorFolderHostContainer(); razor.TemplatePath = binBasePath; binBasePath += "bin\\"; razor.BaseBinaryFolder = binBasePath; razor.UseAppDomain = false; razor.ReferencedAssemblies.Add(binBasePath + "ClassifiedsBusiness.dll"); razor.ReferencedAssemblies.Add(binBasePath + "ClassifiedsWeb.dll"); razor.ReferencedAssemblies.Add(binBasePath + "Westwind.Utilities.dll"); razor.ReferencedAssemblies.Add(binBasePath + "Westwind.Web.dll"); razor.ReferencedAssemblies.Add(binBasePath + "Westwind.Web.Mvc.dll"); razor.ReferencedAssemblies.Add("System.Web.dll"); razor.ReferencedNamespaces.Add("System.Web"); razor.ReferencedNamespaces.Add("ClassifiedsBusiness"); razor.ReferencedNamespaces.Add("ClassifiedsWeb"); razor.ReferencedNamespaces.Add("Westwind.Web"); razor.ReferencedNamespaces.Add("Westwind.Utilities"); _RazorHost = razor; _RazorHost.Start(); //_RazorHost.Engine.Configuration.CompileToMemory = false; } return _RazorHost; } The RazorFolderHostContainer essentially is a full runtime that mimics a folder structure like a typical Web app does including caching semantics and compiling code only if code changes on disk. It maps a folder hierarchy to views using the ~/ path syntax. The host is then configured to add assemblies and namespaces. Unfortunately the engine is not exactly like MVC's Razor - the expression expansion and code execution are the same, but some of the support methods like sections, helpers etc. are not all there so templates have to be a bit simpler. There are other folder hosts provided as well to directly execute templates from strings (using RazorStringHostContainer). The following is an example of an HTML email template @inherits RazorHosting.RazorTemplateFolderHost <ClassifiedsWeb.SearchNotificationViewModel> <html> <head> <title>Search Notifications</title> <style> body { margin: 5px;font-family: Verdana, Arial; font-size: 10pt;} h3 { color: SteelBlue; } .entry-item { border-bottom: 1px solid grey; padding: 8px; margin-bottom: 5px; } </style> </head> <body> Hello @Model.User.Name,<br /> <p>Below are your Search Results for the search phrase:</p> <h3>@Model.Notification.SearchPhrase</h3> <small>since @TimeUtils.ShortDateString(Model.Notification.LastSearch)</small> <hr /> You can see that the syntax is a little different. Instead of the familiar @model header the raw Razor @inherits tag is used to specify the template base class (which you can extend). I took a quick look through the feature set of RazorEngine on CodePlex (now Github I guess) and the template implementation they use is closer to MVC's razor but there are other differences. In the end don't expect exact behavior like MVC templates if you use an external Razor rendering engine. This is not what I would consider an ideal solution, but it works well enough for this project. My biggest concern is the overhead of hosting a second razor engine in a Web app and the fact that here the differences in template rendering between 'real' MVC Razor views and another RazorEngine really are noticeable. You win some, you lose some It's extremely nice to see that if you have a ControllerContext handy (which probably addresses 99% of Web app scenarios) rendering a view to string using the native MVC Razor engine is pretty simple. Kudos on making that happen - as it solves a problem I see in just about every Web application I work on. But it is a bummer that a ControllerContext is required to make this simple code work. It'd be really sweet if there was a way to render views without being so closely coupled to the ASP.NET or MVC infrastructure that requires a ControllerContext. Alternately it'd be nice to have a way for an MVC based application to create a minimal ControllerContext from scratch - maybe somebody's been down that path. I tried for a few hours to come up with a way to make that work but gave up in the soup of nested contexts (MVC/Controller/View/Http). I suspect going down this path would be similar to hosting the ASP.NET runtime requiring a WorkerRequest. Brrr…. The sad part is that it seems to me that a View should really not require much 'context' of any kind to render output to string. Yes there are a few things that clearly are required like paths to the virtual and possibly the disk paths to the root of the app, but beyond that view rendering should not require much. But, no such luck. For now custom RazorHosting seems to be the only way to make Razor rendering go outside of the MVC context… Resources Full ViewRenderer.cs source code from Westwind.Web.Mvc library Hosting the Razor Engine for Non-Web Applications RazorEngine on GitHub© Rick Strahl, West Wind Technologies, 2005-2012Posted in ASP.NET ASP.NET MVC Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

Read the article

Creating STA COM compatible ASP.NET Applications

- by Rick Strahl

When building ASP.NET applications that interface with old school COM objects like those created with VB6 or Visual FoxPro (MTDLL), it's extremely important that the threads that are serving requests use Single Threaded Apartment Threading. STA is a COM built-in technology that allows essentially single threaded components to operate reliably in a multi-threaded environment. STA's guarantee that COM objects instantiated on a specific thread stay on that specific thread and any access to a COM object from another thread automatically marshals that thread to the STA thread. The end effect is that you can have multiple threads, but a COM object instance lives on a fixed never changing thread. ASP.NET by default uses MTA (multi-threaded apartment) threads which are truly free spinning threads that pay no heed to COM object marshaling. This is vastly more efficient than STA threading which has a bit of overhead in determining whether it's OK to run code on a given thread or whether some sort of thread/COM marshaling needs to occur. MTA COM components can be very efficient, but STA COM components in a multi-threaded environment always tend to have a fair amount of overhead. It's amazing how much COM Interop I still see today so while it seems really old school to be talking about this topic, it's actually quite apropos for me as I have many customers using legacy COM systems that need to interface with other .NET applications. In this post I'm consolidating some of the hacks I've used to integrate with various ASP.NET technologies when using STA COM Components. STA in ASP.NET Support for STA threading in the ASP.NET framework is fairly limited. Specifically only the original ASP.NET WebForms technology supports STA threading directly via its STA Page Handler implementation or what you might know as ASPCOMPAT mode. For WebForms running STA components is as easy as specifying the ASPCOMPAT attribute in the @Page tag:<%@ Page Language="C#" AspCompat="true" %> which runs the page in STA mode. Removing it runs in MTA mode. Simple. Unfortunately all other ASP.NET technologies built on top of the core ASP.NET engine do not support STA natively. So if you want to use STA COM components in MVC or with class ASMX Web Services, there's no automatic way like the ASPCOMPAT keyword available. So what happens when you run an STA COM component in an MTA application? In low volume environments - nothing much will happen. The COM objects will appear to work just fine as there are no simultaneous thread interactions and the COM component will happily run on a single thread or multiple single threads one at a time. So for testing running components in MTA environments may appear to work just fine. However as load increases and threads get re-used by ASP.NET COM objects will end up getting created on multiple different threads. This can result in crashes or hangs, or data corruption in the STA components which store their state in thread local storage on the STA thread. If threads overlap this global store can easily get corrupted which in turn causes problems. STA ensures that any COM object instance loaded always stays on the same thread it was instantiated on. What about COM+? COM+ is supposed to address the problem of STA in MTA applications by providing an abstraction with it's own thread pool manager for COM objects. It steps in to the COM instantiation pipeline and hands out COM instances from its own internally maintained STA Thread pool. This guarantees that the COM instantiation threads are STA threads if using STA components. COM+ works, but in my experience the technology is very, very slow for STA components. It adds a ton of overhead and reduces COM performance noticably in load tests in IIS. COM+ can make sense in some situations but for Web apps with STA components it falls short. In addition there's also the need to ensure that COM+ is set up and configured on the target machine and the fact that components have to be registered in COM+. COM+ also keeps components up at all times, so if a component needs to be replaced the COM+ package needs to be unloaded (same is true for IIS hosted components but it's more common to manage that). COM+ is an option for well established components, but native STA support tends to provide better performance and more consistent usability, IMHO. STA for non supporting ASP.NET Technologies As mentioned above only WebForms supports STA natively. However, by utilizing the WebForms ASP.NET Page handler internally it's actually possible to trick various other ASP.NET technologies and let them work with STA components. This is ugly but I've used each of these in various applications and I've had minimal problems making them work with FoxPro STA COM components which is about as dififcult as it gets for COM Interop in .NET. In this post I summarize several STA workarounds that enable you to use STA threading with these ASP.NET Technologies: ASMX Web Services ASP.NET MVC WCF Web Services ASP.NET Web API ASMX Web Services I start with classic ASP.NET ASMX Web Services because it's the easiest mechanism that allows for STA modification. It also clearly demonstrates how the WebForms STA Page Handler is the key technology to enable the various other solutions to create STA components. Essentially the way this works is to override the WebForms Page class and hijack it's init functionality for processing requests. Here's what this looks like for Web Services:namespace FoxProAspNet { public class WebServiceStaHandler : System.Web.UI.Page, IHttpAsyncHandler { protected override void OnInit(EventArgs e) { IHttpHandler handler = new WebServiceHandlerFactory().GetHandler( this.Context, this.Context.Request.HttpMethod, this.Context.Request.FilePath, this.Context.Request.PhysicalPath); handler.ProcessRequest(this.Context); this.Context.ApplicationInstance.CompleteRequest(); } public IAsyncResult BeginProcessRequest( HttpContext context, AsyncCallback cb, object extraData) { return this.AspCompatBeginProcessRequest(context, cb, extraData); } public void EndProcessRequest(IAsyncResult result) { this.AspCompatEndProcessRequest(result); } } public class AspCompatWebServiceStaHandlerWithSessionState : WebServiceStaHandler, IRequiresSessionState { } } This class overrides the ASP.NET WebForms Page class which has a little known AspCompatBeginProcessRequest() and AspCompatEndProcessRequest() method that is responsible for providing the WebForms ASPCOMPAT functionality. These methods handle routing requests to STA threads. Note there are two classes - one that includes session state and one that does not. If you plan on using ASP.NET Session state use the latter class, otherwise stick to the former. This maps to the EnableSessionState page setting in WebForms. This class simply hooks into this functionality by overriding the BeginProcessRequest and EndProcessRequest methods and always forcing it into the AspCompat methods. The way this works is that BeginProcessRequest() fires first to set up the threads and starts intializing the handler. As part of that process the OnInit() method is fired which is now already running on an STA thread. The code then creates an instance of the actual WebService handler factory and calls its ProcessRequest method to start executing which generates the Web Service result. Immediately after ProcessRequest the request is stopped with Application.CompletRequest() which ensures that the rest of the Page handler logic doesn't fire. This means that even though the fairly heavy Page class is overridden here, it doesn't end up executing any of its internal processing which makes this code fairly efficient. In a nutshell, we're highjacking the Page HttpHandler and forcing it to process the WebService process handler in the context of the AspCompat handler behavior. Hooking up the Handler Because the above is an HttpHandler implementation you need to hook up the custom handler and replace the standard ASMX handler. To do this you need to modify the web.config file (here for IIS 7 and IIS Express): <configuration> <system.webServer> <handlers> <remove name="WebServiceHandlerFactory-Integrated-4.0" /> <add name="Asmx STA Web Service Handler" path="*.asmx" verb="*" type="FoxProAspNet.WebServiceStaHandler" precondition="integrated"/> </handlers> </system.webServer> </configuration> (Note: The name for the WebServiceHandlerFactory-Integrated-4.0 might be slightly different depending on your server version. Check the IIS Handler configuration in the IIS Management Console for the exact name or simply remove the handler from the list there which will propagate to your web.config). For IIS 5 & 6 (Windows XP/2003) or the Visual Studio Web Server use:<configuration> <system.web> <httpHandlers> <remove path="*.asmx" verb="*" /> <add path="*.asmx" verb="*" type="FoxProAspNet.WebServiceStaHandler" /> </httpHandlers> </system.web></configuration> To test, create a new ASMX Web Service and create a method like this: [WebService(Namespace = "http://foxaspnet.org/")] [WebServiceBinding(ConformsTo = WsiProfiles.BasicProfile1_1)] public class FoxWebService : System.Web.Services.WebService { [WebMethod] public string HelloWorld() { return "Hello World. Threading mode is: " + System.Threading.Thread.CurrentThread.GetApartmentState(); } } Run this before you put in the web.config configuration changes and you should get: Hello World. Threading mode is: MTA Then put the handler mapping into Web.config and you should see: Hello World. Threading mode is: STA And you're on your way to using STA COM components. It's a hack but it works well! I've used this with several high volume Web Service installations with various customers and it's been fast and reliable. ASP.NET MVC ASP.NET MVC has quickly become the most popular ASP.NET technology, replacing WebForms for creating HTML output. MVC is more complex to get started with, but once you understand the basic structure of how requests flow through the MVC pipeline it's easy to use and amazingly flexible in manipulating HTML requests. In addition, MVC has great support for non-HTML output sources like JSON and XML, making it an excellent choice for AJAX requests without any additional tools. Unlike WebForms ASP.NET MVC doesn't support STA threads natively and so some trickery is needed to make it work with STA threads as well. MVC gets its handler implementation through custom route handlers using ASP.NET's built in routing semantics. To work in an STA handler requires working in the Page Handler as part of the Route Handler implementation. As with the Web Service handler the first step is to create a custom HttpHandler that can instantiate an MVC request pipeline properly:public class MvcStaThreadHttpAsyncHandler : Page, IHttpAsyncHandler, IRequiresSessionState { private RequestContext _requestContext; public MvcStaThreadHttpAsyncHandler(RequestContext requestContext) { if (requestContext == null) throw new ArgumentNullException("requestContext"); _requestContext = requestContext; } public IAsyncResult BeginProcessRequest(HttpContext context, AsyncCallback cb, object extraData) { return this.AspCompatBeginProcessRequest(context, cb, extraData); } protected override void OnInit(EventArgs e) { var controllerName = _requestContext.RouteData.GetRequiredString("controller"); var controllerFactory = ControllerBuilder.Current.GetControllerFactory(); var controller = controllerFactory.CreateController(_requestContext, controllerName); if (controller == null) throw new InvalidOperationException("Could not find controller: " + controllerName); try { controller.Execute(_requestContext); } finally { controllerFactory.ReleaseController(controller); } this.Context.ApplicationInstance.CompleteRequest(); } public void EndProcessRequest(IAsyncResult result) { this.AspCompatEndProcessRequest(result); } public override void ProcessRequest(HttpContext httpContext) { throw new NotSupportedException("STAThreadRouteHandler does not support ProcessRequest called (only BeginProcessRequest)"); } } This handler code figures out which controller to load and then executes the controller. MVC internally provides the information needed to route to the appropriate method and pass the right parameters. Like the Web Service handler the logic occurs in the OnInit() and performs all the processing in that part of the request. Next, we need a RouteHandler that can actually pick up this handler. Unlike the Web Service handler where we simply registered the handler, MVC requires a RouteHandler to pick up the handler. RouteHandlers look at the URL's path and based on that decide on what handler to invoke. The route handler is pretty simple - all it does is load our custom handler: public class MvcStaThreadRouteHandler : IRouteHandler { public IHttpHandler GetHttpHandler(RequestContext requestContext) { if (requestContext == null) throw new ArgumentNullException("requestContext"); return new MvcStaThreadHttpAsyncHandler(requestContext); } } At this point you can instantiate this route handler and force STA requests to MVC by specifying a route. The following sets up the ASP.NET Default Route:Route mvcRoute = new Route("{controller}/{action}/{id}", new RouteValueDictionary( new { controller = "Home", action = "Index", id = UrlParameter.Optional }), new MvcStaThreadRouteHandler()); RouteTable.Routes.Add(mvcRoute); To make this code a little easier to work with and mimic the behavior of the routes.MapRoute() functionality extension method that MVC provides, here is an extension method for MapMvcStaRoute(): public static class RouteCollectionExtensions { public static void MapMvcStaRoute(this RouteCollection routeTable, string name, string url, object defaults = null) { Route mvcRoute = new Route(url, new RouteValueDictionary(defaults), new MvcStaThreadRouteHandler()); RouteTable.Routes.Add(mvcRoute); } } With this the syntax to add route becomes a little easier and matches the MapRoute() method:RouteTable.Routes.MapMvcStaRoute( name: "Default", url: "{controller}/{action}/{id}", defaults: new { controller = "Home", action = "Index", id = UrlParameter.Optional } ); The nice thing about this route handler, STA Handler and extension method is that it's fully self contained. You can put all three into a single class file and stick it into your Web app, and then simply call MapMvcStaRoute() and it just works. Easy! To see whether this works create an MVC controller like this: public class ThreadTestController : Controller { public string ThreadingMode() { return Thread.CurrentThread.GetApartmentState().ToString(); } } Try this test both with only the MapRoute() hookup in the RouteConfiguration in which case you should get MTA as the value. Then change the MapRoute() call to MapMvcStaRoute() leaving all the parameters the same and re-run the request. You now should see STA as the result. You're on your way using STA COM components reliably in ASP.NET MVC. WCF Web Services running through IIS WCF Web Services provide a more robust and wider range of services for Web Services. You can use WCF over HTTP, TCP, and Pipes, and WCF services support WS* secure services. There are many features in WCF that go way beyond what ASMX can do. But it's also a bit more complex than ASMX. As a basic rule if you need to serve straight SOAP Services over HTTP I 'd recommend sticking with the simpler ASMX services especially if COM is involved. If you need WS* support or want to serve data over non-HTTP protocols then WCF makes more sense. WCF is not my forte but I found a solution from Scott Seely on his blog that describes the progress and that seems to work well. I'm copying his code below so this STA information is all in one place and quickly explain. Scott's code basically works by creating a custom OperationBehavior which can be specified via an [STAOperation] attribute on every method. Using his attribute you end up with a class (or Interface if you separate the contract and class) that looks like this: [ServiceContract] public class WcfService { [OperationContract] public string HelloWorldMta() { return Thread.CurrentThread.GetApartmentState().ToString(); } // Make sure you use this custom STAOperationBehavior // attribute to force STA operation of service methods [STAOperationBehavior] [OperationContract] public string HelloWorldSta() { return Thread.CurrentThread.GetApartmentState().ToString(); } } Pretty straight forward. The latter method returns STA while the former returns MTA. To make STA work every method needs to be marked up. The implementation consists of the attribute and OperationInvoker implementation. Here are the two classes required to make this work from Scott's post:public class STAOperationBehaviorAttribute : Attribute, IOperationBehavior { public void AddBindingParameters(OperationDescription operationDescription, System.ServiceModel.Channels.BindingParameterCollection bindingParameters) { } public void ApplyClientBehavior(OperationDescription operationDescription, System.ServiceModel.Dispatcher.ClientOperation clientOperation) { // If this is applied on the client, well, it just doesn’t make sense. // Don’t throw in case this attribute was applied on the contract // instead of the implementation. } public void ApplyDispatchBehavior(OperationDescription operationDescription, System.ServiceModel.Dispatcher.DispatchOperation dispatchOperation) { // Change the IOperationInvoker for this operation. dispatchOperation.Invoker = new STAOperationInvoker(dispatchOperation.Invoker); } public void Validate(OperationDescription operationDescription) { if (operationDescription.SyncMethod == null) { throw new InvalidOperationException("The STAOperationBehaviorAttribute " + "only works for synchronous method invocations."); } } } public class STAOperationInvoker : IOperationInvoker { IOperationInvoker _innerInvoker; public STAOperationInvoker(IOperationInvoker invoker) { _innerInvoker = invoker; } public object[] AllocateInputs() { return _innerInvoker.AllocateInputs(); } public object Invoke(object instance, object[] inputs, out object[] outputs) { // Create a new, STA thread object[] staOutputs = null; object retval = null; Thread thread = new Thread( delegate() { retval = _innerInvoker.Invoke(instance, inputs, out staOutputs); }); thread.SetApartmentState(ApartmentState.STA); thread.Start(); thread.Join(); outputs = staOutputs; return retval; } public IAsyncResult InvokeBegin(object instance, object[] inputs, AsyncCallback callback, object state) { // We don’t handle async… throw new NotImplementedException(); } public object InvokeEnd(object instance, out object[] outputs, IAsyncResult result) { // We don’t handle async… throw new NotImplementedException(); } public bool IsSynchronous { get { return true; } } } The key in this setup is the Invoker and the Invoke method which creates a new thread and then fires the request on this new thread. Because this approach creates a new thread for every request it's not super efficient. There's a bunch of overhead involved in creating the thread and throwing it away after each thread, but it'll work for low volume requests and insure each thread runs in STA mode. If better performance is required it would be useful to create a custom thread manager that can pool a number of STA threads and hand off threads as needed rather than creating new threads on every request. If your Web Service needs are simple and you need only to serve standard SOAP 1.x requests, I would recommend sticking with ASMX services. It's easier to set up and work with and for STA component use it'll be significantly better performing since ASP.NET manages the STA thread pool for you rather than firing new threads for each request. One nice thing about Scotts code is though that it works in any WCF environment including self hosting. It has no dependency on ASP.NET or WebForms for that matter. STA - If you must STA components are a pain in the ass and thankfully there isn't too much stuff out there anymore that requires it. But when you need it and you need to access STA functionality from .NET at least there are a few options available to make it happen. Each of these solutions is a bit hacky, but they work - I've used all of them in production with good results with FoxPro components. I hope compiling all of these in one place here makes it STA consumption a little bit easier. I feel your pain :-) Resources Download STA Handler Code Examples Scott Seely's original STA WCF OperationBehavior Article© Rick Strahl, West Wind Technologies, 2005-2012Posted in FoxPro ASP.NET .NET COM Tweet !function(d,s,id){var js,fjs=d.getElementsByTagName(s)[0];if(!d.getElementById(id)){js=d.createElement(s);js.id=id;js.src="//platform.twitter.com/widgets.js";fjs.parentNode.insertBefore(js,fjs);}}(document,"script","twitter-wjs"); (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

Read the article

Silverlight Recruiting Application Part 6 - Adding an Interview Scheduling Module/View

Between the last post and this one I went ahead and carried the ideas for the Jobs module and view into the Applicants module and view- they're both doing more or less the same thing, except with different objects being at their core. Made for an easy cut-and-paste operation with a few items being switched from one to another. Now that we have the ability to add postings and applicants, wouldn't it be nice if we could schedule an interview? Of course it would! Scheduling Module I think you get the drift from previous posts that these project structures start looking somewhat similar. The interview scheduling module is no different than the rest- it gets a SchedulingModule.cs file at the root that inherits from IModule, and there is a single SchedulerView.xsml and SchedulerViewModel.cs setup for our V+VM. We have one unique concern as we enter into this- RadScheduler deals with AppointmentsSource, not ItemsSource, so there are some special considerations to take into account when planning this module. First, I need something which inherits from AppointmentBase. This is the core of the RadScheduler appointment, and if you are planning to do any form of custom appointment, you'll want it to inherit from this. Then you can add-on functionality as needed. Here is my addition to the mix, the InterviewAppointment: 01.public class InterviewAppointment : AppointmentBase 02.{ 03. private int _applicantID; 04. public int ApplicantID 05. { 06. get { return this._applicantID; } 07. set 08. { 09. if (_applicantID != value) 10. { 11. _applicantID = value; 12. OnPropertyChanged("ApplicantID"); 13. } 14. } 15. } 16. 17. private int _postingID; 18. public int PostingID 19. { 20. get { return _postingID; } 21. set 22. { 23. if (_postingID != value) 24. { 25. _postingID = value; 26. OnPropertyChanged("PostingID"); 27. } 28. } 29. } 30. 31. private string _body; 32. public string Body 33. { 34. get { return _body; } 35. set 36. { 37. if (_body != value) 38. { 39. _body = value; 40. OnPropertyChanged("Body"); 41. } 42. } 43. } 44. 45. private int _interviewID; 46. public int InterviewID 47. { 48. get { return _interviewID; } 49. set 50. { 51. if (_interviewID != value) 52. { 53. _interviewID = value; 54. OnPropertyChanged("InterviewID"); 55. } 56. } 57. } 58. 59. public override IAppointment Copy() 60. { 61. IAppointment appointment = new InterviewAppointment(); 62. appointment.CopyFrom(this); 63. return appointment; 64. } 65. 66. public override void CopyFrom(IAppointment other) 67. { 68. base.CopyFrom(other); 69. var appointment = other as InterviewAppointment; 70. if (appointment != null) 71. { 72. ApplicantID = appointment.ApplicantID; 73. PostingID = appointment.PostingID; 74. Body = appointment.Body; 75. InterviewID = appointment.InterviewID; 76. } 77. } 78.} Nothing too exciting going on here, we just make sure that our custom fields are persisted (specifically set in CopyFrom at the bottom) and notifications are fired- otherwise this ends up exactly like the standard appointment as far as interactions, etc. But if we've got custom appointment items... that also means we need to customize what our appointment dialog window will look like. Customizing the Edit Appointment Dialog This initially sounds a lot more intimidating than it really is. The first step here depends on what you're dealing with for theming, but for ease of everything I went ahead and extracted my templates in Blend for RadScheduler so I could modify it as I pleased. For the faint of heart, the RadScheduler template is a few thousand lines of goodness since there are some very complex things going on in that control. I've gone ahead and trimmed down the template parts I don't need as much as possible, so what is left is all that is relevant to the Edit Appointment Dialog. Here's the resulting Xaml, with line numbers, so I can explain further: 001.<UserControl.Resources> 002.  003. <helpers:DataContextProxy x:Key="DataContextProxy" /> 004. 005. <telerik:Windows7Theme x:Key="Theme" /> 006. <SolidColorBrush x:Key="DialogWindowBackground" 007. Color="White" /> 008. <SolidColorBrush x:Key="CategorySelectorBorderBrush" 009. Color="#FFB1B1B1" /> 010. <LinearGradientBrush x:Key="RadToolBar_InnerBackground" 011. EndPoint="0.5,1" 012. StartPoint="0.5,0"> 013. <GradientStop Color="#FFFDFEFF" 014. Offset="0" /> 015. <GradientStop Color="#FFDDE9F7" 016. Offset="1" /> 017. <GradientStop Color="#FFE6F0FA" 018. Offset="0.5" /> 019. <GradientStop Color="#FFDCE6F4" 020. Offset="0.5" /> 021. </LinearGradientBrush> 022. <Style x:Key="FormElementTextBlockStyle" 023. TargetType="TextBlock"> 024. <Setter Property="HorizontalAlignment" 025. Value="Right" /> 026. <Setter Property="VerticalAlignment" 027. Value="Top" /> 028. <Setter Property="Margin" 029. Value="15, 15, 0, 2" /> 030. </Style> 031. <Style x:Key="FormElementStyle" 032. TargetType="FrameworkElement"> 033. <Setter Property="Margin" 034. Value="10, 10, 0, 2" /> 035. </Style> 036. <SolidColorBrush x:Key="GenericShallowBorderBrush" 037. Color="#FF979994" /> 038. <telerik:BooleanToVisibilityConverter x:Key="BooleanToVisibilityConverter" /> 039. <telerikScheduler:ImportanceToBooleanConverter x:Key="ImportanceToBooleanConverter" /> 040. <telerikScheduler:NullToVisibilityConverter x:Key="NullToVisibilityConverter" /> 041. <telerikScheduler:InvertedNullToVisibilityConverter x:Key="InvertedNullToVisibilityConverter" /> 042. <scheduler:ResourcesSeparatorConverter x:Key="ResourcesSeparatorConverter" /> 043. <DataTemplate x:Key="IconDataEditTemplate"> 044. <Image Source="/Telerik.Windows.Controls.Scheduler;component/Themes/Office/Images/cal.png" 045. Margin="3,3,0,0" 046. Width="16" 047. Height="16" /> 048. </DataTemplate> 049. <DataTemplate x:Key="SingleSelectionTemplate"> 050. <Grid VerticalAlignment="Stretch" 051. HorizontalAlignment="Stretch"> 052. <Grid.RowDefinitions> 053. <RowDefinition Height="Auto" /> 054. </Grid.RowDefinitions> 055. <Grid.ColumnDefinitions> 056. <ColumnDefinition Width="Auto" 057. MinWidth="84" /> 058. <ColumnDefinition Width="Auto" 059. MinWidth="200" /> 060. </Grid.ColumnDefinitions> 061. <TextBlock x:Name="SelectionNameLabel" 062. Margin="0,13,4,2" 063. Text="{Binding ResourceType.DisplayName}" 064. Style="{StaticResource FormElementTextBlockStyle}" 065. Grid.Column="0" /> 066. <telerikInput:RadComboBox ItemsSource="{Binding ResourceItems}" 067. Width="185" 068. Margin="5,10,20,2" 069. HorizontalAlignment="Left" 070. Grid.Column="1" 071. ClearSelectionButtonVisibility="Visible" 072. ClearSelectionButtonContent="Clear All" 073. DisplayMemberPath="Resource.DisplayName" 074. telerik:StyleManager.Theme="{StaticResource Theme}" 075. SelectedItem="{Binding SelectedItem, Mode=TwoWay}" /> 076. </Grid> 077. </DataTemplate> 078. <DataTemplate x:Key="MultipleSelectionTemplate"> 079. <Grid VerticalAlignment="Stretch" 080. HorizontalAlignment="Stretch"> 081. <Grid.RowDefinitions> 082. <RowDefinition Height="Auto" /> 083. </Grid.RowDefinitions> 084. <Grid.ColumnDefinitions> 085. <ColumnDefinition Width="Auto" 086. MinWidth="84" /> 087. <ColumnDefinition Width="Auto" 088. MinWidth="200" /> 089. </Grid.ColumnDefinitions> 090. <TextBlock x:Name="SelectionNameLabel" 091. Grid.Column="0" 092. Text="{Binding ResourceType.DisplayName}" 093. Margin="0,13,4,2" 094. Style="{StaticResource FormElementTextBlockStyle}" /> 095. <telerikInput:RadComboBox Grid.Column="1" 096. Width="185" 097. HorizontalAlignment="Left" 098. Margin="5,10,20,2" 099. ItemsSource="{Binding ResourceItems}" 100. SelectedIndex="{Binding SelectedIndex, Mode=TwoWay}" 101. ClearSelectionButtonVisibility="Visible" 102. ClearSelectionButtonContent="Clear All" 103. telerik:StyleManager.Theme="{StaticResource Theme}"> 104. <telerikInput:RadComboBox.ItemTemplate> 105. <DataTemplate> 106. <Grid HorizontalAlignment="Stretch" 107. VerticalAlignment="Stretch"> 108. <CheckBox VerticalAlignment="Center" 109. HorizontalContentAlignment="Stretch" 110. VerticalContentAlignment="Center" 111. IsChecked="{Binding IsChecked, Mode=TwoWay}" 112. Content="{Binding Resource.DisplayName}"> 113. <CheckBox.ContentTemplate> 114. <DataTemplate> 115. <TextBlock HorizontalAlignment="Stretch" 116. VerticalAlignment="Stretch" 117. Text="{Binding Content, RelativeSource={RelativeSource TemplatedParent}}" /> 118. </DataTemplate> 119. </CheckBox.ContentTemplate> 120. </CheckBox> 121. </Grid> 122. </DataTemplate> 123. </telerikInput:RadComboBox.ItemTemplate> 124. </telerikInput:RadComboBox> 125. </Grid> 126. </DataTemplate> 127. <scheduler:ResourceTypeTemplateSelector x:Key="ItemTemplateSelector" 128. MultipleSelectionTemplate="{StaticResource MultipleSelectionTemplate}" 129. SingleSelectionTemplate="{StaticResource SingleSelectionTemplate}" /> 130.  131. 132. <ControlTemplate x:Key="EditAppointmentTemplate" 133. TargetType="telerikScheduler:AppointmentDialogWindow"> 134. <StackPanel Background="{TemplateBinding Background}" 135. UseLayoutRounding="True"> 136. <StackPanel Grid.Row="0" 137. Orientation="Horizontal" 138. Background="{StaticResource RadToolBar_InnerBackground}" 139. Grid.ColumnSpan="2" 140. Height="0"> 141.  142. <Border Margin="1,1,0,0" 143. Background="#50000000" 144. HorizontalAlignment="Left" 145. VerticalAlignment="Center" 146. Width="2" 147. Height="16"> 148. <Border Margin="0,0,1,1" 149. Background="#80FFFFFF" 150. HorizontalAlignment="Left" 151. Width="1" /> 152. </Border> 153. <Border Margin="1,1,0,0" 154. Background="#50000000" 155. HorizontalAlignment="Left" 156. VerticalAlignment="Center" 157. Width="2" 158. Height="16"> 159. <Border Margin="0,0,1,1" 160. Background="#80FFFFFF" 161. HorizontalAlignment="Left" 162. Width="1" /> 163. </Border> 164. <TextBlock telerik:LocalizationManager.ResourceKey="ShowAs" 165. VerticalAlignment="Center" 166. Margin="5,0,0,0" /> 167. <telerikInput:RadComboBox ItemsSource="{TemplateBinding TimeMarkers}" 168. Width="100" 169. Height="20" 170. VerticalAlignment="Center" 171. Margin="5,0,0,0" 172. ClearSelectionButtonVisibility="Visible" 173. ClearSelectionButtonContent="Clear" 174. SelectedItem="{Binding TimeMarker,RelativeSource={RelativeSource TemplatedParent},Mode=TwoWay}" 175. telerik:StyleManager.Theme="{StaticResource Theme}"> 176. <telerikInput:RadComboBox.ItemTemplate> 177. <DataTemplate> 178. <StackPanel Orientation="Horizontal"> 179. <Rectangle Fill="{Binding TimeMarkerBrush}" 180. Margin="2" 181. Width="12" 182. Height="12" /> 183. <TextBlock Text="{Binding TimeMarkerName}" 184. Margin="2" /> 185. </StackPanel> 186. </DataTemplate> 187. </telerikInput:RadComboBox.ItemTemplate> 188. </telerikInput:RadComboBox> 189. <telerik:RadToggleButton x:Name="High" 190. BorderThickness="0" 191. Background="{StaticResource RadToolBar_InnerBackground}" 192. DataContext="{TemplateBinding EditedAppointment}" 193. telerik:StyleManager.Theme="{StaticResource Theme}" 194. IsChecked="{Binding Importance,Mode=TwoWay, Converter={StaticResource ImportanceToBooleanConverter},ConverterParameter=High}" 195. Margin="2,2,0,2" 196. Width="23" 197. Height="23" 198. HorizontalContentAlignment="Center" 199. ToolTipService.ToolTip="High importance" 200. CommandParameter="High" 201. Command="telerikScheduler:RadSchedulerCommands.SetAppointmentImportance"> 202. <StackPanel HorizontalAlignment="Center"> 203. <Path Stretch="Fill" 204. Height="10" 205. HorizontalAlignment="Center" 206. VerticalAlignment="Top" 207. Width="5.451" 208. Data="M200.39647,58.840393 C200.39337,58.336426 201.14566,57.683922 202.56244,57.684292 C204.06589,57.684685 204.73764,58.357765 204.72783,58.992363 C205.04649,61.795574 203.04713,64.181099 202.47388,66.133446 C201.93753,64.154961 199.9471,61.560352 200.39647,58.840393 z"> 209. <Path.Fill> 210. <LinearGradientBrush EndPoint="1.059,0.375" 211. StartPoint="-0.457,0.519"> 212. <GradientStop Color="#FFFF0606" 213. Offset="0.609" /> 214. <GradientStop Color="#FFBF0303" 215. Offset="0.927" /> 216. </LinearGradientBrush> 217. </Path.Fill> 218. </Path> 219. <Ellipse Height="3" 220. HorizontalAlignment="Center" 221. Margin="0,-1,0,0" 222. VerticalAlignment="Top" 223. Width="3"> 224. <Ellipse.Fill> 225. <RadialGradientBrush> 226. <GradientStop Color="#FFFF0606" 227. Offset="0" /> 228. <GradientStop Color="#FFBF0303" 229. Offset="1" /> 230. </RadialGradientBrush> 231. </Ellipse.Fill> 232. </Ellipse> 233. </StackPanel> 234. </telerik:RadToggleButton> 235. <telerik:RadToggleButton x:Name="Low" 236. HorizontalContentAlignment="Center" 237. BorderThickness="0" 238. Background="{StaticResource RadToolBar_InnerBackground}" 239. DataContext="{TemplateBinding EditedAppointment}" 240. IsChecked="{Binding Importance,Mode=TwoWay, Converter={StaticResource ImportanceToBooleanConverter},ConverterParameter=Low}" 241. Margin="0,2,0,2" 242. Width="23" 243. Height="23" 244. ToolTipService.ToolTip="Low importance" 245. CommandParameter="Low" 246. telerik:StyleManager.Theme="{StaticResource Theme}" 247. Command="telerikScheduler:RadSchedulerCommands.SetAppointmentImportance"> 248. <Path Stretch="Fill" 249. Height="12" 250. HorizontalAlignment="Center" 251. VerticalAlignment="Top" 252. Width="9" 253. Data="M222.40353,60.139881 L226.65768,60.139843 L226.63687,67.240196 L229.15347,67.240196 L224.37816,71.394943 L219.65274,67.240196 L222.37572,67.219345 z" 254. Stroke="#FF0365A7"> 255. <Path.Fill> 256. <LinearGradientBrush EndPoint="1.059,0.375" 257. StartPoint="-0.457,0.519"> 258. <GradientStop Color="#FFBBE4FF" /> 259. <GradientStop Color="#FF024572" 260. Offset="0.836" /> 261. <GradientStop Color="#FF43ADF4" 262. Offset="0.466" /> 263. </LinearGradientBrush> 264. </Path.Fill> 265. </Path> 266. </telerik:RadToggleButton> 267. </StackPanel > 268. <Border DataContext="{TemplateBinding EditedAppointment}" 269. Background="{Binding Category.CategoryBrush}" 270. Visibility="{Binding Category,Converter={StaticResource NullToVisibilityConverter}}" 271. CornerRadius="3" 272. Height="20" 273. Margin="5,10,5,0"> 274. <TextBlock Text="{Binding Category.DisplayName}" 275. VerticalAlignment="Center" 276. Margin="5,0,0,0" /> 277. </Border> 278. <Grid VerticalAlignment="Stretch" 279. HorizontalAlignment="Stretch" 280. DataContext="{TemplateBinding EditedAppointment}" 281. Background="{TemplateBinding Background}"> 282. <Grid.RowDefinitions> 283. <RowDefinition Height="Auto" /> 284. <RowDefinition Height="Auto" /> 285. <RowDefinition Height="Auto" /> 286. <RowDefinition Height="Auto" /> 287. <RowDefinition Height="Auto" /> 288. <RowDefinition Height="Auto" /> 289. <RowDefinition Height="Auto" /> 290. <RowDefinition Height="Auto" /> 291. <RowDefinition Height="Auto" /> 292. <RowDefinition Height="Auto" /> 293. </Grid.RowDefinitions> 294. <Grid.ColumnDefinitions> 295. <ColumnDefinition Width="Auto" 296. MinWidth="100" /> 297. <ColumnDefinition Width="Auto" 298. MinWidth="200" /> 299. </Grid.ColumnDefinitions> 300.  301. <TextBlock x:Name="SubjectLabel" 302. Grid.Row="0" 303. Grid.Column="0" 304. Margin="0,15,0,2" 305. telerik:LocalizationManager.ResourceKey="Subject" 306. Style="{StaticResource FormElementTextBlockStyle}" /> 307. <TextBox x:Name="Subject" 308. Grid.Row="0" 309. Grid.Column="1" 310. MinHeight="22" 311. Padding="4 2" 312. Width="340" 313. HorizontalAlignment="Left" 314. Text="{Binding Subject, Mode=TwoWay}" 315. MaxLength="255" 316. telerik:StyleManager.Theme="{StaticResource Theme}" 317. Margin="10,12,20,2" /> 318.  319. <TextBlock x:Name="DescriptionLabel" 320. Grid.Row="1" 321. Grid.Column="0" 322. Margin="0,13,0,2" 323. telerik:LocalizationManager.ResourceKey="Body" 324. Style="{StaticResource FormElementTextBlockStyle}" /> 325. <TextBox x:Name="Body" 326. VerticalAlignment="top" 327. Grid.Row="1" 328. Grid.Column="1" 329. Height="Auto" 330. MaxHeight="82" 331. Width="340" 332. HorizontalAlignment="Left" 333. MinHeight="22" 334. Padding="4 2" 335. TextWrapping="Wrap" 336. telerik:StyleManager.Theme="{StaticResource Theme}" 337. Text="{Binding Body, Mode=TwoWay}" 338. AcceptsReturn="true" 339. Margin="10,10,20,2" 340. HorizontalScrollBarVisibility="Auto" 341. VerticalScrollBarVisibility="Auto" /> 342.  343. <TextBlock x:Name="StartDateLabel" 344. Grid.Row="2" 345. Grid.Column="0" 346. Margin="0,13,0,2" 347. telerik:LocalizationManager.ResourceKey="StartTime" 348. Style="{StaticResource FormElementTextBlockStyle}" /> 349. <telerikScheduler:DateTimePicker x:Name="StartDateTime" 350. Height="22" 351. Grid.Row="2" 352. Grid.Column="1" 353. HorizontalAlignment="Left" 354. Margin="10,10,20,2" 355. Style="{StaticResource FormElementStyle}" 356. SelectedDateTime="{Binding Start, Mode=TwoWay}" 357. telerikScheduler:StartEndDatePicker.EndPicker="{Binding ElementName=EndDateTime}" 358. IsTabStop="False" 359. IsEnabled="False" /> 360. <TextBlock x:Name="EndDateLabel" 361. Grid.Row="3" 362. Grid.Column="0" 363. Margin="0,13,0,2" 364. telerik:LocalizationManager.ResourceKey="EndTime" 365. Style="{StaticResource FormElementTextBlockStyle}" /> 366. <telerikScheduler:DateTimePicker x:Name="EndDateTime" 367. Height="22" 368. Grid.Row="3" 369. Grid.Column="1" 370. HorizontalAlignment="Left" 371. Margin="10,10,20,2" 372. Style="{StaticResource FormElementStyle}" 373. IsTabStop="False" 374. IsEnabled="False" 375. SelectedDateTime="{Binding End, Mode=TwoWay}" /> 376.  377. <CheckBox x:Name="AllDayEventCheckbox" 378. IsChecked="{Binding IsAllDayEvent, Mode=TwoWay}" 379. Grid.Row="4" 380. Grid.Column="1" 381. Margin="10,10,20,2" 382. HorizontalAlignment="Left" 383. telerik:StyleManager.Theme="{StaticResource Theme}" 384. telerik:LocalizationManager.ResourceKey="AllDayEvent"> 385. <telerik:CommandManager.InputBindings> 386. <telerik:InputBindingCollection> 387. <telerik:MouseBinding Command="telerikScheduler:RadSchedulerCommands.ChangeTimePickersVisibility" 388. Gesture="LeftClick" /> 389. </telerik:InputBindingCollection> 390. </telerik:CommandManager.InputBindings> 391. </CheckBox> 392. <Grid Grid.Row="5" 393. Grid.ColumnSpan="2"> 394. <Grid.ColumnDefinitions> 395. <ColumnDefinition Width="Auto" 396. MinWidth="100" /> 397. <ColumnDefinition Width="Auto" 398. MinWidth="200" /> 399. </Grid.ColumnDefinitions> 400. <Grid.RowDefinitions> 401. <RowDefinition Height="Auto" /> 402. <RowDefinition Height="Auto" /> 403. </Grid.RowDefinitions> 404. <TextBlock Text="Applicant" 405. Margin="0,13,0,2" 406. Style="{StaticResource FormElementTextBlockStyle}" /> 407. <telerikInput:RadComboBox IsEditable="False" 408. Grid.Column="1" 409. Height="24" 410. VerticalAlignment="Center" 411. ItemsSource="{Binding Source={StaticResource DataContextProxy}, Path=DataSource.ApplicantList}" 412. SelectedValue="{Binding ApplicantID, Mode=TwoWay}" 413. SelectedValuePath="ApplicantID" 414. DisplayMemberPath="FirstName" /> 415. 416. <TextBlock Text="Job" 417. Margin="0,13,0,2" 418. Grid.Row="1" 419. Style="{StaticResource FormElementTextBlockStyle}" /> 420. <telerikInput:RadComboBox IsEditable="False" 421. Grid.Column="1" 422. Grid.Row="1" 423. Height="24" 424. VerticalAlignment="Center" 425. ItemsSource="{Binding Source={StaticResource DataContextProxy}, Path=DataSource.JobsList}" 426. SelectedValue="{Binding PostingID, Mode=TwoWay}" 427. SelectedValuePath="PostingID" 428. DisplayMemberPath="JobTitle"/> 429. </Grid> 430.  431. <Grid x:Name="ResourcesLayout" 432. Grid.Row="7" 433. Grid.Column="0" 434. Grid.ColumnSpan="2" 435. MaxHeight="130" 436. Margin="20,5,20,0"> 437. <Border Margin="0" 438. BorderThickness="1" 439. BorderBrush="{StaticResource GenericShallowBorderBrush}" 440. Visibility="{Binding ElementName=ResourcesScrollViewer, Path=ComputedVerticalScrollBarVisibility}"></Border> 441. <ScrollViewer x:Name="ResourcesScrollViewer" 442. IsTabStop="false" 443. Grid.Row="6" 444. Grid.Column="0" 445. Grid.ColumnSpan="2" 446. Margin="1" 447. telerik:StyleManager.Theme="{StaticResource Theme}" 448. VerticalScrollBarVisibility="Auto"> 449. <scheduler:ResourcesItemsControl x:Name="PART_Resources" 450. HorizontalAlignment="Left" 451. Padding="0,2,0,5" 452. IsTabStop="false" 453. ItemsSource="{TemplateBinding ResourceTypeModels}" 454. ItemTemplateSelector="{StaticResource ItemTemplateSelector}" /> 455. </ScrollViewer> 456. </Grid> 457. <StackPanel x:Name="FooterControls" 458. Margin="5 10 10 10" 459. Grid.Row="8" 460. Grid.Column="1" 461. HorizontalAlignment="Left" 462. Orientation="Horizontal"> 463. <telerik:RadButton x:Name="OKButton" 464. Margin="5" 465. Padding="10 0" 466. MinWidth="80" 467. Command="telerikScheduler:RadSchedulerCommands.SaveAppointment" 468. telerik:StyleManager.Theme="{StaticResource Theme}" 469. telerikNavigation:RadWindow.ResponseButton="Accept" 470. telerik:LocalizationManager.ResourceKey="SaveAndCloseCommandText"> 471. </telerik:RadButton> 472. <telerik:RadButton x:Name="CancelButton" 473. Margin="5" 474. Padding="10 0" 475. MinWidth="80" 476. telerik:LocalizationManager.ResourceKey="Cancel" 477. telerik:StyleManager.Theme="{StaticResource Theme}" 478. telerikNavigation:RadWindow.ResponseButton="Cancel" 479. Command="telerik:WindowCommands.Close"> 480. </telerik:RadButton> 481. </StackPanel> 482. </Grid> 483. <vsm:VisualStateManager.VisualStateGroups> 484. <vsm:VisualStateGroup x:Name="RecurrenceRuleState"> 485. <vsm:VisualState x:Name="RecurrenceRuleIsNull"> 486. <Storyboard> 487. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="StartDateTime" 488. Storyboard.TargetProperty="IsEnabled" 489. Duration="0"> 490. <DiscreteObjectKeyFrame KeyTime="0" 491. Value="True" /> 492. </ObjectAnimationUsingKeyFrames> 493. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="EndDateTime" 494. Storyboard.TargetProperty="IsEnabled" 495. Duration="0"> 496. <DiscreteObjectKeyFrame KeyTime="0" 497. Value="True" /> 498. </ObjectAnimationUsingKeyFrames> 499. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="AllDayEventCheckbox" 500. Storyboard.TargetProperty="IsEnabled" 501. Duration="0"> 502. <DiscreteObjectKeyFrame KeyTime="0" 503. Value="True" /> 504. </ObjectAnimationUsingKeyFrames> 505. </Storyboard> 506. </vsm:VisualState> 507. <vsm:VisualState x:Name="RecurrenceRuleIsNotNull"> 508. <Storyboard> 509. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="StartDateTime" 510. Storyboard.TargetProperty="IsEnabled" 511. Duration="0"> 512. <DiscreteObjectKeyFrame KeyTime="0" 513. Value="False" /> 514. </ObjectAnimationUsingKeyFrames> 515. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="EndDateTime" 516. Storyboard.TargetProperty="IsEnabled" 517. Duration="0"> 518. <DiscreteObjectKeyFrame KeyTime="0" 519. Value="False" /> 520. </ObjectAnimationUsingKeyFrames> 521. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="AllDayEventCheckbox" 522. Storyboard.TargetProperty="IsEnabled" 523. Duration="0"> 524. <DiscreteObjectKeyFrame KeyTime="0" 525. Value="False" /> 526. </ObjectAnimationUsingKeyFrames> 527. </Storyboard> 528. </vsm:VisualState> 529. </vsm:VisualStateGroup> 530. </vsm:VisualStateManager.VisualStateGroups> 531. </StackPanel> 532. </ControlTemplate> 533. <DataTemplate x:Key="AppointmentDialogWindowHeaderDataTemplate"> 534. <StackPanel Orientation="Horizontal" 535. MaxWidth="400"> 536. <TextBlock telerik:LocalizationManager.ResourceKey="Event" 537. Visibility="{Binding Appointment.IsAllDayEvent, Converter={StaticResource BooleanToVisibilityConverter}}" /> 538. <TextBlock telerik:LocalizationManager.ResourceKey="Appointment" 539. Visibility="{Binding Appointment.IsAllDayEvent, Converter={StaticResource InvertedBooleanToVisibilityConverter}}" /> 540. <TextBlock Text=" - " /> 541. <TextBlock x:Name="SubjectTextBlock" 542. Visibility="{Binding Appointment.Subject, Converter={StaticResource NullToVisibilityConverter}}" 543. Text="{Binding Appointment.Subject}" /> 544. <TextBlock telerik:LocalizationManager.ResourceKey="Untitled" 545. Visibility="{Binding Appointment.Subject, Converter={StaticResource InvertedNullToVisibilityConverter}}" /> 546. </StackPanel> 547. </DataTemplate> 548. <Style x:Key="EditAppointmentStyle" 549. TargetType="telerikScheduler:AppointmentDialogWindow"> 550. <Setter Property="IconTemplate" 551. Value="{StaticResource IconDataEditTemplate}" /> 552. <Setter Property="HeaderTemplate" 553. Value="{StaticResource AppointmentDialogWindowHeaderDataTemplate}" /> 554. <Setter Property="Background" 555. Value="{StaticResource DialogWindowBackground}" /> 556. <Setter Property="Template" 557. Value="{StaticResource EditAppointmentTemplate}" /> 558. </Style> 559.</UserControl.Resources> The first line there is the DataContextProxy I mentioned previously- we use that again to work a bit of magic in this template. Where we start getting into the dialog in question is line 132, but line 407 is where things start getting interesting. The ItemsSource is pointing at a list that exists in my ViewModel (or code-behind, if it is used as a DataContext), the SelectedValue is the item I am actually binding from the applicant (note the TwoWay binding), and SelectedValuePath and DisplayMemberPath ensure the proper applicant is being displayed from the collection. You will also see similar starting on line 420 where I do the same for the Jobs we'll be displaying. Just to wrap-up the Xaml, here's the RadScheduler declaraction that ties this all together and will be the main focus of our view: 01.<telerikScheduler:RadScheduler x:Name="xJobsScheduler" 02. Grid.Row="1" 03. Grid.Column="1" 04. Width="800" 05. MinWidth="600" 06. Height="500" 07. MinHeight="300" 08. AppointmentsSource="{Binding Interviews}" 09. EditAppointmentStyle="{StaticResource EditAppointmentStyle}" 10. command:AppointmentAddedEventClass.Command="{Binding AddAppointmentCommand}" 11. command:ApptCreatedEventClass.Command="{Binding ApptCreatingCommand}" 12. command:ApptEditedEventClass.Command="{Binding ApptEditedCommand}" 13. command:ApptDeletedEventClass.Command="{Binding ApptDeletedCommand}"> 14.</telerikScheduler:RadScheduler> Now, we get to the ViewModel and what it takes to get that rigged up. And for those of you who remember the jobs post, those command:s in the Xaml are pointing to attached behavior commands that reproduce the respective events. This becomes very handy when we're setting up the code-behind version. ;) ViewModel I've been liking this approach so far, so I'm going to put the entire ViewModel here and then go into the lines of interest. Of course, feel free to ask me questions about anything that isn't clear (by line number, ideally) so I can help out if I have missed anything important: 001.public class SchedulerViewModel : ViewModelBase 002.{ 003. private readonly IEventAggregator eventAggregator; 004. private readonly IRegionManager regionManager; 005. 006. public RecruitingContext context; 007. 008. private ObservableItemCollection<InterviewAppointment> _interviews = new ObservableItemCollection<InterviewAppointment>(); 009. public ObservableItemCollection<InterviewAppointment> Interviews 010. { 011. get { return _interviews; } 012. set 013. { 014. if (_interviews != value) 015. { 016. _interviews = value; 017. NotifyChanged("Interviews"); 018. } 019. } 020. } 021. 022. private QueryableCollectionView _jobsList; 023. public QueryableCollectionView JobsList 024. { 025. get { return this._jobsList; } 026. set 027. { 028. if (this._jobsList != value) 029. { 030. this._jobsList = value; 031. this.NotifyChanged("JobsList"); 032. } 033. } 034. } 035. 036. private QueryableCollectionView _applicantList; 037. public QueryableCollectionView ApplicantList 038. { 039. get { return _applicantList; } 040. set 041. { 042. if (_applicantList != value) 043. { 044. _applicantList = value; 045. NotifyChanged("ApplicantList"); 046. } 047. } 048. } 049. 050. public DelegateCommand<object> AddAppointmentCommand { get; set; } 051. public DelegateCommand<object> ApptCreatingCommand { get; set; } 052. public DelegateCommand<object> ApptEditedCommand { get; set; } 053. public DelegateCommand<object> ApptDeletedCommand { get; set; } 054. 055. public SchedulerViewModel(IEventAggregator eventAgg, IRegionManager regionmanager) 056. { 057. // set Unity items 058. this.eventAggregator = eventAgg; 059. this.regionManager = regionmanager; 060. 061. // load our context 062. context = new RecruitingContext(); 063. LoadOperation<Interview> loadOp = context.Load(context.GetInterviewsQuery()); 064. loadOp.Completed += new EventHandler(loadOp_Completed); 065. 066. this._jobsList = new QueryableCollectionView(context.JobPostings); 067. context.Load(context.GetJobPostingsQuery()); 068. 069. this._applicantList = new QueryableCollectionView(context.Applicants); 070. context.Load(context.GetApplicantsQuery()); 071. 072. AddAppointmentCommand = new DelegateCommand<object>(this.AddAppt); 073. ApptCreatingCommand = new DelegateCommand<object>(this.ApptCreating); 074. ApptEditedCommand = new DelegateCommand<object>(this.ApptEdited); 075. ApptDeletedCommand = new DelegateCommand<object>(this.ApptDeleted); 076. 077. } 078. 079. void loadOp_Completed(object sender, EventArgs e) 080. { 081. LoadOperation loadop = sender as LoadOperation; 082. 083. foreach (var ent in loadop.Entities) 084. { 085. _interviews.Add(EntityToAppointment(ent as Interview)); 086. } 087. } 088. 089. #region Appointment Adding 090. 091. public void AddAppt(object obj) 092. { 093. // now we have a new InterviewAppointment to add to our QCV :) 094. InterviewAppointment newInterview = obj as InterviewAppointment; 095. 096. this.context.Interviews.Add(AppointmentToEntity(newInterview)); 097. this.context.SubmitChanges((s) => 098. { 099. ActionHistory myAction = new ActionHistory(); 100. myAction.InterviewID = newInterview.InterviewID; 101. myAction.PostingID = newInterview.PostingID; 102. myAction.ApplicantID = newInterview.ApplicantID; 103. myAction.Description = String.Format("Interview with {0} has been created by {1}", newInterview.ApplicantID.ToString(), "default user"); 104. myAction.TimeStamp = DateTime.Now; 105. eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); 106. } 107. , null); 108. } 109. 110. public void ApptCreating(object obj) 111. { 112. // handled in the behavior, just a placeholder to ensure it runs :) 113. } 114. 115. #endregion 116. 117. #region Appointment Editing 118. 119. public void ApptEdited(object obj) 120. { 121. Interview editedInterview = (from x in context.Interviews 122. where x.InterviewID == (obj as InterviewAppointment).InterviewID 123. select x).SingleOrDefault(); 124. 125. CopyAppointmentEdit(editedInterview, obj as InterviewAppointment); 126. 127. context.SubmitChanges((s) => { 128. ActionHistory myAction = new ActionHistory(); 129. myAction.InterviewID = editedInterview.InterviewID; 130. myAction.PostingID = editedInterview.PostingID; 131. myAction.ApplicantID = editedInterview.ApplicantID; 132. myAction.Description = String.Format("Interview with {0} has been modified by {1}", editedInterview.ApplicantID.ToString(), "default user"); 133. myAction.TimeStamp = DateTime.Now; 134. eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); } 135. , null); 136. } 137. 138. #endregion 139. 140. #region Appointment Deleting 141. 142. public void ApptDeleted(object obj) 143. { 144. Interview deletedInterview = (from x in context.Interviews 145. where x.InterviewID == (obj as InterviewAppointment).InterviewID 146. select x).SingleOrDefault(); 147. 148. context.Interviews.Remove(deletedInterview); 149. context.SubmitChanges((s) => 150. { 151. ActionHistory myAction = new ActionHistory(); 152. myAction.InterviewID = deletedInterview.InterviewID; 153. myAction.PostingID = deletedInterview.PostingID; 154. myAction.ApplicantID = deletedInterview.ApplicantID; 155. myAction.Description = String.Format("Interview with {0} has been deleted by {1}", deletedInterview.ApplicantID.ToString(), "default user"); 156. myAction.TimeStamp = DateTime.Now; 157. eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); 158. } 159. , null); 160. } 161. 162. #endregion 163. 164. #region Appointment Helpers :) 165. 166. public Interview AppointmentToEntity(InterviewAppointment ia) 167. { 168. Interview newInterview = new Interview(); 169. newInterview.Subject = ia.Subject; 170. newInterview.Body = ia.Body; 171. newInterview.Start = ia.Start; 172. newInterview.End = ia.End; 173. newInterview.ApplicantID = ia.ApplicantID; 174. newInterview.PostingID = ia.PostingID; 175. newInterview.InterviewID = ia.InterviewID; 176. 177. return newInterview; 178. } 179. 180. public InterviewAppointment EntityToAppointment(Interview ia) 181. { 182. InterviewAppointment newInterview = new InterviewAppointment(); 183. newInterview.Subject = ia.Subject; 184. newInterview.Body = ia.Body; 185. newInterview.Start = ia.Start; 186. newInterview.End = ia.End; 187. newInterview.ApplicantID = ia.ApplicantID; 188. newInterview.PostingID = ia.PostingID; 189. newInterview.InterviewID = ia.InterviewID; 190. 191. return newInterview; 192. } 193. 194. public void CopyAppointmentEdit(Interview entityInterview, InterviewAppointment appointmentInterview) 195. { 196. entityInterview.Subject = appointmentInterview.Subject; 197. entityInterview.Body = appointmentInterview.Body; 198. entityInterview.Start = appointmentInterview.Start; 199. entityInterview.End = appointmentInterview.End; 200. entityInterview.ApplicantID = appointmentInterview.ApplicantID; 201. entityInterview.PostingID = appointmentInterview.PostingID; 202. } 203. 204. #endregion 205.} One thing we're doing here which you won't see in any of the other ViewModels is creating a duplicate collection. I know this is something which will be fixed down the line for using RadScheduler, simplifying this process, but with WCF RIA changing as it does I wanted to ensure functionality would remain consistent as I continued development on this application. So, I do a little bit of duplication, but for the greater good. This all takes place starting on line 79, so for every entity that comes back we add it to the collection that is bound to RadScheduler. Otherwise, the DelegateCommands that you see correspond directly to the events they are named after. In each case, rather than sending over the full event arguments, I just send in the appointment in question (coming through as the object obj in all cases) so I can add (line 91), edit (line 119), and delete appointments (line 142) like normal. This just ensures they get updated back to my database. Also, the one bit of code you won't see is for the Appointment Creating (line 110) event- that is because in the command I've created I simply make the replacement I need to: 1.void element_AppointmentCreating(object sender, AppointmentCreatingEventArgs e) 2.{ 3. e.NewAppointment = new InterviewAppointment(); 4. base.ExecuteCommand(); 5.} And the ViewModel is none the wiser, the appointments just work as far as it is concerned since as they are created they become InterviewAppointments. End result? I've customized my EditAppointmentDialog as follows: And adding, editing, and deleting appointments works like a charm. I can even 'edit' by moving appointments around RadScheduler, so as they are dropped into a timeslot they perform their full edit routine and things get updated. And then, the Code-Behind Version Perhaps the thing I like the most about doing one then the other is I get to steal 90% or more of the code from the MVVM version. For example, the only real changes to the Code-Behind Xaml file exist in the control declaration, in which I use events instead of attached-behavior-event-commands: 01.<telerikScheduler:RadScheduler x:Name="xJobsScheduler" 02. Grid.Row="1" 03. Grid.Column="1" 04. Width="800" 05. MinWidth="600" 06. Height="500" 07. MinHeight="300" 08. EditAppointmentStyle="{StaticResource EditAppointmentStyle}" 09. AppointmentAdded="xJobsScheduler_AppointmentAdded" 10. AppointmentCreating="xJobsScheduler_AppointmentCreating" 11. AppointmentEdited="xJobsScheduler_AppointmentEdited" 12. AppointmentDeleted="xJobsScheduler_AppointmentDeleted"> 13.</telerikScheduler:RadScheduler> Easy, right? Otherwise, all the same styling in UserControl.Resources was re-used, right down to the DataContextProxy that lets us bind to a collection from our viewmodel (in this case, our code-behind) to use within the DataTemplate. The code conversion gets even easier, as I could literally copy and paste almost everything from the ViewModel to my Code-Behind, just a matter of pasting the right section into the right event. Here's the code-behind as proof: 001.public partial class SchedulingView : UserControl, INotifyPropertyChanged 002.{ 003. public RecruitingContext context; 004. 005. private QueryableCollectionView _jobsList; 006. public QueryableCollectionView JobsList 007. { 008. get { return this._jobsList; } 009. set 010. { 011. if (this._jobsList != value) 012. { 013. this._jobsList = value; 014. this.NotifyChanged("JobsList"); 015. } 016. } 017. } 018. 019. private QueryableCollectionView _applicantList; 020. public QueryableCollectionView ApplicantList 021. { 022. get { return _applicantList; } 023. set 024. { 025. if (_applicantList != value) 026. { 027. _applicantList = value; 028. NotifyChanged("ApplicantList"); 029. } 030. } 031. } 032. 033. private ObservableItemCollection<InterviewAppointment> _interviews = new ObservableItemCollection<InterviewAppointment>(); 034. public ObservableItemCollection<InterviewAppointment> Interviews 035. { 036. get { return _interviews; } 037. set 038. { 039. if (_interviews != value) 040. { 041. _interviews = value; 042. NotifyChanged("Interviews"); 043. } 044. } 045. } 046. 047. public SchedulingView() 048. { 049. InitializeComponent(); 050. 051. this.DataContext = this; 052. 053. this.Loaded += new RoutedEventHandler(SchedulingView_Loaded); 054. } 055. 056. void SchedulingView_Loaded(object sender, RoutedEventArgs e) 057. { 058. this.xJobsScheduler.AppointmentsSource = Interviews; 059. 060. context = new RecruitingContext(); 061. 062. LoadOperation loadop = context.Load(context.GetInterviewsQuery()); 063. loadop.Completed += new EventHandler(loadop_Completed); 064. 065. this._applicantList = new QueryableCollectionView(context.Applicants); 066. context.Load(context.GetApplicantsQuery()); 067. 068. this._jobsList = new QueryableCollectionView(context.JobPostings); 069. context.Load(context.GetJobPostingsQuery()); 070. } 071. 072. void loadop_Completed(object sender, EventArgs e) 073. { 074. LoadOperation loadop = sender as LoadOperation; 075. 076. _interviews.Clear(); 077. 078. foreach (var ent in loadop.Entities) 079. { 080. _interviews.Add(EntityToAppointment(ent as Interview)); 081. } 082. } 083. 084. private void xJobsScheduler_AppointmentAdded(object sender, Telerik.Windows.Controls.AppointmentAddedEventArgs e) 085. { 086. // now we have a new InterviewAppointment to add to our QCV :) 087. InterviewAppointment newInterview = e.Appointment as InterviewAppointment; 088. 089. this.context.Interviews.Add(AppointmentToEntity(newInterview)); 090. this.context.SubmitChanges((s) => 091. { 092. ActionHistory myAction = new ActionHistory(); 093. myAction.InterviewID = newInterview.InterviewID; 094. myAction.PostingID = newInterview.PostingID; 095. myAction.ApplicantID = newInterview.ApplicantID; 096. myAction.Description = String.Format("Interview with {0} has been created by {1}", newInterview.ApplicantID.ToString(), "default user"); 097. myAction.TimeStamp = DateTime.Now; 098. context.ActionHistories.Add(myAction); 099. context.SubmitChanges(); 100. } 101. , null); 102. } 103. 104. private void xJobsScheduler_AppointmentCreating(object sender, Telerik.Windows.Controls.AppointmentCreatingEventArgs e) 105. { 106. e.NewAppointment = new InterviewAppointment(); 107. } 108. 109. private void xJobsScheduler_AppointmentEdited(object sender, Telerik.Windows.Controls.AppointmentEditedEventArgs e) 110. { 111. Interview editedInterview = (from x in context.Interviews 112. where x.InterviewID == (e.Appointment as InterviewAppointment).InterviewID 113. select x).SingleOrDefault(); 114. 115. CopyAppointmentEdit(editedInterview, e.Appointment as InterviewAppointment); 116. 117. context.SubmitChanges((s) => 118. { 119. ActionHistory myAction = new ActionHistory(); 120. myAction.InterviewID = editedInterview.InterviewID; 121. myAction.PostingID = editedInterview.PostingID; 122. myAction.ApplicantID = editedInterview.ApplicantID; 123. myAction.Description = String.Format("Interview with {0} has been modified by {1}", editedInterview.ApplicantID.ToString(), "default user"); 124. myAction.TimeStamp = DateTime.Now; 125. context.ActionHistories.Add(myAction); 126. context.SubmitChanges(); 127. } 128. , null); 129. } 130. 131. private void xJobsScheduler_AppointmentDeleted(object sender, Telerik.Windows.Controls.AppointmentDeletedEventArgs e) 132. { 133. Interview deletedInterview = (from x in context.Interviews 134. where x.InterviewID == (e.Appointment as InterviewAppointment).InterviewID 135. select x).SingleOrDefault(); 136. 137. context.Interviews.Remove(deletedInterview); 138. context.SubmitChanges((s) => 139. { 140. ActionHistory myAction = new ActionHistory(); 141. myAction.InterviewID = deletedInterview.InterviewID; 142. myAction.PostingID = deletedInterview.PostingID; 143. myAction.ApplicantID = deletedInterview.ApplicantID; 144. myAction.Description = String.Format("Interview with {0} has been deleted by {1}", deletedInterview.ApplicantID.ToString(), "default user"); 145. myAction.TimeStamp = DateTime.Now; 146. context.ActionHistories.Add(myAction); 147. context.SubmitChanges(); 148. } 149. , null); 150. } 151. 152. #region Appointment Helpers :) 153. 154. public Interview AppointmentToEntity(InterviewAppointment ia) 155. { 156. Interview newInterview = new Interview(); 157. newInterview.Subject = ia.Subject; 158. newInterview.Body = ia.Body; 159. newInterview.Start = ia.Start; 160. newInterview.End = ia.End; 161. newInterview.ApplicantID = ia.ApplicantID; 162. newInterview.PostingID = ia.PostingID; 163. newInterview.InterviewID = ia.InterviewID; 164. 165. return newInterview; 166. } 167. 168. public InterviewAppointment EntityToAppointment(Interview ia) 169. { 170. InterviewAppointment newInterview = new InterviewAppointment(); 171. newInterview.Subject = ia.Subject; 172. newInterview.Body = ia.Body; 173. newInterview.Start = ia.Start; 174. newInterview.End = ia.End; 175. newInterview.ApplicantID = ia.ApplicantID; 176. newInterview.PostingID = ia.PostingID; 177. newInterview.InterviewID = ia.InterviewID; 178. 179. return newInterview; 180. } 181. 182. public void CopyAppointmentEdit(Interview entityInterview, InterviewAppointment appointmentInterview) 183. { 184. entityInterview.Subject = appointmentInterview.Subject; 185. entityInterview.Body = appointmentInterview.Body; 186. entityInterview.Start = appointmentInterview.Start; 187. entityInterview.End = appointmentInterview.End; 188. entityInterview.ApplicantID = appointmentInterview.ApplicantID; 189. entityInterview.PostingID = appointmentInterview.PostingID; 190. } 191. 192. #endregion 193. 194. #region INotifyPropertyChanged Members 195. 196. public event PropertyChangedEventHandler PropertyChanged; 197. 198. public void NotifyChanged(string propertyName) 199. { 200. if (string.IsNullOrEmpty(propertyName)) 201. throw new ArgumentException("propertyName"); 202. 203. PropertyChanged(this, new PropertyChangedEventArgs(propertyName)); 204. } 205. 206. #endregion 207.} Nice... right? :) One really important thing to note as well. See on line 51 where I set the DataContext before the Loaded event? This is super important, as if you don't have this set before the usercontrol is loaded, the DataContextProxy has no context to use and your EditAppointmentDialog Job/Applicant dropdowns will be blank and empty. Trust me on this, took a little bit of debugging to figure out that by setting the DataContext post-loaded would only lead to disaster and frustration. Otherwise, the only other real difference is that instead of sending an ActionHistory item through an event to get added to the database and saved, I do those right in the callback from submitting. The Result Again, I only have to post one picture because these bad boys used nearly identical code for both the MVVM and the code-behind views, so our end result is... So what have we learned here today? One, for the most part this MVVM thing is somewhat easy. Yeah, you sometimes have to write a bunch of extra code, but with the help of a few useful snippits you can turn the process into a pretty streamlined little workflow. Heck, this story gets even easier as you can see in this blog post by Michael Washington- specifically run a find on 'InvokeCommandAction' and you'll see the section regarding the command on TreeView in Blend 4. Brilliant! MVVM never looked so sweet! Otherwise, it is business as usual with RadScheduler for Silverlight whichever path you're choosing for your development. Between now and the next post, I'll be cleaning up styles a bit (those RadComboBoxes are a little too close to my labels!) and adding some to the RowDetailsViews for Applicants and Jobs, so you can see all the info for an appointment in the dropdown tab view. Otherwise, we're about ready to call a wrap on this oneDid you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

Read the article

Why should you choose Oracle WebLogic 12c instead of JBoss EAP 6?

- by Ricardo Ferreira

In this post, I will cover some technical differences between Oracle WebLogic 12c and JBoss EAP 6, which was released a couple days ago from Red Hat. This article claims to help you in the evaluation of key points that you should consider when choosing for an Java EE application server. In the following sections, I will present to you some important aspects that most customers ask us when they are seriously evaluating for an middleware infrastructure, specially if you are considering JBoss for some reason. I would suggest that you keep the following question in mind while you are reading the points: "Why should I choose JBoss instead of WebLogic?" 1) Multi Datacenter Deployment and Clustering - D/R ("Disaster & Recovery") architecture support is embedded on the WebLogic Server 12c product. JBoss EAP 6 on the other hand has no direct D/R support included, Red Hat relies on third-part tools with higher prices. When you consider a middleware solution to host your business critical application, you should worry with every architectural aspect that are related with the solution. Fail-over support is one little aspect of a truly reliable solution. If you do not worry about D/R, your solution will not be reliable. Having said that, with Red Hat and JBoss EAP 6, you have this extra cost that will increase considerably the total cost of ownership of the solution. As we commonly hear from analysts, open-source are not so cheaper when you start seeing the big picture. - WebLogic Server 12c supports advanced LAN clustering, detection of death servers and have a common alert framework. JBoss EAP 6 on the other hand has limited LAN clustering support with no server death detection. They do not generate any alerts when servers goes down (only if you buy JBoss ON which is a separated technology, but until now does not support JBoss EAP 6) and manual intervention are required when servers goes down. In most cases, admin people must rely on "kill -9", "tail -f someFile.log" and "ps ax | grep java" commands to manage failures and clustering anomalies. - WebLogic Server 12c supports the concept of Node Manager, which is a separated process that runs on the physical | virtual servers that allows extend the administration of the cluster to WebLogic managed servers that are often distributed across multiple machines and geographic locations. JBoss EAP 6 on the other hand has no equivalent technology. Whole server instances must be managed individually. - WebLogic Server 12c Node Manager supports Coherence to boost performance when managing servers. JBoss EAP 6 on the other hand has no similar technology. There is no way to coordinate JBoss and infiniband instances provided by JBoss using high throughput and low latency protocols like InfiniBand. The Node Manager feature also allows another very important feature that JBoss EAP lacks: secure the administration. When using WebLogic Node Manager, all the administration tasks are sent to the managed servers in a secure tunel protected by a certificate, which means that the transport layer that separates the WebLogic administration console from the managed servers are secured by SSL. - WebLogic Server 12c are now integrated with OTD ("Oracle Traffic Director") which is a web server technology derived from the former Sun iPlanet Web Server. This software complements the web server support offered by OHS ("Oracle HTTP Server"). Using OTD, WebLogic instances are load-balanced by a high powerful software that knows how to handle SDP ("Socket Direct Protocol") over InfiniBand, which boost performance when used with engineered systems technologies like Oracle Exalogic Elastic Cloud. JBoss EAP 6 on the other hand only offers support to Apache Web Server with custom modules created to deal with JBoss clusters, but only across standard TCP/IP networks. 2) Application and Runtime Diagnostics - WebLogic Server 12c have diagnostics capabilities embedded on the server called WLDF ("WebLogic Diagnostic Framework") so there is no need to rely on third-part tools. JBoss EAP 6 on the other hand has no diagnostics capabilities. Their only diagnostics tool is the log generated by the application server. Admin people are encouraged to analyse thousands of log lines to find out what is going on. - WebLogic Server 12c complement WLDF with JRockit MC ("Mission Control"), which provides to administrators and developers a complete insight about the JVM performance, behavior and possible bottlenecks. WebLogic Server 12c also have an classloader analysis tool embedded, and even a log analyzer tool that enables administrators and developers to view logs of multiple servers at the same time. JBoss EAP 6 on the other hand relies on third-part tools to do something similar. Again, only log searching are offered to find out whats going on. - WebLogic Server 12c offers end-to-end traceability and monitoring available through Oracle EM ("Enterprise Manager"), including monitoring of business transactions that flows through web servers, ESBs, application servers and database servers, all of this with high deep JVM analysis and diagnostics. JBoss EAP 6 on the other hand, even using JBoss ON ("Operations Network"), which is a separated technology, does not support those features. Red Hat relies on third-part tools to provide direct Oracle database traceability across JVMs. One of those tools are Oracle EM for non-Oracle middleware that manage JBoss, Tomcat, Websphere and IIS transparently. - WebLogic Server 12c with their JRockit support offers a tool called JRockit Flight Recorder, which can give developers a complete visibility of a certain period of application production monitoring with zero extra overhead. This automatic recording allows you to deep analyse threads latency, memory leaks, thread contention, resource utilization, stack overflow damages and GC ("Garbage Collection") cycles, to observe in real time stop-the-world phenomenons, generational, reference count and parallel collects and mutator threads analysis. JBoss EAP 6 don't even dream to support something similar, even because they don't have their own JVM. 3) Application Server Administration - WebLogic Server 12c offers a complete administration console complemented with scripting and macro-like recording capabilities. A single WebLogic console can managed up to hundreds of WebLogic servers belonging to the same domain. JBoss EAP 6 on the other hand has a limited console and provides a XML centric administration. JBoss, after ten years, started the development of a rudimentary centralized administration that still leave a lot of administration tasks aside, so admin people and developers must touch scripts and XML configuration files for most advanced and even simple administration tasks. This lead applications to error prone and risky deployments. Even using JBoss ON, JBoss EAP are not able to offer decent administration features for admin people which must be high skilled in JBoss internal architecture and its managing capabilities. - Oracle EM is available to manage multiple domains, databases, application servers, operating systems and virtualization, with a complete end-to-end visibility. JBoss ON does not provide management capabilities across the complete architecture, only basic monitoring. Even deployment must be done aside JBoss ON which does no integrate well with others softwares than JBoss. Until now, JBoss ON does not supports JBoss EAP 6, so even their minimal support for JBoss are not available for JBoss EAP 6 leaving customers uncovered and subject to high skilled JBoss admin people. - WebLogic Server 12c has the same administration model whatever is the topology selected by the customer. JBoss EAP 6 on the other hand differentiates between two operational models: standalone-mode and domain-mode, that are not consistent with each other. Depending on the mode used, the administration skill is different. - WebLogic Server 12c has no point-of-failures processes, and it does not need to define any specialized server. Domain model in WebLogic is available for years (at least ten years or more) and is production proven. JBoss EAP 6 on the other hand needs special processes to garantee JBoss integrity, the PC ("Process-Controller") and the HC ("Host-Controller"). Different from WebLogic, the domain model in JBoss is quite new (one year at tops) of maturity, and need to mature considerably until start doing things like WebLogic domain model does. - WebLogic Server 12c supports parallel deployment model which enables some artifacts being deployed at the same time. JBoss EAP 6 on the other hand does not have any similar feature. Every deployment are done atomically in the containers. This means that if you have a huge EAR (an EAR of 120 MB of size for instance) and deploy onto JBoss EAP 6, this EAR will take some minutes in order to starting accept thread requests. The same EAR deployed onto WebLogic Server 12c will reduce the deployment time at least in 2X compared to JBoss. 4) Support and Upgrades - WebLogic Server 12c has patch management available. JBoss EAP 6 on the other hand has no patch management available, each JBoss EAP instance should be patched manually. To achieve such feature, you need to buy a separated technology called JBoss ON ("Operations Network") that manage this type of stuff. But until now, JBoss ON does not support JBoss EAP 6 so, in practice, JBoss EAP 6 does not have this feature. - WebLogic Server 12c supports previuous WebLogic domains without any reconfiguration since its kernel is robust and mature since its creation in 1995. JBoss EAP 6 on the other hand has a proven lack of supportability between JBoss AS 4, 5, 6 and 7. Different kernels and messaging engines were implemented in JBoss stack in the last five years reveling their incapacity to create a well architected and proven middleware technology. - WebLogic Server 12c has patch prescription based on customer configuration. JBoss EAP 6 on the other hand has no such capability. People need to create ticket supports and have their installations revised by Red Hat support guys to gain some patch prescription from them. - Oracle WebLogic Server independent of the version has 8 years of support of new patches and has lifetime release of existing patches beyond that. JBoss EAP 6 on the other hand provides patches for a specific application server version up to 5 years after the release date. JBoss EAP 4 and previous versions had only 4 years. A good question that Red Hat will argue to answer is: "what happens when you find issues after year 5"? 5) RAC ("Real Application Clusters") Support - WebLogic Server 12c ships with a specific JDBC driver to leverage Oracle RAC clustering capabilities (Fast-Application-Notification, Transaction Affinity, Fast-Connection-Failover, etc). Oracle JDBC thin driver are also available. JBoss EAP 6 on the other hand ships only the standard Oracle JDBC thin driver. Load balancing with Oracle RAC are not supported. Manual intervention in case of planned or unplanned RAC downtime are necessary. In JBoss EAP 6, situation does not reestablish automatically after downtime. - WebLogic Server 12c has a feature called Active GridLink for Oracle RAC which provides up to 3X performance on OLTP applications. This seamless integration between WebLogic and Oracle database enable more value added to critical business applications leveraging their investments in Oracle database technology and Oracle middleware. JBoss EAP 6 on the other hand has no performance gains at all, even when admin people implement some kind of connection-pooling tuning. - WebLogic Server 12c also supports transaction and web session affinity to the Oracle RAC, which provides aditional gains of performance. This is particularly interesting if you are creating a reliable solution that are distributed not only in an LAN cluster, but into a different data center. JBoss EAP 6 on the other hand has no such support. 6) Standards and Technology Support - WebLogic Server 12c is fully Java EE 6 compatible and production ready since december of 2011. JBoss EAP 6 on the other hand became fully compatible with Java EE 6 only in the community version after three months, and production ready only in a few days considering that this article was written in June of 2012. Red Hat says that they are the masters of innovation and technology proliferation, but compared with Oracle and even other proprietary vendors like IBM, they historically speaking are lazy to deliver the most newest technologies and standards adherence. - Oracle is the steward of Java, driving innovation into the platform from commercial and open-source vendors. Red Hat on the other hand does not have its own JVM and relies on third-part JVMs to complete their application server offer. 95% of Red Hat customers are using Oracle HotSpot as JVM, which means that without Oracle involvement, their support are limited exclusively to the application server layer and we all know that most problems are happens in the JVM layer. - WebLogic Server 12c supports natively JDK 7, which empower developers to explore the maximum of the Java platform productivity when writing code. This feature differentiate WebLogic from others application servers (except GlassFish that are also managed by Oracle) because the usage of JDK 7 introduce such remarkable productivity features like the "try-with-resources" enhancement, catching multiple exceptions with one try block, Strings in the switch statements, JVM improvements in terms of JDBC, I/O, networking, security, concurrency and of course, the most important feature of Java 7: native support for multiple non-Java languages. More features regarding JDK 7 can be found here. JBoss EAP 6 on the other hand does not support JDK 7 officially, they comment in their community version that "Java SE 7 can be used with JBoss 7" which does not gives you any guarantees of enterprise support for JDK 7. - Oracle WebLogic Server 12c supports integration with Spring framework allowing Spring applications to use WebLogic special transaction manager, exposing bean interfaces to WebLogic MBeans to take advantage of all WebLogic monitoring and administration advantages. JBoss EAP 6 on the other hand has no special integration with Spring. In fact, Red Hat offers a suspicious package called "JBoss Web Platform" that in theory supports Spring, but in practice this package does not offers any special integration. It is just a facility for Red Hat customers to have support from both JBoss and Spring technology using the same customer support. 7) Lightweight Development - Oracle WebLogic Server 12c and Oracle GlassFish are completely integrated and can share applications without any modifications. Starting with the 12c version, WebLogic now understands natively GlassFish deployment descriptors and specific configurations in order to offer you a truly and reliable migration path from a community Java EE application server to a enterprise middleware product like WebLogic. JBoss EAP 6 on the other hand has no support to natively reuse an existing (or still in development) application from JBoss AS community server. Users of JBoss suffer of critical issues during deployment time that includes: changing the libraries and dependencies of the application, patching the DTD or XSD deployment descriptors, refactoring of the application layers due classloading issues and anomalies, rebuilding of persistence, business and web layers due issues with "usage of the certified version of an certain dependency" or "frameworks that Red Hat potentially does not recommend" etc. If you have the culture or enterprise IT directive of developing Java EE applications using community middleware to in a certain future, transition to enterprise (supported by a vendor) middleware, Oracle WebLogic plus Oracle GlassFish offers you a more sustainable solution. - WebLogic Server 12c has a very light ZIP distribution (less than 165 MB). JBoss EAP 6 ZIP size is around 130 MB, together with JBoss ON you have more 100 MB resulting in a higher download footprint. This is particularly interesting if you plan to use automated setup of application server instances (for example, to rapidly setup a development or staging environment) using Maven or Hudson. - WebLogic Server 12c has a complete integration with Maven allowing developers to setup WebLogic domains with few commands. Tasks like downloading WebLogic, installation, domain creation, data sources deployment are completely integrated. JBoss EAP 6 on the other hand has a limited offer integration with those tools. - WebLogic Server 12c has a startup mode called WLX that turns-off EJB, JMS and JCA containers leaving enabled only the web container with Java EE 6 web profile. JBoss EAP 6 on the other hand has no such feature, you need to disable manually the containers that you do not want to use. - WebLogic Server 12c supports fastswap, which enables you to change classes without redeployment. This is particularly interesting if you are developing patches for the application that is already deployed and you do not want to redeploy the entire application. This is the same behavior that most application servers offers to JSP pages, but with WebLogic Server 12c, you have the same feature for Java classes in general. JBoss EAP 6 on the other hand has no such support. Even JBoss EAP 5 does not support this until now. 8) JMS and Messaging - WebLogic Server 12c has a proven and high scalable JMS implementation since its initial release in 1995. JBoss EAP 6 on the other hand has a still immature technology called HornetQ, which was introduced in JBoss EAP 5 replacing everything that was implemented in the previous versions. Red Hat loves to introduce new technologies across JBoss versions, playing around with customers and their investments. And when they are asked about why they have changed the implementation and caused such a mess, their answer is always: "the previous implementation was inadequate and not aligned with the community strategy so we are creating a new a improved one". This Red Hat practice leads to uncomfortable investments that in a near future (sometimes less than a year) will be affected in someway. - WebLogic Server 12c has troubleshooting and monitoring features included on the WebLogic console and WLDF. JBoss EAP 6 on the other hand has no direct monitoring on the console, activity is reflected only on the logs, no debug logs available in case of JMS issues. - WebLogic Server 12c has extremely good performance and scalability. JBoss EAP 6 on the other hand has a JMS storage mechanism relying on Oracle database or MySQL. This means that if an issue in production happens and Red Hat affirms that an performance issue is happening due to database problems, they will not support you on the performance issue. They will orient you to call Oracle instead. - WebLogic Server 12c supports messaging enterprise features like SAF ("Store and Forward"), Distributed Queues/Topics and Foreign JMS providers support that leverage JMS implementations without compromise developer code making things completely transparent. JBoss EAP 6 on the other hand do not even dream to support such features. 9) Caching and Grid - Coherence, which is the leading and most mature data grid technology from Oracle, is available since early 2000 and was integrated with WebLogic in 2009. Coherence and WebLogic clusters can be both managed from WebLogic administrative console. Even Node Manager supports Coherence. JBoss on the other hand discontinued JBoss Cache, which was their caching implementation just like they did with the messaging implementation (JBossMQ) which was a issue for long term customers. JBoss EAP 6 ships InfiniSpan version 1.0 which is immature and lack a proven record of successful cases and reliability. - WebLogic Server 12c has a feature called ActiveCache which uses Coherence to, without any code changes, replicate HTTP sessions from both WebLogic and other application servers like JBoss, Tomcat, Websphere, GlassFish and even Microsoft IIS. JBoss EAP 6 on the other hand does have such support and even when they do in the future, they probably will support only their own application server. - Coherence can be used to manage both L1 and L2 cache levels, providing support to Oracle TopLink and others JPA compliant implementations, even Hibernate. JBoss EAP 6 and Infinispan on the other hand supports only Hibernate. And most important of all: Infinispan does not have any successful case of L1 or L2 caching level support using Hibernate, which lead us to reflect about its viability. 10) Performance - WebLogic Server 12c is certified with Oracle Exalogic Elastic Cloud and can run unchanged applications at this engineered system. This approach can benefit customers from Exalogic optimization's of both kernel and JVM layers to boost performance in terms of 10X for web, OLTP, JMS and grid applications. JBoss EAP 6 on the other hand has no investment on engineered systems: customers do not have the choice to deploy on a Java ultra fast system if their project becomes relevant and performance issues are detected. - WebLogic Server 12c maintains a performance gain across each new release: starting on WebLogic 5.1, the overall performance gain has been close to 4X, which close to a 20% gain release by release. JBoss on the other hand does not provide SPECJAppServer or SPECJEnterprise performance benchmarks. Their so called "performance gains" remains hidden in their customer environments, which lead us to think if it is true or not since we will never get access to those environments. - WebLogic Server 12c has industry performance benchmarks with submissions across platforms and configurations leading SPECJ. Oracle WebLogic leads SPECJAppServer performance in multiple categories, fitting all customer topologies like: dual-node, single-node, multi-node and multi-node with RAC. JBoss... again, does not provide any SPECJAppServer performance benchmarks. - WebLogic Server 12c has a feature called work manager which allows your application to embrace new performance levels based on critical resource utilization of the CPUs usage. Work managers prioritizes work and allocates threads based on an execution model that takes into account administrator-defined parameters and actual run-time performance and throughput. JBoss EAP 6 on the other hand has no compared feature and probably they never will. Not supporting such feature like work managers, JBoss EAP 6 forces admin people and specially developers to uncover performance gains in a intrusive way, rewriting the code and doing performance refactorings. 11) Professional Services Support - WebLogic Server 12c and any other technology sold by Oracle give customers the possibility of hire OCS ("Oracle Consulting Services") to manage critical scenarios, deployment assistance of new applications, high skilled consultancy of architecture, best practices and people allocation together with customer teams. All OCS services are available without any restrictions, having the customer bought software from Oracle or just starting their implementation before any acquisition. JBoss EAP 6 or Red Hat to be more specifically, only offers professional services if you buy subscriptions from them. If you are developing a new critical application for your business and need the help of Red Hat for a serious issue or architecture decision, they will probably say: "OK... I can help you but after you buy subscriptions from me". Red Hat also does not allows their professional services consultants to manage environments that uses community based software. They will probably force you to first buy a subscription, download their "enterprise" version and them, optionally hire their consultants. - Oracle provides you our university to educate your team into our technologies, including of course specialized trainings of WebLogic application server. At any time and location, you can hire Oracle to train your team so you get trustful knowledge according to your specific needs. Certifications for the products are also available if your technical people desire to differentiate themselves as professionals. Red Hat on the other hand have a limited pool of resources to train your team in their technologies. Basically they are selling training and certification for RHEL ("Red Hat Enterprise Linux") but if you demand more specialized training in JBoss middleware, they will probably connect you to some "certified" partner localized training since they are apparently discontinuing their education center, at least here in Brazil. They were not able to reproduce their success with RHEL education to their middleware division since they need first sell the subscriptions to after gives you specialized training. And again, they only offer you specialized training based on their enterprise version (EAP in the case of JBoss) which means that the courses will be a quite outdated. There are reports of developers that took official training's from Red Hat at this year (2012) and in a certain JBoss advanced course, Red Hat supposedly covered JBossMQ as the messaging subsystem, and even the printed material provided was based on JBossMQ since the training was created for JBoss EAP 4.3. 12) Encouraging Transparency without Ulterior Motives - WebLogic Server 12c like any other software from Oracle can be downloaded any time from anywhere, you should only possess an OTN ("Oracle Technology Network") credential and you can download any enterprise software how many times you want. And is not some kind of "trial" version. It is the official binaries that will be running for ever in your data center. Oracle does not encourages the usage of "specific versions" of our software. The binaries you buy from Oracle are the same binaries anyone in the world could download and use for testing and personal education. JBoss EAP 6 on the other hand are not available for download unless you buy a subscription and get access to the Red Hat enterprise repositories. If you need to test, learn or just start creating your application using Red Hat's middleware software, you should download it from the community website. You are not allowed to download the enterprise version that, according to Red Hat are more secure, reliable and robust. But no one of us want to start the development of a software with an unsecured, unreliable and not scalable middleware right? So what you do? You are "invited" by Red Hat to buy subscriptions from them to get access to the "cool" version of the software. - WebLogic Server 12c prices are publicly available in the Oracle website. If you want to know right now how much WebLogic will cost to your organization, just click here and get access to our price list. In the case of WebLogic, check out the "US Oracle Technology Commercial Price List". Oracle also encourages you to get in touch with a sales representative to discuss discounts that would make possible the investment into our technology. But you are not required to do this, only if you are interested in buying our technology or maybe you want to discuss some discount scenarios. JBoss EAP 6 on the other hand does not have its cost publicly available in Red Hat's website or in any other media, at least is not so easy to get such information. The only link you will possibly find in their website is a "Contact a Sales Representative" link. This is not a very good relationship between an customer and an vendor. This is not an example of transparency, mainly when the software are sold as open. In this situations, customers expects to see the software prices publicly available, so they can have the chance to decide, based on the existing features of the software, if the cost is fair or not. Conclusion Oracle WebLogic is the most mature, secure, reliable and scalable Java EE application server of the market, and have a proven record of success around the globe to prove it's majority. Don't lose the chance to discover today how WebLogic could fit your needs and sustain your global IT middleware strategy, no matter if your strategy are completely based on the Cloud or not.

Read the article

Silverlight for Windows Embedded tutorial (step 4)

- by Valter Minute

I’m back with my Silverlight for Windows Embedded tutorial. Sorry for the long delay between step 3 and step 4, the MVP summit and some work related issue prevented me from working on the tutorial during the last weeks. In our first, second and third tutorial steps we implemented some very simple applications, just to understand the basic structure of a Silverlight for Windows Embedded application, learn how to handle events and how to operate on images. In this third step our sample application will be slightly more complicated, to introduce two new topics: list boxes and custom control. We will also learn how to create controls at runtime. I choose to explain those topics together and provide a sample a bit more complicated than usual just to start to give the feeling of how a “real” Silverlight for Windows Embedded application is organized. As usual we can start using Expression Blend to define our main page. In this case we will have a listbox and a textblock. Here’s the XAML code: <UserControl xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" x:Class="ListDemo.Page" Width="640" Height="480" x:Name="ListPage" xmlns:ListDemo="clr-namespace:ListDemo"> <Grid x:Name="LayoutRoot" Background="White"> <ListBox Margin="19,57,19,66" x:Name="FileList" SelectionChanged="Filelist_SelectionChanged"/> <TextBlock Height="35" Margin="19,8,19,0" VerticalAlignment="Top" TextWrapping="Wrap" x:Name="CurrentDir" Text="TextBlock" FontSize="20"/> </Grid> </UserControl> In our listbox we will load a list of directories, starting from the filesystem root (there are no drives in Windows CE, the filesystem has a single root named “\”). When the user clicks on an item inside the list, the corresponding directory path will be displayed in the TextBlock object and the subdirectories of the selected branch will be shown inside the list. As you can see we declared an event handler for the SelectionChanged event of our listbox. We also used a different font size for the TextBlock, to make it more readable. XAML and Expression Blend allow you to customize your UI pretty heavily, experiment with the tools and discover how you can completely change the aspect of your application without changing a single line of code! Inside our ListBox we want to insert the directory presenting a nice icon and their name, just like you are used to see them inside Windows 7 file explorer, for example. To get this we will define a user control. This is a custom object that will behave like “regular” Silverlight for Windows Embedded objects inside our application. First of all we have to define the look of our custom control, named DirectoryItem, using XAML: <UserControl xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" mc:Ignorable="d" x:Class="ListDemo.DirectoryItem" Width="500" Height="80"> <StackPanel x:Name="LayoutRoot" Orientation="Horizontal"> <Canvas Width="31.6667" Height="45.9583" Margin="10,10,10,10" RenderTransformOrigin="0.5,0.5"> <Canvas.RenderTransform> <TransformGroup> <ScaleTransform/> <SkewTransform/> <RotateTransform Angle="-31.27"/> <TranslateTransform/> </TransformGroup> </Canvas.RenderTransform> <Rectangle Width="31.6667" Height="45.8414" Canvas.Left="0" Canvas.Top="0.116943" Stretch="Fill"> <Rectangle.Fill> <LinearGradientBrush StartPoint="0.142631,0.75344" EndPoint="1.01886,0.75344"> <LinearGradientBrush.RelativeTransform> <TransformGroup> <SkewTransform CenterX="0.142631" CenterY="0.75344" AngleX="19.3128" AngleY="0"/> <RotateTransform CenterX="0.142631" CenterY="0.75344" Angle="-35.3436"/> </TransformGroup> </LinearGradientBrush.RelativeTransform> <LinearGradientBrush.GradientStops> <GradientStop Color="#FF7B6802" Offset="0"/> <GradientStop Color="#FFF3D42C" Offset="1"/> </LinearGradientBrush.GradientStops> </LinearGradientBrush> </Rectangle.Fill> </Rectangle> <Rectangle Width="29.8441" Height="43.1517" Canvas.Left="0.569519" Canvas.Top="1.05249" Stretch="Fill"> <Rectangle.Fill> <LinearGradientBrush StartPoint="0.142632,0.753441" EndPoint="1.01886,0.753441"> <LinearGradientBrush.RelativeTransform> <TransformGroup> <SkewTransform CenterX="0.142632" CenterY="0.753441" AngleX="19.3127" AngleY="0"/> <RotateTransform CenterX="0.142632" CenterY="0.753441" Angle="-35.3437"/> </TransformGroup> </LinearGradientBrush.RelativeTransform> <LinearGradientBrush.GradientStops> <GradientStop Color="#FFCDCDCD" Offset="0.0833333"/> <GradientStop Color="#FFFFFFFF" Offset="1"/> </LinearGradientBrush.GradientStops> </LinearGradientBrush> </Rectangle.Fill> </Rectangle> <Rectangle Width="29.8441" Height="43.1517" Canvas.Left="0.455627" Canvas.Top="2.28036" Stretch="Fill"> <Rectangle.Fill> <LinearGradientBrush StartPoint="0.142631,0.75344" EndPoint="1.01886,0.75344"> <LinearGradientBrush.RelativeTransform> <TransformGroup> <SkewTransform CenterX="0.142631" CenterY="0.75344" AngleX="19.3128" AngleY="0"/> <RotateTransform CenterX="0.142631" CenterY="0.75344" Angle="-35.3436"/> </TransformGroup> </LinearGradientBrush.RelativeTransform> <LinearGradientBrush.GradientStops> <GradientStop Color="#FFCDCDCD" Offset="0.0833333"/> <GradientStop Color="#FFFFFFFF" Offset="1"/> </LinearGradientBrush.GradientStops> </LinearGradientBrush> </Rectangle.Fill> </Rectangle> <Rectangle Width="29.8441" Height="43.1517" Canvas.Left="0.455627" Canvas.Top="1.34485" Stretch="Fill"> <Rectangle.Fill> <LinearGradientBrush StartPoint="0.142631,0.75344" EndPoint="1.01886,0.75344"> <LinearGradientBrush.RelativeTransform> <TransformGroup> <SkewTransform CenterX="0.142631" CenterY="0.75344" AngleX="19.3128" AngleY="0"/> <RotateTransform CenterX="0.142631" CenterY="0.75344" Angle="-35.3436"/> </TransformGroup> </LinearGradientBrush.RelativeTransform> <LinearGradientBrush.GradientStops> <GradientStop Color="#FFCDCDCD" Offset="0.0833333"/> <GradientStop Color="#FFFFFFFF" Offset="1"/> </LinearGradientBrush.GradientStops> </LinearGradientBrush> </Rectangle.Fill> </Rectangle> <Rectangle Width="26.4269" Height="45.8414" Canvas.Left="0.227798" Canvas.Top="0" Stretch="Fill"> <Rectangle.Fill> <LinearGradientBrush StartPoint="0.142631,0.75344" EndPoint="1.01886,0.75344"> <LinearGradientBrush.RelativeTransform> <TransformGroup> <SkewTransform CenterX="0.142631" CenterY="0.75344" AngleX="19.3127" AngleY="0"/> <RotateTransform CenterX="0.142631" CenterY="0.75344" Angle="-35.3436"/> </TransformGroup> </LinearGradientBrush.RelativeTransform> <LinearGradientBrush.GradientStops> <GradientStop Color="#FF7B6802" Offset="0"/> <GradientStop Color="#FFF3D42C" Offset="1"/> </LinearGradientBrush.GradientStops> </LinearGradientBrush> </Rectangle.Fill> </Rectangle> <Rectangle Width="1.25301" Height="45.8414" Canvas.Left="1.70862" Canvas.Top="0.116943" Stretch="Fill" Fill="#FFEBFF07"/> </Canvas> <TextBlock Height="80" x:Name="Name" Width="448" TextWrapping="Wrap" VerticalAlignment="Center" FontSize="24" Text="Directory"/> </StackPanel> </UserControl> As you can see, this XAML contains many graphic elements. Those elements are used to design the folder icon. The original drawing has been designed in Expression Design and then exported as XAML. In Silverlight for Windows Embedded you can use vector images. This means that your images will look good even when scaled or rotated. In our DirectoryItem custom control we have a TextBlock named Name, that will be used to display….(suspense)…. the directory name (I’m too lazy to invent fancy names for controls, and using “boring” intuitive names will make code more readable, I hope!). Now that we have some XAML code, we may execute XAML2CPP to generate part of the aplication code for us. We should then add references to our XAML2CPP generated resource file and include in our code and add a reference to the XAML runtime library to our sources file (you can follow the instruction of the first tutorial step to do that), To generate the code used in this tutorial you need XAML2CPP ver 1.0.1.0, that is downloadable here: http://geekswithblogs.net/WindowsEmbeddedCookbook/archive/2010/03/08/xaml2cpp-1.0.1.0.aspx We can now create our usual simple Win32 application inside Platform Builder, using the same step described in the first chapter of this tutorial (http://geekswithblogs.net/WindowsEmbeddedCookbook/archive/2009/10/01/silverlight-for-embedded-tutorial.aspx). We can declare a class for our main page, deriving it from the template that XAML2CPP generated for us: class ListPage : public TListPage<ListPage> { ... } We will see the ListPage class code in a short time, but before we will see the code of our DirectoryItem user control. This object will be used to populate our list, one item for each directory. To declare a user control things are a bit more complicated (but also in this case XAML2CPP will write most of the “boilerplate” code for use. To interact with a user control you should declare an interface. An interface defines the functions of a user control that can be called inside the application code. Our custom control is currently quite simple and we just need some member functions to store and retrieve a full pathname inside our control. The control will display just the last part of the path inside the control. An interface is declared as a C++ class that has only abstract virtual members. It should also have an UUID associated with it. UUID means Universal Unique IDentifier and it’s a 128 bit number that will identify our interface without the need of specifying its fully qualified name. UUIDs are used to identify COM interfaces and, as we discovered in chapter one, Silverlight for Windows Embedded is based on COM or, at least, provides a COM-like Application Programming Interface (API). Here’s the declaration of the DirectoryItem interface: class __declspec(novtable,uuid("{D38C66E5-2725-4111-B422-D75B32AA8702}")) IDirectoryItem : public IXRCustomUserControl { public: virtual HRESULT SetFullPath(BSTR fullpath) = 0; virtual HRESULT GetFullPath(BSTR* retval) = 0; }; The interface is derived from IXRCustomControl, this will allow us to add our object to a XAML tree. It declares the two functions needed to set and get the full path, but don’t implement them. Implementation will be done inside the control class. The interface only defines the functions of our control class that are accessible from the outside. It’s a sort of “contract” between our control and the applications that will use it. We must support what’s inside the contract and the application code should know nothing else about our own control. To reference our interface we will use the UUID, to make code more readable we can declare a #define in this way: #define IID_IDirectoryItem __uuidof(IDirectoryItem) Silverlight for Windows Embedded objects (like COM objects) use a reference counting mechanism to handle object destruction. Every time you store a pointer to an object you should call its AddRef function and every time you no longer need that pointer you should call Release. The object keeps an internal counter, incremented for each AddRef and decremented on Release. When the counter reaches 0, the object is destroyed. Managing reference counting in our code can be quite complicated and, since we are lazy (I am, at least!), we will use a great feature of Silverlight for Windows Embedded: smart pointers.A smart pointer can be connected to a Silverlight for Windows Embedded object and manages its reference counting. To declare a smart pointer we must use the XRPtr template: typedef XRPtr<IDirectoryItem> IDirectoryItemPtr; Now that we have defined our interface, it’s time to implement our user control class. XAML2CPP has implemented a class for us, and we have only to derive our class from it, defining the main class and interface of our new custom control: class DirectoryItem : public DirectoryItemUserControlRegister<DirectoryItem,IDirectoryItem> { ... } XAML2CPP has generated some code for us to support the user control, we don’t have to mind too much about that code, since it will be generated (or written by hand, if you like) always in the same way, for every user control. But knowing how does this works “under the hood” is still useful to understand the architecture of Silverlight for Windows Embedded. Our base class declaration is a bit more complex than the one we used for a simple page in the previous chapters: template <class A,class B> class DirectoryItemUserControlRegister : public XRCustomUserControlImpl<A,B>,public TDirectoryItem<A,XAML2CPPUserControl> { ... } This class derives from the XAML2CPP generated template class, like the ListPage class, but it uses XAML2CPPUserControl for the implementation of some features. This class shares the same ancestor of XAML2CPPPage (base class for “regular” XAML pages), XAML2CPPBase, implements binding of member variables and event handlers but, instead of loading and creating its own XAML tree, it attaches to an existing one. The XAML tree (and UI) of our custom control is created and loaded by the XRCustomUserControlImpl class. This class is part of the Silverlight for Windows Embedded framework and implements most of the functions needed to build-up a custom control in Silverlight (the guys that developed Silverlight for Windows Embedded seem to care about lazy programmers!). We have just to initialize it, providing our class (DirectoryItem) and interface (IDirectoryItem). Our user control class has also a static member: protected: static HINSTANCE hInstance; This is used to store the HINSTANCE of the modules that contain our user control class. I don’t like this implementation, but I can’t find a better one, so if somebody has good ideas about how to handle the HINSTANCE object, I’ll be happy to hear suggestions! It also implements two static members required by XRCustomUserControlImpl. The first one is used to load the XAML UI of our custom control: static HRESULT GetXamlSource(XRXamlSource* pXamlSource) { pXamlSource->SetResource(hInstance,TEXT("XAML"),IDR_XAML_DirectoryItem); return S_OK; } It initializes a XRXamlSource object, connecting it to the XAML resource that XAML2CPP has included in our resource script. The other method is used to register our custom control, allowing Silverlight for Windows Embedded to create it when it load some XAML or when an application creates a new control at runtime (more about this later): static HRESULT Register() { return XRCustomUserControlImpl<A,B>::Register(__uuidof(B), L"DirectoryItem", L"clr-namespace:DirectoryItemNamespace"); } To register our control we should provide its interface UUID, the name of the corresponding element in the XAML tree and its current namespace (namespaces compatible with Silverlight must use the “clr-namespace” prefix. We may also register additional properties for our objects, allowing them to be loaded and saved inside XAML. In this case we have no permanent properties and the Register method will just register our control. An additional static method is implemented to allow easy registration of our custom control inside our application WinMain function: static HRESULT RegisterUserControl(HINSTANCE hInstance) { DirectoryItemUserControlRegister::hInstance=hInstance; return DirectoryItemUserControlRegister<A,B>::Register(); } Now our control is registered and we will be able to create it using the Silverlight for Windows Embedded runtime functions. But we need to bind our members and event handlers to have them available like we are used to do for other XAML2CPP generated objects. To bind events and members we need to implement the On_Loaded function: virtual HRESULT OnLoaded(__in IXRDependencyObject* pRoot) { HRESULT retcode; IXRApplicationPtr app; if (FAILED(retcode=GetXRApplicationInstance(&app))) return retcode; return ((A*)this)->Init(pRoot,hInstance,app); } This function will call the XAML2CPPUserControl::Init member that will connect the “root” member with the XAML sub tree that has been created for our control and then calls BindObjects and BindEvents to bind members and events to our code. Now we can go back to our application code (the code that you’ll have to actually write) to see the contents of our DirectoryItem class: class DirectoryItem : public DirectoryItemUserControlRegister<DirectoryItem,IDirectoryItem> { protected: WCHAR fullpath[_MAX_PATH+1]; public: DirectoryItem() { *fullpath=0; } virtual HRESULT SetFullPath(BSTR fullpath) { wcscpy_s(this->fullpath,fullpath); WCHAR* p=fullpath; for(WCHAR*q=wcsstr(p,L"\\");q;p=q+1,q=wcsstr(p,L"\\")) ; Name->SetText(p); return S_OK; } virtual HRESULT GetFullPath(BSTR* retval) { *retval=SysAllocString(fullpath); return S_OK; } }; It’s pretty easy and contains a fullpath member (used to store that path of the directory connected with the user control) and the implementation of the two interface members that can be used to set and retrieve the path. The SetFullPath member parses the full path and displays just the last branch directory name inside the “Name” TextBlock object. As you can see, implementing a user control in Silverlight for Windows Embedded is not too complex and using XAML also for the UI of the control allows us to re-use the same mechanisms that we learnt and used in the previous steps of our tutorial. Now let’s see how the main page is managed by the ListPage class. class ListPage : public TListPage<ListPage> { protected: // current path TCHAR curpath[_MAX_PATH+1]; It has a member named “curpath” that is used to store the current directory. It’s initialized inside the constructor: ListPage() { *curpath=0; } And it’s value is displayed inside the “CurrentDir” TextBlock inside the initialization function: virtual HRESULT Init(HINSTANCE hInstance,IXRApplication* app) { HRESULT retcode; if (FAILED(retcode=TListPage<ListPage>::Init(hInstance,app))) return retcode; CurrentDir->SetText(L"\\"); return S_OK; } The FillFileList function is used to enumerate subdirectories of the current dir and add entries for each one inside the list box that fills most of the client area of our main page: HRESULT FillFileList() { HRESULT retcode; IXRItemCollectionPtr items; IXRApplicationPtr app; if (FAILED(retcode=GetXRApplicationInstance(&app))) return retcode; // retrieves the items contained in the listbox if (FAILED(retcode=FileList->GetItems(&items))) return retcode; // clears the list if (FAILED(retcode=items->Clear())) return retcode; // enumerates files and directory in the current path WCHAR filemask[_MAX_PATH+1]; wcscpy_s(filemask,curpath); wcscat_s(filemask,L"\\*.*"); WIN32_FIND_DATA finddata; HANDLE findhandle; findhandle=FindFirstFile(filemask,&finddata); // the directory is empty? if (findhandle==INVALID_HANDLE_VALUE) return S_OK; do { if (finddata.dwFileAttributes&=FILE_ATTRIBUTE_DIRECTORY) { IXRListBoxItemPtr listboxitem; // add a new item to the listbox if (FAILED(retcode=app->CreateObject(IID_IXRListBoxItem,&listboxitem))) { FindClose(findhandle); return retcode; } if (FAILED(retcode=items->Add(listboxitem,NULL))) { FindClose(findhandle); return retcode; } IDirectoryItemPtr directoryitem; if (FAILED(retcode=app->CreateObject(IID_IDirectoryItem,&directoryitem))) { FindClose(findhandle); return retcode; } WCHAR fullpath[_MAX_PATH+1]; wcscpy_s(fullpath,curpath); wcscat_s(fullpath,L"\\"); wcscat_s(fullpath,finddata.cFileName); if (FAILED(retcode=directoryitem->SetFullPath(fullpath))) { FindClose(findhandle); return retcode; } XAML2CPPXRValue value((IXRDependencyObject*)directoryitem); if (FAILED(retcode=listboxitem->SetContent(&value))) { FindClose(findhandle); return retcode; } } } while (FindNextFile(findhandle,&finddata)); FindClose(findhandle); return S_OK; } This functions retrieve a pointer to the collection of the items contained in the directory listbox. The IXRItemCollection interface is used by listboxes and comboboxes and allow you to clear the list (using Clear(), as our function does at the beginning) and change its contents by adding and removing elements. This function uses the FindFirstFile/FindNextFile functions to enumerate all the objects inside our current directory and for each subdirectory creates a IXRListBoxItem object. You can insert any kind of control inside a list box, you don’t need a IXRListBoxItem, but using it will allow you to handle the selected state of an item, highlighting it inside the list. The function creates a list box item using the CreateObject function of XRApplication. The same function is then used to create an instance of our custom control. The function returns a pointer to the control IDirectoryItem interface and we can use it to store the directory full path inside the object and add it as content of the IXRListBox item object, adding it to the listbox contents. The listbox generates an event (SelectionChanged) each time the user clicks on one of the items contained in the listbox. We implement an event handler for that event and use it to change our current directory and repopulate the listbox. The current directory full path will be displayed in the TextBlock: HRESULT Filelist_SelectionChanged(IXRDependencyObject* source,XRSelectionChangedEventArgs* args) { HRESULT retcode; IXRListBoxItemPtr listboxitem; if (!args->pAddedItem) return S_OK; if (FAILED(retcode=args->pAddedItem->QueryInterface(IID_IXRListBoxItem,(void**)&listboxitem))) return retcode; XRValue content; if (FAILED(retcode=listboxitem->GetContent(&content))) return retcode; if (content.vType!=VTYPE_OBJECT) return E_FAIL; IDirectoryItemPtr directoryitem; if (FAILED(retcode=content.pObjectVal->QueryInterface(IID_IDirectoryItem,(void**)&directoryitem))) return retcode; content.pObjectVal->Release(); content.pObjectVal=NULL; BSTR fullpath=NULL; if (FAILED(retcode=directoryitem->GetFullPath(&fullpath))) return retcode; CurrentDir->SetText(fullpath); wcscpy_s(curpath,fullpath); FillFileList(); SysFreeString(fullpath); return S_OK; } }; The function uses the pAddedItem member of the XRSelectionChangedEventArgs object to retrieve the currently selected item, converts it to a IXRListBoxItem interface using QueryInterface, and then retrives its contents (IDirectoryItem object). Using the GetFullPath method we can get the full path of our selected directory and assing it to the curdir member. A call to FillFileList will update the listbox contents, displaying the list of subdirectories of the selected folder. To build our sample we just need to add code to our WinMain function: int WINAPI WinMain(HINSTANCE hInstance, HINSTANCE hPrevInstance, LPTSTR lpCmdLine, int nCmdShow) { if (!XamlRuntimeInitialize()) return -1; HRESULT retcode; IXRApplicationPtr app; if (FAILED(retcode=GetXRApplicationInstance(&app))) return -1; if (FAILED(retcode=DirectoryItem::RegisterUserControl(hInstance))) return retcode; ListPage page; if (FAILED(page.Init(hInstance,app))) return -1; page.FillFileList(); UINT exitcode; if (FAILED(page.GetVisualHost()->StartDialog(&exitcode))) return -1; return 0; } This code is very similar to the one of the WinMains of our previous samples. The main differences are that we register our custom control (you should do that as soon as you have initialized the XAML runtime) and call FillFileList after the initialization of our ListPage object to load the contents of the root folder of our device inside the listbox. As usual you can download the full sample source code from here: http://cid-9b7b0aefe3514dc5.skydrive.live.com/self.aspx/.Public/ListBoxTest.zip

Read the article

An Xml Serializable PropertyBag Dictionary Class for .NET

- by Rick Strahl

I don't know about you but I frequently need property bags in my applications to store and possibly cache arbitrary data. Dictionary<T,V> works well for this although I always seem to be hunting for a more specific generic type that provides a string key based dictionary. There's string dictionary, but it only works with strings. There's Hashset<T> but it uses the actual values as keys. In most key value pair situations for me string is key value to work off. Dictionary<T,V> works well enough, but there are some issues with serialization of dictionaries in .NET. The .NET framework doesn't do well serializing IDictionary objects out of the box. The XmlSerializer doesn't support serialization of IDictionary via it's default serialization, and while the DataContractSerializer does support IDictionary serialization it produces some pretty atrocious XML. What doesn't work? First off Dictionary serialization with the Xml Serializer doesn't work so the following fails: [TestMethod] public void DictionaryXmlSerializerTest() { var bag = new Dictionary<string, object>(); bag.Add("key", "Value"); bag.Add("Key2", 100.10M); bag.Add("Key3", Guid.NewGuid()); bag.Add("Key4", DateTime.Now); bag.Add("Key5", true); bag.Add("Key7", new byte[3] { 42, 45, 66 }); TestContext.WriteLine(this.ToXml(bag)); } public string ToXml(object obj) { if (obj == null) return null; StringWriter sw = new StringWriter(); XmlSerializer ser = new XmlSerializer(obj.GetType()); ser.Serialize(sw, obj); return sw.ToString(); } The error you get with this is: System.NotSupportedException: The type System.Collections.Generic.Dictionary`2[[System.String, mscorlib, Version=4.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089],[System.Object, mscorlib, Version=4.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089]] is not supported because it implements IDictionary. Got it! BTW, the same is true with binary serialization. Running the same code above against the DataContractSerializer does work: [TestMethod] public void DictionaryDataContextSerializerTest() { var bag = new Dictionary<string, object>(); bag.Add("key", "Value"); bag.Add("Key2", 100.10M); bag.Add("Key3", Guid.NewGuid()); bag.Add("Key4", DateTime.Now); bag.Add("Key5", true); bag.Add("Key7", new byte[3] { 42, 45, 66 }); TestContext.WriteLine(this.ToXmlDcs(bag)); } public string ToXmlDcs(object value, bool throwExceptions = false) { var ser = new DataContractSerializer(value.GetType(), null, int.MaxValue, true, false, null); MemoryStream ms = new MemoryStream(); ser.WriteObject(ms, value); return Encoding.UTF8.GetString(ms.ToArray(), 0, (int)ms.Length); } This DOES work but produces some pretty heinous XML (formatted with line breaks and indentation here): <ArrayOfKeyValueOfstringanyType xmlns="http://schemas.microsoft.com/2003/10/Serialization/Arrays" xmlns:i="http://www.w3.org/2001/XMLSchema-instance"> <KeyValueOfstringanyType> <Key>key</Key> <Value i:type="a:string" xmlns:a="http://www.w3.org/2001/XMLSchema">Value</Value> </KeyValueOfstringanyType> <KeyValueOfstringanyType> <Key>Key2</Key> <Value i:type="a:decimal" xmlns:a="http://www.w3.org/2001/XMLSchema">100.10</Value> </KeyValueOfstringanyType> <KeyValueOfstringanyType> <Key>Key3</Key> <Value i:type="a:guid" xmlns:a="http://schemas.microsoft.com/2003/10/Serialization/">2cd46d2a-a636-4af4-979b-e834d39b6d37</Value> </KeyValueOfstringanyType> <KeyValueOfstringanyType> <Key>Key4</Key> <Value i:type="a:dateTime" xmlns:a="http://www.w3.org/2001/XMLSchema">2011-09-19T17:17:05.4406999-07:00</Value> </KeyValueOfstringanyType> <KeyValueOfstringanyType> <Key>Key5</Key> <Value i:type="a:boolean" xmlns:a="http://www.w3.org/2001/XMLSchema">true</Value> </KeyValueOfstringanyType> <KeyValueOfstringanyType> <Key>Key7</Key> <Value i:type="a:base64Binary" xmlns:a="http://www.w3.org/2001/XMLSchema">Ki1C</Value> </KeyValueOfstringanyType> </ArrayOfKeyValueOfstringanyType> Ouch! That seriously hurts the eye! :-) Worse though it's extremely verbose with all those repetitive namespace declarations. It's good to know that it works in a pinch, but for a human readable/editable solution or something lightweight to store in a database it's not quite ideal. Why should I care? As a little background, in one of my applications I have a need for a flexible property bag that is used on a free form database field on an otherwise static entity. Basically what I have is a standard database record to which arbitrary properties can be added in an XML based string field. I intend to expose those arbitrary properties as a collection from field data stored in XML. The concept is pretty simple: When loading write the data to the collection, when the data is saved serialize the data into an XML string and store it into the database. When reading the data pick up the XML and if the collection on the entity is accessed automatically deserialize the XML into the Dictionary. (I'll talk more about this in another post). While the DataContext Serializer would work, it's verbosity is problematic both for size of the generated XML strings and the fact that users can manually edit this XML based property data in an advanced mode. A clean(er) layout certainly would be preferable and more user friendly. Custom XMLSerialization with a PropertyBag Class So… after a bunch of experimentation with different serialization formats I decided to create a custom PropertyBag class that provides for a serializable Dictionary. It's basically a custom Dictionary<TType,TValue> implementation with the keys always set as string keys. The result are PropertyBag<TValue> and PropertyBag (which defaults to the object type for values). The PropertyBag<TType> and PropertyBag classes provide these features: Subclassed from Dictionary<T,V> Implements IXmlSerializable with a cleanish XML format ToXml() and FromXml() methods to export and import to and from XML strings Static CreateFromXml() method to create an instance It's simple enough as it's merely a Dictionary<string,object> subclass but that supports serialization to a - what I think at least - cleaner XML format. The class is super simple to use: [TestMethod] public void PropertyBagTwoWayObjectSerializationTest() { var bag = new PropertyBag(); bag.Add("key", "Value"); bag.Add("Key2", 100.10M); bag.Add("Key3", Guid.NewGuid()); bag.Add("Key4", DateTime.Now); bag.Add("Key5", true); bag.Add("Key7", new byte[3] { 42,45,66 } ); bag.Add("Key8", null); bag.Add("Key9", new ComplexObject() { Name = "Rick", Entered = DateTime.Now, Count = 10 }); string xml = bag.ToXml(); TestContext.WriteLine(bag.ToXml()); bag.Clear(); bag.FromXml(xml); Assert.IsTrue(bag["key"] as string == "Value"); Assert.IsInstanceOfType( bag["Key3"], typeof(Guid)); Assert.IsNull(bag["Key8"]); //Assert.IsNull(bag["Key10"]); Assert.IsInstanceOfType(bag["Key9"], typeof(ComplexObject)); } This uses the PropertyBag class which uses a PropertyBag<string,object> - which means it returns untyped values of type object. I suspect for me this will be the most common scenario as I'd want to store arbitrary values in the PropertyBag rather than one specific type. The same code with a strongly typed PropertyBag<decimal> looks like this: [TestMethod] public void PropertyBagTwoWayValueTypeSerializationTest() { var bag = new PropertyBag<decimal>(); bag.Add("key", 10M); bag.Add("Key1", 100.10M); bag.Add("Key2", 200.10M); bag.Add("Key3", 300.10M); string xml = bag.ToXml(); TestContext.WriteLine(bag.ToXml()); bag.Clear(); bag.FromXml(xml); Assert.IsTrue(bag.Get("Key1") == 100.10M); Assert.IsTrue(bag.Get("Key3") == 300.10M); } and produces typed results of type decimal. The types can be either value or reference types the combination of which actually proved to be a little more tricky than anticipated due to null and specific string value checks required - getting the generic typing right required use of default(T) and Convert.ChangeType() to trick the compiler into playing nice. Of course the whole raison d'etre for this class is the XML serialization. You can see in the code above that we're doing a .ToXml() and .FromXml() to serialize to and from string. The XML produced for the first example looks like this: <?xml version="1.0" encoding="utf-8"?> <properties> <item> <key>key</key> <value>Value</value> </item> <item> <key>Key2</key> <value type="decimal">100.10</value> </item> <item> <key>Key3</key> <value type="___System.Guid"> <guid>f7a92032-0c6d-4e9d-9950-b15ff7cd207d</guid> </value> </item> <item> <key>Key4</key> <value type="datetime">2011-09-26T17:45:58.5789578-10:00</value> </item> <item> <key>Key5</key> <value type="boolean">true</value> </item> <item> <key>Key7</key> <value type="base64Binary">Ki1C</value> </item> <item> <key>Key8</key> <value type="nil" /> </item> <item> <key>Key9</key> <value type="___Westwind.Tools.Tests.PropertyBagTest+ComplexObject"> <ComplexObject> <Name>Rick</Name> <Entered>2011-09-26T17:45:58.5789578-10:00</Entered> <Count>10</Count> </ComplexObject> </value> </item> </properties> The format is a bit cleaner than the DataContractSerializer. Each item is serialized into <key> <value> pairs. If the value is a string no type information is written. Since string tends to be the most common type this saves space and serialization processing. All other types are attributed. Simple types are mapped to XML types so things like decimal, datetime, boolean and base64Binary are encoded using their Xml type values. All other types are embedded with a hokey format that describes the .NET type preceded by a three underscores and then are encoded using the XmlSerializer. You can see this best above in the ComplexObject encoding. For custom types this isn't pretty either, but it's more concise than the DCS and it works as long as you're serializing back and forth between .NET clients at least. The XML generated from the second example that uses PropertyBag<decimal> looks like this: <?xml version="1.0" encoding="utf-8"?> <properties> <item> <key>key</key> <value type="decimal">10</value> </item> <item> <key>Key1</key> <value type="decimal">100.10</value> </item> <item> <key>Key2</key> <value type="decimal">200.10</value> </item> <item> <key>Key3</key> <value type="decimal">300.10</value> </item> </properties> How does it work As I mentioned there's nothing fancy about this solution - it's little more than a subclass of Dictionary<T,V> that implements custom Xml Serialization and a couple of helper methods that facilitate getting the XML in and out of the class more easily. But it's proven very handy for a number of projects for me where dynamic data storage is required. Here's the code: /// <summary> /// Creates a serializable string/object dictionary that is XML serializable /// Encodes keys as element names and values as simple values with a type /// attribute that contains an XML type name. Complex names encode the type /// name with type='___namespace.classname' format followed by a standard xml /// serialized format. The latter serialization can be slow so it's not recommended /// to pass complex types if performance is critical. /// </summary> [XmlRoot("properties")] public class PropertyBag : PropertyBag<object> { /// <summary> /// Creates an instance of a propertybag from an Xml string /// </summary> /// <param name="xml">Serialize</param> /// <returns></returns> public static PropertyBag CreateFromXml(string xml) { var bag = new PropertyBag(); bag.FromXml(xml); return bag; } } /// <summary> /// Creates a serializable string for generic types that is XML serializable. /// /// Encodes keys as element names and values as simple values with a type /// attribute that contains an XML type name. Complex names encode the type /// name with type='___namespace.classname' format followed by a standard xml /// serialized format. The latter serialization can be slow so it's not recommended /// to pass complex types if performance is critical. /// </summary> /// <typeparam name="TValue">Must be a reference type. For value types use type object</typeparam> [XmlRoot("properties")] public class PropertyBag<TValue> : Dictionary<string, TValue>, IXmlSerializable { /// <summary> /// Not implemented - this means no schema information is passed /// so this won't work with ASMX/WCF services. /// </summary> /// <returns></returns> public System.Xml.Schema.XmlSchema GetSchema() { return null; } /// <summary> /// Serializes the dictionary to XML. Keys are /// serialized to element names and values as /// element values. An xml type attribute is embedded /// for each serialized element - a .NET type /// element is embedded for each complex type and /// prefixed with three underscores. /// </summary> /// <param name="writer"></param> public void WriteXml(System.Xml.XmlWriter writer) { foreach (string key in this.Keys) { TValue value = this[key]; Type type = null; if (value != null) type = value.GetType(); writer.WriteStartElement("item"); writer.WriteStartElement("key"); writer.WriteString(key as string); writer.WriteEndElement(); writer.WriteStartElement("value"); string xmlType = XmlUtils.MapTypeToXmlType(type); bool isCustom = false; // Type information attribute if not string if (value == null) { writer.WriteAttributeString("type", "nil"); } else if (!string.IsNullOrEmpty(xmlType)) { if (xmlType != "string") { writer.WriteStartAttribute("type"); writer.WriteString(xmlType); writer.WriteEndAttribute(); } } else { isCustom = true; xmlType = "___" + value.GetType().FullName; writer.WriteStartAttribute("type"); writer.WriteString(xmlType); writer.WriteEndAttribute(); } // Actual deserialization if (!isCustom) { if (value != null) writer.WriteValue(value); } else { XmlSerializer ser = new XmlSerializer(value.GetType()); ser.Serialize(writer, value); } writer.WriteEndElement(); // value writer.WriteEndElement(); // item } } /// <summary> /// Reads the custom serialized format /// </summary> /// <param name="reader"></param> public void ReadXml(System.Xml.XmlReader reader) { this.Clear(); while (reader.Read()) { if (reader.NodeType == XmlNodeType.Element && reader.Name == "key") { string xmlType = null; string name = reader.ReadElementContentAsString(); // item element reader.ReadToNextSibling("value"); if (reader.MoveToNextAttribute()) xmlType = reader.Value; reader.MoveToContent(); TValue value; if (xmlType == "nil") value = default(TValue); // null else if (string.IsNullOrEmpty(xmlType)) { // value is a string or object and we can assign TValue to value string strval = reader.ReadElementContentAsString(); value = (TValue) Convert.ChangeType(strval, typeof(TValue)); } else if (xmlType.StartsWith("___")) { while (reader.Read() && reader.NodeType != XmlNodeType.Element) { } Type type = ReflectionUtils.GetTypeFromName(xmlType.Substring(3)); //value = reader.ReadElementContentAs(type,null); XmlSerializer ser = new XmlSerializer(type); value = (TValue)ser.Deserialize(reader); } else value = (TValue)reader.ReadElementContentAs(XmlUtils.MapXmlTypeToType(xmlType), null); this.Add(name, value); } } } /// <summary> /// Serializes this dictionary to an XML string /// </summary> /// <returns>XML String or Null if it fails</returns> public string ToXml() { string xml = null; SerializationUtils.SerializeObject(this, out xml); return xml; } /// <summary> /// Deserializes from an XML string /// </summary> /// <param name="xml"></param> /// <returns>true or false</returns> public bool FromXml(string xml) { this.Clear(); // if xml string is empty we return an empty dictionary if (string.IsNullOrEmpty(xml)) return true; var result = SerializationUtils.DeSerializeObject(xml, this.GetType()) as PropertyBag<TValue>; if (result != null) { foreach (var item in result) { this.Add(item.Key, item.Value); } } else // null is a failure return false; return true; } /// <summary> /// Creates an instance of a propertybag from an Xml string /// </summary> /// <param name="xml"></param> /// <returns></returns> public static PropertyBag<TValue> CreateFromXml(string xml) { var bag = new PropertyBag<TValue>(); bag.FromXml(xml); return bag; } } } The code uses a couple of small helper classes SerializationUtils and XmlUtils for mapping Xml types to and from .NET, both of which are from the WestWind,Utilities project (which is the same project where PropertyBag lives) from the West Wind Web Toolkit. The code implements ReadXml and WriteXml for the IXmlSerializable implementation using old school XmlReaders and XmlWriters (because it's pretty simple stuff - no need for XLinq here). Then there are two helper methods .ToXml() and .FromXml() that basically allow your code to easily convert between XML and a PropertyBag object. In my code that's what I use to actually to persist to and from the entity XML property during .Load() and .Save() operations. It's sweet to be able to have a string key dictionary and then be able to turn around with 1 line of code to persist the whole thing to XML and back. Hopefully some of you will find this class as useful as I've found it. It's a simple solution to a common requirement in my applications and I've used the hell out of it in the short time since I created it. Resources You can find the complete code for the two classes plus the helpers in the Subversion repository for Westwind.Utilities. You can grab the source files from there or download the whole project. You can also grab the full Westwind.Utilities assembly from NuGet and add it to your project if that's easier for you. PropertyBag Source Code SerializationUtils and XmlUtils Westwind.Utilities Assembly on NuGet (add from Visual Studio) © Rick Strahl, West Wind Technologies, 2005-2011Posted in .NET CSharp Tweet (function() { var po = document.createElement('script'); po.type = 'text/javascript'; po.async = true; po.src = 'https://apis.google.com/js/plusone.js'; var s = document.getElementsByTagName('script')[0]; s.parentNode.insertBefore(po, s); })();

Read the article

Silverlight Recruiting Application Part 6 - Adding an Interview Scheduling Module/View

Between the last post and this one I went ahead and carried the ideas for the Jobs module and view into the Applicants module and view- they're both doing more or less the same thing, except with different objects being at their core. Made for an easy cut-and-paste operation with a few items being switched from one to another. Now that we have the ability to add postings and applicants, wouldn't it be nice if we could schedule an interview? Of course it would! Scheduling Module I think you get the drift from previous posts that these project structures start looking somewhat similar. The interview scheduling module is no different than the rest- it gets a SchedulingModule.cs file at the root that inherits from IModule, and there is a single SchedulerView.xsml and SchedulerViewModel.cs setup for our V+VM. We have one unique concern as we enter into this- RadScheduler deals with AppointmentsSource, not ItemsSource, so there are some special considerations to take into account when planning this module. First, I need something which inherits from AppointmentBase. This is the core of the RadScheduler appointment, and if you are planning to do any form of custom appointment, you'll want it to inherit from this. Then you can add-on functionality as needed. Here is my addition to the mix, the InterviewAppointment: 01.public class InterviewAppointment : AppointmentBase 02.{ 03. private int _applicantID; 04. public int ApplicantID 05. { 06. get { return this._applicantID; } 07. set 08. { 09. if (_applicantID != value) 10. { 11. _applicantID = value; 12. OnPropertyChanged("ApplicantID"); 13. } 14. } 15. } 16. 17. private int _postingID; 18. public int PostingID 19. { 20. get { return _postingID; } 21. set 22. { 23. if (_postingID != value) 24. { 25. _postingID = value; 26. OnPropertyChanged("PostingID"); 27. } 28. } 29. } 30. 31. private string _body; 32. public string Body 33. { 34. get { return _body; } 35. set 36. { 37. if (_body != value) 38. { 39. _body = value; 40. OnPropertyChanged("Body"); 41. } 42. } 43. } 44. 45. private int _interviewID; 46. public int InterviewID 47. { 48. get { return _interviewID; } 49. set 50. { 51. if (_interviewID != value) 52. { 53. _interviewID = value; 54. OnPropertyChanged("InterviewID"); 55. } 56. } 57. } 58. 59. public override IAppointment Copy() 60. { 61. IAppointment appointment = new InterviewAppointment(); 62. appointment.CopyFrom(this); 63. return appointment; 64. } 65. 66. public override void CopyFrom(IAppointment other) 67. { 68. base.CopyFrom(other); 69. var appointment = other as InterviewAppointment; 70. if (appointment != null) 71. { 72. ApplicantID = appointment.ApplicantID; 73. PostingID = appointment.PostingID; 74. Body = appointment.Body; 75. InterviewID = appointment.InterviewID; 76. } 77. } 78.} Nothing too exciting going on here, we just make sure that our custom fields are persisted (specifically set in CopyFrom at the bottom) and notifications are fired- otherwise this ends up exactly like the standard appointment as far as interactions, etc. But if we've got custom appointment items... that also means we need to customize what our appointment dialog window will look like. Customizing the Edit Appointment Dialog This initially sounds a lot more intimidating than it really is. The first step here depends on what you're dealing with for theming, but for ease of everything I went ahead and extracted my templates in Blend for RadScheduler so I could modify it as I pleased. For the faint of heart, the RadScheduler template is a few thousand lines of goodness since there are some very complex things going on in that control. I've gone ahead and trimmed down the template parts I don't need as much as possible, so what is left is all that is relevant to the Edit Appointment Dialog. Here's the resulting Xaml, with line numbers, so I can explain further: 001.<UserControl.Resources> 002.  003. <helpers:DataContextProxy x:Key="DataContextProxy" /> 004. 005. <telerik:Windows7Theme x:Key="Theme" /> 006. <SolidColorBrush x:Key="DialogWindowBackground" 007. Color="White" /> 008. <SolidColorBrush x:Key="CategorySelectorBorderBrush" 009. Color="#FFB1B1B1" /> 010. <LinearGradientBrush x:Key="RadToolBar_InnerBackground" 011. EndPoint="0.5,1" 012. StartPoint="0.5,0"> 013. <GradientStop Color="#FFFDFEFF" 014. Offset="0" /> 015. <GradientStop Color="#FFDDE9F7" 016. Offset="1" /> 017. <GradientStop Color="#FFE6F0FA" 018. Offset="0.5" /> 019. <GradientStop Color="#FFDCE6F4" 020. Offset="0.5" /> 021. </LinearGradientBrush> 022. <Style x:Key="FormElementTextBlockStyle" 023. TargetType="TextBlock"> 024. <Setter Property="HorizontalAlignment" 025. Value="Right" /> 026. <Setter Property="VerticalAlignment" 027. Value="Top" /> 028. <Setter Property="Margin" 029. Value="15, 15, 0, 2" /> 030. </Style> 031. <Style x:Key="FormElementStyle" 032. TargetType="FrameworkElement"> 033. <Setter Property="Margin" 034. Value="10, 10, 0, 2" /> 035. </Style> 036. <SolidColorBrush x:Key="GenericShallowBorderBrush" 037. Color="#FF979994" /> 038. <telerik:BooleanToVisibilityConverter x:Key="BooleanToVisibilityConverter" /> 039. <telerikScheduler:ImportanceToBooleanConverter x:Key="ImportanceToBooleanConverter" /> 040. <telerikScheduler:NullToVisibilityConverter x:Key="NullToVisibilityConverter" /> 041. <telerikScheduler:InvertedNullToVisibilityConverter x:Key="InvertedNullToVisibilityConverter" /> 042. <scheduler:ResourcesSeparatorConverter x:Key="ResourcesSeparatorConverter" /> 043. <DataTemplate x:Key="IconDataEditTemplate"> 044. <Image Source="/Telerik.Windows.Controls.Scheduler;component/Themes/Office/Images/cal.png" 045. Margin="3,3,0,0" 046. Width="16" 047. Height="16" /> 048. </DataTemplate> 049. <DataTemplate x:Key="SingleSelectionTemplate"> 050. <Grid VerticalAlignment="Stretch" 051. HorizontalAlignment="Stretch"> 052. <Grid.RowDefinitions> 053. <RowDefinition Height="Auto" /> 054. </Grid.RowDefinitions> 055. <Grid.ColumnDefinitions> 056. <ColumnDefinition Width="Auto" 057. MinWidth="84" /> 058. <ColumnDefinition Width="Auto" 059. MinWidth="200" /> 060. </Grid.ColumnDefinitions> 061. <TextBlock x:Name="SelectionNameLabel" 062. Margin="0,13,4,2" 063. Text="{Binding ResourceType.DisplayName}" 064. Style="{StaticResource FormElementTextBlockStyle}" 065. Grid.Column="0" /> 066. <telerikInput:RadComboBox ItemsSource="{Binding ResourceItems}" 067. Width="185" 068. Margin="5,10,20,2" 069. HorizontalAlignment="Left" 070. Grid.Column="1" 071. ClearSelectionButtonVisibility="Visible" 072. ClearSelectionButtonContent="Clear All" 073. DisplayMemberPath="Resource.DisplayName" 074. telerik:StyleManager.Theme="{StaticResource Theme}" 075. SelectedItem="{Binding SelectedItem, Mode=TwoWay}" /> 076. </Grid> 077. </DataTemplate> 078. <DataTemplate x:Key="MultipleSelectionTemplate"> 079. <Grid VerticalAlignment="Stretch" 080. HorizontalAlignment="Stretch"> 081. <Grid.RowDefinitions> 082. <RowDefinition Height="Auto" /> 083. </Grid.RowDefinitions> 084. <Grid.ColumnDefinitions> 085. <ColumnDefinition Width="Auto" 086. MinWidth="84" /> 087. <ColumnDefinition Width="Auto" 088. MinWidth="200" /> 089. </Grid.ColumnDefinitions> 090. <TextBlock x:Name="SelectionNameLabel" 091. Grid.Column="0" 092. Text="{Binding ResourceType.DisplayName}" 093. Margin="0,13,4,2" 094. Style="{StaticResource FormElementTextBlockStyle}" /> 095. <telerikInput:RadComboBox Grid.Column="1" 096. Width="185" 097. HorizontalAlignment="Left" 098. Margin="5,10,20,2" 099. ItemsSource="{Binding ResourceItems}" 100. SelectedIndex="{Binding SelectedIndex, Mode=TwoWay}" 101. ClearSelectionButtonVisibility="Visible" 102. ClearSelectionButtonContent="Clear All" 103. telerik:StyleManager.Theme="{StaticResource Theme}"> 104. <telerikInput:RadComboBox.ItemTemplate> 105. <DataTemplate> 106. <Grid HorizontalAlignment="Stretch" 107. VerticalAlignment="Stretch"> 108. <CheckBox VerticalAlignment="Center" 109. HorizontalContentAlignment="Stretch" 110. VerticalContentAlignment="Center" 111. IsChecked="{Binding IsChecked, Mode=TwoWay}" 112. Content="{Binding Resource.DisplayName}"> 113. <CheckBox.ContentTemplate> 114. <DataTemplate> 115. <TextBlock HorizontalAlignment="Stretch" 116. VerticalAlignment="Stretch" 117. Text="{Binding Content, RelativeSource={RelativeSource TemplatedParent}}" /> 118. </DataTemplate> 119. </CheckBox.ContentTemplate> 120. </CheckBox> 121. </Grid> 122. </DataTemplate> 123. </telerikInput:RadComboBox.ItemTemplate> 124. </telerikInput:RadComboBox> 125. </Grid> 126. </DataTemplate> 127. <scheduler:ResourceTypeTemplateSelector x:Key="ItemTemplateSelector" 128. MultipleSelectionTemplate="{StaticResource MultipleSelectionTemplate}" 129. SingleSelectionTemplate="{StaticResource SingleSelectionTemplate}" /> 130.  131. 132. <ControlTemplate x:Key="EditAppointmentTemplate" 133. TargetType="telerikScheduler:AppointmentDialogWindow"> 134. <StackPanel Background="{TemplateBinding Background}" 135. UseLayoutRounding="True"> 136. <StackPanel Grid.Row="0" 137. Orientation="Horizontal" 138. Background="{StaticResource RadToolBar_InnerBackground}" 139. Grid.ColumnSpan="2" 140. Height="0"> 141.  142. <Border Margin="1,1,0,0" 143. Background="#50000000" 144. HorizontalAlignment="Left" 145. VerticalAlignment="Center" 146. Width="2" 147. Height="16"> 148. <Border Margin="0,0,1,1" 149. Background="#80FFFFFF" 150. HorizontalAlignment="Left" 151. Width="1" /> 152. </Border> 153. <Border Margin="1,1,0,0" 154. Background="#50000000" 155. HorizontalAlignment="Left" 156. VerticalAlignment="Center" 157. Width="2" 158. Height="16"> 159. <Border Margin="0,0,1,1" 160. Background="#80FFFFFF" 161. HorizontalAlignment="Left" 162. Width="1" /> 163. </Border> 164. <TextBlock telerik:LocalizationManager.ResourceKey="ShowAs" 165. VerticalAlignment="Center" 166. Margin="5,0,0,0" /> 167. <telerikInput:RadComboBox ItemsSource="{TemplateBinding TimeMarkers}" 168. Width="100" 169. Height="20" 170. VerticalAlignment="Center" 171. Margin="5,0,0,0" 172. ClearSelectionButtonVisibility="Visible" 173. ClearSelectionButtonContent="Clear" 174. SelectedItem="{Binding TimeMarker,RelativeSource={RelativeSource TemplatedParent},Mode=TwoWay}" 175. telerik:StyleManager.Theme="{StaticResource Theme}"> 176. <telerikInput:RadComboBox.ItemTemplate> 177. <DataTemplate> 178. <StackPanel Orientation="Horizontal"> 179. <Rectangle Fill="{Binding TimeMarkerBrush}" 180. Margin="2" 181. Width="12" 182. Height="12" /> 183. <TextBlock Text="{Binding TimeMarkerName}" 184. Margin="2" /> 185. </StackPanel> 186. </DataTemplate> 187. </telerikInput:RadComboBox.ItemTemplate> 188. </telerikInput:RadComboBox> 189. <telerik:RadToggleButton x:Name="High" 190. BorderThickness="0" 191. Background="{StaticResource RadToolBar_InnerBackground}" 192. DataContext="{TemplateBinding EditedAppointment}" 193. telerik:StyleManager.Theme="{StaticResource Theme}" 194. IsChecked="{Binding Importance,Mode=TwoWay, Converter={StaticResource ImportanceToBooleanConverter},ConverterParameter=High}" 195. Margin="2,2,0,2" 196. Width="23" 197. Height="23" 198. HorizontalContentAlignment="Center" 199. ToolTipService.ToolTip="High importance" 200. CommandParameter="High" 201. Command="telerikScheduler:RadSchedulerCommands.SetAppointmentImportance"> 202. <StackPanel HorizontalAlignment="Center"> 203. <Path Stretch="Fill" 204. Height="10" 205. HorizontalAlignment="Center" 206. VerticalAlignment="Top" 207. Width="5.451" 208. Data="M200.39647,58.840393 C200.39337,58.336426 201.14566,57.683922 202.56244,57.684292 C204.06589,57.684685 204.73764,58.357765 204.72783,58.992363 C205.04649,61.795574 203.04713,64.181099 202.47388,66.133446 C201.93753,64.154961 199.9471,61.560352 200.39647,58.840393 z"> 209. <Path.Fill> 210. <LinearGradientBrush EndPoint="1.059,0.375" 211. StartPoint="-0.457,0.519"> 212. <GradientStop Color="#FFFF0606" 213. Offset="0.609" /> 214. <GradientStop Color="#FFBF0303" 215. Offset="0.927" /> 216. </LinearGradientBrush> 217. </Path.Fill> 218. </Path> 219. <Ellipse Height="3" 220. HorizontalAlignment="Center" 221. Margin="0,-1,0,0" 222. VerticalAlignment="Top" 223. Width="3"> 224. <Ellipse.Fill> 225. <RadialGradientBrush> 226. <GradientStop Color="#FFFF0606" 227. Offset="0" /> 228. <GradientStop Color="#FFBF0303" 229. Offset="1" /> 230. </RadialGradientBrush> 231. </Ellipse.Fill> 232. </Ellipse> 233. </StackPanel> 234. </telerik:RadToggleButton> 235. <telerik:RadToggleButton x:Name="Low" 236. HorizontalContentAlignment="Center" 237. BorderThickness="0" 238. Background="{StaticResource RadToolBar_InnerBackground}" 239. DataContext="{TemplateBinding EditedAppointment}" 240. IsChecked="{Binding Importance,Mode=TwoWay, Converter={StaticResource ImportanceToBooleanConverter},ConverterParameter=Low}" 241. Margin="0,2,0,2" 242. Width="23" 243. Height="23" 244. ToolTipService.ToolTip="Low importance" 245. CommandParameter="Low" 246. telerik:StyleManager.Theme="{StaticResource Theme}" 247. Command="telerikScheduler:RadSchedulerCommands.SetAppointmentImportance"> 248. <Path Stretch="Fill" 249. Height="12" 250. HorizontalAlignment="Center" 251. VerticalAlignment="Top" 252. Width="9" 253. Data="M222.40353,60.139881 L226.65768,60.139843 L226.63687,67.240196 L229.15347,67.240196 L224.37816,71.394943 L219.65274,67.240196 L222.37572,67.219345 z" 254. Stroke="#FF0365A7"> 255. <Path.Fill> 256. <LinearGradientBrush EndPoint="1.059,0.375" 257. StartPoint="-0.457,0.519"> 258. <GradientStop Color="#FFBBE4FF" /> 259. <GradientStop Color="#FF024572" 260. Offset="0.836" /> 261. <GradientStop Color="#FF43ADF4" 262. Offset="0.466" /> 263. </LinearGradientBrush> 264. </Path.Fill> 265. </Path> 266. </telerik:RadToggleButton> 267. </StackPanel > 268. <Border DataContext="{TemplateBinding EditedAppointment}" 269. Background="{Binding Category.CategoryBrush}" 270. Visibility="{Binding Category,Converter={StaticResource NullToVisibilityConverter}}" 271. CornerRadius="3" 272. Height="20" 273. Margin="5,10,5,0"> 274. <TextBlock Text="{Binding Category.DisplayName}" 275. VerticalAlignment="Center" 276. Margin="5,0,0,0" /> 277. </Border> 278. <Grid VerticalAlignment="Stretch" 279. HorizontalAlignment="Stretch" 280. DataContext="{TemplateBinding EditedAppointment}" 281. Background="{TemplateBinding Background}"> 282. <Grid.RowDefinitions> 283. <RowDefinition Height="Auto" /> 284. <RowDefinition Height="Auto" /> 285. <RowDefinition Height="Auto" /> 286. <RowDefinition Height="Auto" /> 287. <RowDefinition Height="Auto" /> 288. <RowDefinition Height="Auto" /> 289. <RowDefinition Height="Auto" /> 290. <RowDefinition Height="Auto" /> 291. <RowDefinition Height="Auto" /> 292. <RowDefinition Height="Auto" /> 293. </Grid.RowDefinitions> 294. <Grid.ColumnDefinitions> 295. <ColumnDefinition Width="Auto" 296. MinWidth="100" /> 297. <ColumnDefinition Width="Auto" 298. MinWidth="200" /> 299. </Grid.ColumnDefinitions> 300.  301. <TextBlock x:Name="SubjectLabel" 302. Grid.Row="0" 303. Grid.Column="0" 304. Margin="0,15,0,2" 305. telerik:LocalizationManager.ResourceKey="Subject" 306. Style="{StaticResource FormElementTextBlockStyle}" /> 307. <TextBox x:Name="Subject" 308. Grid.Row="0" 309. Grid.Column="1" 310. MinHeight="22" 311. Padding="4 2" 312. Width="340" 313. HorizontalAlignment="Left" 314. Text="{Binding Subject, Mode=TwoWay}" 315. MaxLength="255" 316. telerik:StyleManager.Theme="{StaticResource Theme}" 317. Margin="10,12,20,2" /> 318.  319. <TextBlock x:Name="DescriptionLabel" 320. Grid.Row="1" 321. Grid.Column="0" 322. Margin="0,13,0,2" 323. telerik:LocalizationManager.ResourceKey="Body" 324. Style="{StaticResource FormElementTextBlockStyle}" /> 325. <TextBox x:Name="Body" 326. VerticalAlignment="top" 327. Grid.Row="1" 328. Grid.Column="1" 329. Height="Auto" 330. MaxHeight="82" 331. Width="340" 332. HorizontalAlignment="Left" 333. MinHeight="22" 334. Padding="4 2" 335. TextWrapping="Wrap" 336. telerik:StyleManager.Theme="{StaticResource Theme}" 337. Text="{Binding Body, Mode=TwoWay}" 338. AcceptsReturn="true" 339. Margin="10,10,20,2" 340. HorizontalScrollBarVisibility="Auto" 341. VerticalScrollBarVisibility="Auto" /> 342.  343. <TextBlock x:Name="StartDateLabel" 344. Grid.Row="2" 345. Grid.Column="0" 346. Margin="0,13,0,2" 347. telerik:LocalizationManager.ResourceKey="StartTime" 348. Style="{StaticResource FormElementTextBlockStyle}" /> 349. <telerikScheduler:DateTimePicker x:Name="StartDateTime" 350. Height="22" 351. Grid.Row="2" 352. Grid.Column="1" 353. HorizontalAlignment="Left" 354. Margin="10,10,20,2" 355. Style="{StaticResource FormElementStyle}" 356. SelectedDateTime="{Binding Start, Mode=TwoWay}" 357. telerikScheduler:StartEndDatePicker.EndPicker="{Binding ElementName=EndDateTime}" 358. IsTabStop="False" 359. IsEnabled="False" /> 360. <TextBlock x:Name="EndDateLabel" 361. Grid.Row="3" 362. Grid.Column="0" 363. Margin="0,13,0,2" 364. telerik:LocalizationManager.ResourceKey="EndTime" 365. Style="{StaticResource FormElementTextBlockStyle}" /> 366. <telerikScheduler:DateTimePicker x:Name="EndDateTime" 367. Height="22" 368. Grid.Row="3" 369. Grid.Column="1" 370. HorizontalAlignment="Left" 371. Margin="10,10,20,2" 372. Style="{StaticResource FormElementStyle}" 373. IsTabStop="False" 374. IsEnabled="False" 375. SelectedDateTime="{Binding End, Mode=TwoWay}" /> 376.  377. <CheckBox x:Name="AllDayEventCheckbox" 378. IsChecked="{Binding IsAllDayEvent, Mode=TwoWay}" 379. Grid.Row="4" 380. Grid.Column="1" 381. Margin="10,10,20,2" 382. HorizontalAlignment="Left" 383. telerik:StyleManager.Theme="{StaticResource Theme}" 384. telerik:LocalizationManager.ResourceKey="AllDayEvent"> 385. <telerik:CommandManager.InputBindings> 386. <telerik:InputBindingCollection> 387. <telerik:MouseBinding Command="telerikScheduler:RadSchedulerCommands.ChangeTimePickersVisibility" 388. Gesture="LeftClick" /> 389. </telerik:InputBindingCollection> 390. </telerik:CommandManager.InputBindings> 391. </CheckBox> 392. <Grid Grid.Row="5" 393. Grid.ColumnSpan="2"> 394. <Grid.ColumnDefinitions> 395. <ColumnDefinition Width="Auto" 396. MinWidth="100" /> 397. <ColumnDefinition Width="Auto" 398. MinWidth="200" /> 399. </Grid.ColumnDefinitions> 400. <Grid.RowDefinitions> 401. <RowDefinition Height="Auto" /> 402. <RowDefinition Height="Auto" /> 403. </Grid.RowDefinitions> 404. <TextBlock Text="Applicant" 405. Margin="0,13,0,2" 406. Style="{StaticResource FormElementTextBlockStyle}" /> 407. <telerikInput:RadComboBox IsEditable="False" 408. Grid.Column="1" 409. Height="24" 410. VerticalAlignment="Center" 411. ItemsSource="{Binding Source={StaticResource DataContextProxy}, Path=DataSource.ApplicantList}" 412. SelectedValue="{Binding ApplicantID, Mode=TwoWay}" 413. SelectedValuePath="ApplicantID" 414. DisplayMemberPath="FirstName" /> 415. 416. <TextBlock Text="Job" 417. Margin="0,13,0,2" 418. Grid.Row="1" 419. Style="{StaticResource FormElementTextBlockStyle}" /> 420. <telerikInput:RadComboBox IsEditable="False" 421. Grid.Column="1" 422. Grid.Row="1" 423. Height="24" 424. VerticalAlignment="Center" 425. ItemsSource="{Binding Source={StaticResource DataContextProxy}, Path=DataSource.JobsList}" 426. SelectedValue="{Binding PostingID, Mode=TwoWay}" 427. SelectedValuePath="PostingID" 428. DisplayMemberPath="JobTitle"/> 429. </Grid> 430.  431. <Grid x:Name="ResourcesLayout" 432. Grid.Row="7" 433. Grid.Column="0" 434. Grid.ColumnSpan="2" 435. MaxHeight="130" 436. Margin="20,5,20,0"> 437. <Border Margin="0" 438. BorderThickness="1" 439. BorderBrush="{StaticResource GenericShallowBorderBrush}" 440. Visibility="{Binding ElementName=ResourcesScrollViewer, Path=ComputedVerticalScrollBarVisibility}"></Border> 441. <ScrollViewer x:Name="ResourcesScrollViewer" 442. IsTabStop="false" 443. Grid.Row="6" 444. Grid.Column="0" 445. Grid.ColumnSpan="2" 446. Margin="1" 447. telerik:StyleManager.Theme="{StaticResource Theme}" 448. VerticalScrollBarVisibility="Auto"> 449. <scheduler:ResourcesItemsControl x:Name="PART_Resources" 450. HorizontalAlignment="Left" 451. Padding="0,2,0,5" 452. IsTabStop="false" 453. ItemsSource="{TemplateBinding ResourceTypeModels}" 454. ItemTemplateSelector="{StaticResource ItemTemplateSelector}" /> 455. </ScrollViewer> 456. </Grid> 457. <StackPanel x:Name="FooterControls" 458. Margin="5 10 10 10" 459. Grid.Row="8" 460. Grid.Column="1" 461. HorizontalAlignment="Left" 462. Orientation="Horizontal"> 463. <telerik:RadButton x:Name="OKButton" 464. Margin="5" 465. Padding="10 0" 466. MinWidth="80" 467. Command="telerikScheduler:RadSchedulerCommands.SaveAppointment" 468. telerik:StyleManager.Theme="{StaticResource Theme}" 469. telerikNavigation:RadWindow.ResponseButton="Accept" 470. telerik:LocalizationManager.ResourceKey="SaveAndCloseCommandText"> 471. </telerik:RadButton> 472. <telerik:RadButton x:Name="CancelButton" 473. Margin="5" 474. Padding="10 0" 475. MinWidth="80" 476. telerik:LocalizationManager.ResourceKey="Cancel" 477. telerik:StyleManager.Theme="{StaticResource Theme}" 478. telerikNavigation:RadWindow.ResponseButton="Cancel" 479. Command="telerik:WindowCommands.Close"> 480. </telerik:RadButton> 481. </StackPanel> 482. </Grid> 483. <vsm:VisualStateManager.VisualStateGroups> 484. <vsm:VisualStateGroup x:Name="RecurrenceRuleState"> 485. <vsm:VisualState x:Name="RecurrenceRuleIsNull"> 486. <Storyboard> 487. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="StartDateTime" 488. Storyboard.TargetProperty="IsEnabled" 489. Duration="0"> 490. <DiscreteObjectKeyFrame KeyTime="0" 491. Value="True" /> 492. </ObjectAnimationUsingKeyFrames> 493. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="EndDateTime" 494. Storyboard.TargetProperty="IsEnabled" 495. Duration="0"> 496. <DiscreteObjectKeyFrame KeyTime="0" 497. Value="True" /> 498. </ObjectAnimationUsingKeyFrames> 499. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="AllDayEventCheckbox" 500. Storyboard.TargetProperty="IsEnabled" 501. Duration="0"> 502. <DiscreteObjectKeyFrame KeyTime="0" 503. Value="True" /> 504. </ObjectAnimationUsingKeyFrames> 505. </Storyboard> 506. </vsm:VisualState> 507. <vsm:VisualState x:Name="RecurrenceRuleIsNotNull"> 508. <Storyboard> 509. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="StartDateTime" 510. Storyboard.TargetProperty="IsEnabled" 511. Duration="0"> 512. <DiscreteObjectKeyFrame KeyTime="0" 513. Value="False" /> 514. </ObjectAnimationUsingKeyFrames> 515. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="EndDateTime" 516. Storyboard.TargetProperty="IsEnabled" 517. Duration="0"> 518. <DiscreteObjectKeyFrame KeyTime="0" 519. Value="False" /> 520. </ObjectAnimationUsingKeyFrames> 521. <ObjectAnimationUsingKeyFrames Storyboard.TargetName="AllDayEventCheckbox" 522. Storyboard.TargetProperty="IsEnabled" 523. Duration="0"> 524. <DiscreteObjectKeyFrame KeyTime="0" 525. Value="False" /> 526. </ObjectAnimationUsingKeyFrames> 527. </Storyboard> 528. </vsm:VisualState> 529. </vsm:VisualStateGroup> 530. </vsm:VisualStateManager.VisualStateGroups> 531. </StackPanel> 532. </ControlTemplate> 533. <DataTemplate x:Key="AppointmentDialogWindowHeaderDataTemplate"> 534. <StackPanel Orientation="Horizontal" 535. MaxWidth="400"> 536. <TextBlock telerik:LocalizationManager.ResourceKey="Event" 537. Visibility="{Binding Appointment.IsAllDayEvent, Converter={StaticResource BooleanToVisibilityConverter}}" /> 538. <TextBlock telerik:LocalizationManager.ResourceKey="Appointment" 539. Visibility="{Binding Appointment.IsAllDayEvent, Converter={StaticResource InvertedBooleanToVisibilityConverter}}" /> 540. <TextBlock Text=" - " /> 541. <TextBlock x:Name="SubjectTextBlock" 542. Visibility="{Binding Appointment.Subject, Converter={StaticResource NullToVisibilityConverter}}" 543. Text="{Binding Appointment.Subject}" /> 544. <TextBlock telerik:LocalizationManager.ResourceKey="Untitled" 545. Visibility="{Binding Appointment.Subject, Converter={StaticResource InvertedNullToVisibilityConverter}}" /> 546. </StackPanel> 547. </DataTemplate> 548. <Style x:Key="EditAppointmentStyle" 549. TargetType="telerikScheduler:AppointmentDialogWindow"> 550. <Setter Property="IconTemplate" 551. Value="{StaticResource IconDataEditTemplate}" /> 552. <Setter Property="HeaderTemplate" 553. Value="{StaticResource AppointmentDialogWindowHeaderDataTemplate}" /> 554. <Setter Property="Background" 555. Value="{StaticResource DialogWindowBackground}" /> 556. <Setter Property="Template" 557. Value="{StaticResource EditAppointmentTemplate}" /> 558. </Style> 559.</UserControl.Resources> The first line there is the DataContextProxy I mentioned previously- we use that again to work a bit of magic in this template. Where we start getting into the dialog in question is line 132, but line 407 is where things start getting interesting. The ItemsSource is pointing at a list that exists in my ViewModel (or code-behind, if it is used as a DataContext), the SelectedValue is the item I am actually binding from the applicant (note the TwoWay binding), and SelectedValuePath and DisplayMemberPath ensure the proper applicant is being displayed from the collection. You will also see similar starting on line 420 where I do the same for the Jobs we'll be displaying. Just to wrap-up the Xaml, here's the RadScheduler declaraction that ties this all together and will be the main focus of our view: 01.<telerikScheduler:RadScheduler x:Name="xJobsScheduler" 02. Grid.Row="1" 03. Grid.Column="1" 04. Width="800" 05. MinWidth="600" 06. Height="500" 07. MinHeight="300" 08. AppointmentsSource="{Binding Interviews}" 09. EditAppointmentStyle="{StaticResource EditAppointmentStyle}" 10. command:AppointmentAddedEventClass.Command="{Binding AddAppointmentCommand}" 11. command:ApptCreatedEventClass.Command="{Binding ApptCreatingCommand}" 12. command:ApptEditedEventClass.Command="{Binding ApptEditedCommand}" 13. command:ApptDeletedEventClass.Command="{Binding ApptDeletedCommand}"> 14.</telerikScheduler:RadScheduler> Now, we get to the ViewModel and what it takes to get that rigged up. And for those of you who remember the jobs post, those command:s in the Xaml are pointing to attached behavior commands that reproduce the respective events. This becomes very handy when we're setting up the code-behind version. ;) ViewModel I've been liking this approach so far, so I'm going to put the entire ViewModel here and then go into the lines of interest. Of course, feel free to ask me questions about anything that isn't clear (by line number, ideally) so I can help out if I have missed anything important: 001.public class SchedulerViewModel : ViewModelBase 002.{ 003. private readonly IEventAggregator eventAggregator; 004. private readonly IRegionManager regionManager; 005. 006. public RecruitingContext context; 007. 008. private ObservableItemCollection<InterviewAppointment> _interviews = new ObservableItemCollection<InterviewAppointment>(); 009. public ObservableItemCollection<InterviewAppointment> Interviews 010. { 011. get { return _interviews; } 012. set 013. { 014. if (_interviews != value) 015. { 016. _interviews = value; 017. NotifyChanged("Interviews"); 018. } 019. } 020. } 021. 022. private QueryableCollectionView _jobsList; 023. public QueryableCollectionView JobsList 024. { 025. get { return this._jobsList; } 026. set 027. { 028. if (this._jobsList != value) 029. { 030. this._jobsList = value; 031. this.NotifyChanged("JobsList"); 032. } 033. } 034. } 035. 036. private QueryableCollectionView _applicantList; 037. public QueryableCollectionView ApplicantList 038. { 039. get { return _applicantList; } 040. set 041. { 042. if (_applicantList != value) 043. { 044. _applicantList = value; 045. NotifyChanged("ApplicantList"); 046. } 047. } 048. } 049. 050. public DelegateCommand<object> AddAppointmentCommand { get; set; } 051. public DelegateCommand<object> ApptCreatingCommand { get; set; } 052. public DelegateCommand<object> ApptEditedCommand { get; set; } 053. public DelegateCommand<object> ApptDeletedCommand { get; set; } 054. 055. public SchedulerViewModel(IEventAggregator eventAgg, IRegionManager regionmanager) 056. { 057. // set Unity items 058. this.eventAggregator = eventAgg; 059. this.regionManager = regionmanager; 060. 061. // load our context 062. context = new RecruitingContext(); 063. LoadOperation<Interview> loadOp = context.Load(context.GetInterviewsQuery()); 064. loadOp.Completed += new EventHandler(loadOp_Completed); 065. 066. this._jobsList = new QueryableCollectionView(context.JobPostings); 067. context.Load(context.GetJobPostingsQuery()); 068. 069. this._applicantList = new QueryableCollectionView(context.Applicants); 070. context.Load(context.GetApplicantsQuery()); 071. 072. AddAppointmentCommand = new DelegateCommand<object>(this.AddAppt); 073. ApptCreatingCommand = new DelegateCommand<object>(this.ApptCreating); 074. ApptEditedCommand = new DelegateCommand<object>(this.ApptEdited); 075. ApptDeletedCommand = new DelegateCommand<object>(this.ApptDeleted); 076. 077. } 078. 079. void loadOp_Completed(object sender, EventArgs e) 080. { 081. LoadOperation loadop = sender as LoadOperation; 082. 083. foreach (var ent in loadop.Entities) 084. { 085. _interviews.Add(EntityToAppointment(ent as Interview)); 086. } 087. } 088. 089. #region Appointment Adding 090. 091. public void AddAppt(object obj) 092. { 093. // now we have a new InterviewAppointment to add to our QCV :) 094. InterviewAppointment newInterview = obj as InterviewAppointment; 095. 096. this.context.Interviews.Add(AppointmentToEntity(newInterview)); 097. this.context.SubmitChanges((s) => 098. { 099. ActionHistory myAction = new ActionHistory(); 100. myAction.InterviewID = newInterview.InterviewID; 101. myAction.PostingID = newInterview.PostingID; 102. myAction.ApplicantID = newInterview.ApplicantID; 103. myAction.Description = String.Format("Interview with {0} has been created by {1}", newInterview.ApplicantID.ToString(), "default user"); 104. myAction.TimeStamp = DateTime.Now; 105. eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); 106. } 107. , null); 108. } 109. 110. public void ApptCreating(object obj) 111. { 112. // handled in the behavior, just a placeholder to ensure it runs :) 113. } 114. 115. #endregion 116. 117. #region Appointment Editing 118. 119. public void ApptEdited(object obj) 120. { 121. Interview editedInterview = (from x in context.Interviews 122. where x.InterviewID == (obj as InterviewAppointment).InterviewID 123. select x).SingleOrDefault(); 124. 125. CopyAppointmentEdit(editedInterview, obj as InterviewAppointment); 126. 127. context.SubmitChanges((s) => { 128. ActionHistory myAction = new ActionHistory(); 129. myAction.InterviewID = editedInterview.InterviewID; 130. myAction.PostingID = editedInterview.PostingID; 131. myAction.ApplicantID = editedInterview.ApplicantID; 132. myAction.Description = String.Format("Interview with {0} has been modified by {1}", editedInterview.ApplicantID.ToString(), "default user"); 133. myAction.TimeStamp = DateTime.Now; 134. eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); } 135. , null); 136. } 137. 138. #endregion 139. 140. #region Appointment Deleting 141. 142. public void ApptDeleted(object obj) 143. { 144. Interview deletedInterview = (from x in context.Interviews 145. where x.InterviewID == (obj as InterviewAppointment).InterviewID 146. select x).SingleOrDefault(); 147. 148. context.Interviews.Remove(deletedInterview); 149. context.SubmitChanges((s) => 150. { 151. ActionHistory myAction = new ActionHistory(); 152. myAction.InterviewID = deletedInterview.InterviewID; 153. myAction.PostingID = deletedInterview.PostingID; 154. myAction.ApplicantID = deletedInterview.ApplicantID; 155. myAction.Description = String.Format("Interview with {0} has been deleted by {1}", deletedInterview.ApplicantID.ToString(), "default user"); 156. myAction.TimeStamp = DateTime.Now; 157. eventAggregator.GetEvent<AddActionEvent>().Publish(myAction); 158. } 159. , null); 160. } 161. 162. #endregion 163. 164. #region Appointment Helpers :) 165. 166. public Interview AppointmentToEntity(InterviewAppointment ia) 167. { 168. Interview newInterview = new Interview(); 169. newInterview.Subject = ia.Subject; 170. newInterview.Body = ia.Body; 171. newInterview.Start = ia.Start; 172. newInterview.End = ia.End; 173. newInterview.ApplicantID = ia.ApplicantID; 174. newInterview.PostingID = ia.PostingID; 175. newInterview.InterviewID = ia.InterviewID; 176. 177. return newInterview; 178. } 179. 180. public InterviewAppointment EntityToAppointment(Interview ia) 181. { 182. InterviewAppointment newInterview = new InterviewAppointment(); 183. newInterview.Subject = ia.Subject; 184. newInterview.Body = ia.Body; 185. newInterview.Start = ia.Start; 186. newInterview.End = ia.End; 187. newInterview.ApplicantID = ia.ApplicantID; 188. newInterview.PostingID = ia.PostingID; 189. newInterview.InterviewID = ia.InterviewID; 190. 191. return newInterview; 192. } 193. 194. public void CopyAppointmentEdit(Interview entityInterview, InterviewAppointment appointmentInterview) 195. { 196. entityInterview.Subject = appointmentInterview.Subject; 197. entityInterview.Body = appointmentInterview.Body; 198. entityInterview.Start = appointmentInterview.Start; 199. entityInterview.End = appointmentInterview.End; 200. entityInterview.ApplicantID = appointmentInterview.ApplicantID; 201. entityInterview.PostingID = appointmentInterview.PostingID; 202. } 203. 204. #endregion 205.} One thing we're doing here which you won't see in any of the other ViewModels is creating a duplicate collection. I know this is something which will be fixed down the line for using RadScheduler, simplifying this process, but with WCF RIA changing as it does I wanted to ensure functionality would remain consistent as I continued development on this application. So, I do a little bit of duplication, but for the greater good. This all takes place starting on line 79, so for every entity that comes back we add it to the collection that is bound to RadScheduler. Otherwise, the DelegateCommands that you see correspond directly to the events they are named after. In each case, rather than sending over the full event arguments, I just send in the appointment in question (coming through as the object obj in all cases) so I can add (line 91), edit (line 119), and delete appointments (line 142) like normal. This just ensures they get updated back to my database. Also, the one bit of code you won't see is for the Appointment Creating (line 110) event- that is because in the command I've created I simply make the replacement I need to: 1.void element_AppointmentCreating(object sender, AppointmentCreatingEventArgs e) 2.{ 3. e.NewAppointment = new InterviewAppointment(); 4. base.ExecuteCommand(); 5.} And the ViewModel is none the wiser, the appointments just work as far as it is concerned since as they are created they become InterviewAppointments. End result? I've customized my EditAppointmentDialog as follows: And adding, editing, and deleting appointments works like a charm. I can even 'edit' by moving appointments around RadScheduler, so as they are dropped into a timeslot they perform their full edit routine and things get updated. And then, the Code-Behind Version Perhaps the thing I like the most about doing one then the other is I get to steal 90% or more of the code from the MVVM version. For example, the only real changes to the Code-Behind Xaml file exist in the control declaration, in which I use events instead of attached-behavior-event-commands: 01.<telerikScheduler:RadScheduler x:Name="xJobsScheduler" 02. Grid.Row="1" 03. Grid.Column="1" 04. Width="800" 05. MinWidth="600" 06. Height="500" 07. MinHeight="300" 08. EditAppointmentStyle="{StaticResource EditAppointmentStyle}" 09. AppointmentAdded="xJobsScheduler_AppointmentAdded" 10. AppointmentCreating="xJobsScheduler_AppointmentCreating" 11. AppointmentEdited="xJobsScheduler_AppointmentEdited" 12. AppointmentDeleted="xJobsScheduler_AppointmentDeleted"> 13.</telerikScheduler:RadScheduler> Easy, right? Otherwise, all the same styling in UserControl.Resources was re-used, right down to the DataContextProxy that lets us bind to a collection from our viewmodel (in this case, our code-behind) to use within the DataTemplate. The code conversion gets even easier, as I could literally copy and paste almost everything from the ViewModel to my Code-Behind, just a matter of pasting the right section into the right event. Here's the code-behind as proof: 001.public partial class SchedulingView : UserControl, INotifyPropertyChanged 002.{ 003. public RecruitingContext context; 004. 005. private QueryableCollectionView _jobsList; 006. public QueryableCollectionView JobsList 007. { 008. get { return this._jobsList; } 009. set 010. { 011. if (this._jobsList != value) 012. { 013. this._jobsList = value; 014. this.NotifyChanged("JobsList"); 015. } 016. } 017. } 018. 019. private QueryableCollectionView _applicantList; 020. public QueryableCollectionView ApplicantList 021. { 022. get { return _applicantList; } 023. set 024. { 025. if (_applicantList != value) 026. { 027. _applicantList = value; 028. NotifyChanged("ApplicantList"); 029. } 030. } 031. } 032. 033. private ObservableItemCollection<InterviewAppointment> _interviews = new ObservableItemCollection<InterviewAppointment>(); 034. public ObservableItemCollection<InterviewAppointment> Interviews 035. { 036. get { return _interviews; } 037. set 038. { 039. if (_interviews != value) 040. { 041. _interviews = value; 042. NotifyChanged("Interviews"); 043. } 044. } 045. } 046. 047. public SchedulingView() 048. { 049. InitializeComponent(); 050. 051. this.DataContext = this; 052. 053. this.Loaded += new RoutedEventHandler(SchedulingView_Loaded); 054. } 055. 056. void SchedulingView_Loaded(object sender, RoutedEventArgs e) 057. { 058. this.xJobsScheduler.AppointmentsSource = Interviews; 059. 060. context = new RecruitingContext(); 061. 062. LoadOperation loadop = context.Load(context.GetInterviewsQuery()); 063. loadop.Completed += new EventHandler(loadop_Completed); 064. 065. this._applicantList = new QueryableCollectionView(context.Applicants); 066. context.Load(context.GetApplicantsQuery()); 067. 068. this._jobsList = new QueryableCollectionView(context.JobPostings); 069. context.Load(context.GetJobPostingsQuery()); 070. } 071. 072. void loadop_Completed(object sender, EventArgs e) 073. { 074. LoadOperation loadop = sender as LoadOperation; 075. 076. _interviews.Clear(); 077. 078. foreach (var ent in loadop.Entities) 079. { 080. _interviews.Add(EntityToAppointment(ent as Interview)); 081. } 082. } 083. 084. private void xJobsScheduler_AppointmentAdded(object sender, Telerik.Windows.Controls.AppointmentAddedEventArgs e) 085. { 086. // now we have a new InterviewAppointment to add to our QCV :) 087. InterviewAppointment newInterview = e.Appointment as InterviewAppointment; 088. 089. this.context.Interviews.Add(AppointmentToEntity(newInterview)); 090. this.context.SubmitChanges((s) => 091. { 092. ActionHistory myAction = new ActionHistory(); 093. myAction.InterviewID = newInterview.InterviewID; 094. myAction.PostingID = newInterview.PostingID; 095. myAction.ApplicantID = newInterview.ApplicantID; 096. myAction.Description = String.Format("Interview with {0} has been created by {1}", newInterview.ApplicantID.ToString(), "default user"); 097. myAction.TimeStamp = DateTime.Now; 098. context.ActionHistories.Add(myAction); 099. context.SubmitChanges(); 100. } 101. , null); 102. } 103. 104. private void xJobsScheduler_AppointmentCreating(object sender, Telerik.Windows.Controls.AppointmentCreatingEventArgs e) 105. { 106. e.NewAppointment = new InterviewAppointment(); 107. } 108. 109. private void xJobsScheduler_AppointmentEdited(object sender, Telerik.Windows.Controls.AppointmentEditedEventArgs e) 110. { 111. Interview editedInterview = (from x in context.Interviews 112. where x.InterviewID == (e.Appointment as InterviewAppointment).InterviewID 113. select x).SingleOrDefault(); 114. 115. CopyAppointmentEdit(editedInterview, e.Appointment as InterviewAppointment); 116. 117. context.SubmitChanges((s) => 118. { 119. ActionHistory myAction = new ActionHistory(); 120. myAction.InterviewID = editedInterview.InterviewID; 121. myAction.PostingID = editedInterview.PostingID; 122. myAction.ApplicantID = editedInterview.ApplicantID; 123. myAction.Description = String.Format("Interview with {0} has been modified by {1}", editedInterview.ApplicantID.ToString(), "default user"); 124. myAction.TimeStamp = DateTime.Now; 125. context.ActionHistories.Add(myAction); 126. context.SubmitChanges(); 127. } 128. , null); 129. } 130. 131. private void xJobsScheduler_AppointmentDeleted(object sender, Telerik.Windows.Controls.AppointmentDeletedEventArgs e) 132. { 133. Interview deletedInterview = (from x in context.Interviews 134. where x.InterviewID == (e.Appointment as InterviewAppointment).InterviewID 135. select x).SingleOrDefault(); 136. 137. context.Interviews.Remove(deletedInterview); 138. context.SubmitChanges((s) => 139. { 140. ActionHistory myAction = new ActionHistory(); 141. myAction.InterviewID = deletedInterview.InterviewID; 142. myAction.PostingID = deletedInterview.PostingID; 143. myAction.ApplicantID = deletedInterview.ApplicantID; 144. myAction.Description = String.Format("Interview with {0} has been deleted by {1}", deletedInterview.ApplicantID.ToString(), "default user"); 145. myAction.TimeStamp = DateTime.Now; 146. context.ActionHistories.Add(myAction); 147. context.SubmitChanges(); 148. } 149. , null); 150. } 151. 152. #region Appointment Helpers :) 153. 154. public Interview AppointmentToEntity(InterviewAppointment ia) 155. { 156. Interview newInterview = new Interview(); 157. newInterview.Subject = ia.Subject; 158. newInterview.Body = ia.Body; 159. newInterview.Start = ia.Start; 160. newInterview.End = ia.End; 161. newInterview.ApplicantID = ia.ApplicantID; 162. newInterview.PostingID = ia.PostingID; 163. newInterview.InterviewID = ia.InterviewID; 164. 165. return newInterview; 166. } 167. 168. public InterviewAppointment EntityToAppointment(Interview ia) 169. { 170. InterviewAppointment newInterview = new InterviewAppointment(); 171. newInterview.Subject = ia.Subject; 172. newInterview.Body = ia.Body; 173. newInterview.Start = ia.Start; 174. newInterview.End = ia.End; 175. newInterview.ApplicantID = ia.ApplicantID; 176. newInterview.PostingID = ia.PostingID; 177. newInterview.InterviewID = ia.InterviewID; 178. 179. return newInterview; 180. } 181. 182. public void CopyAppointmentEdit(Interview entityInterview, InterviewAppointment appointmentInterview) 183. { 184. entityInterview.Subject = appointmentInterview.Subject; 185. entityInterview.Body = appointmentInterview.Body; 186. entityInterview.Start = appointmentInterview.Start; 187. entityInterview.End = appointmentInterview.End; 188. entityInterview.ApplicantID = appointmentInterview.ApplicantID; 189. entityInterview.PostingID = appointmentInterview.PostingID; 190. } 191. 192. #endregion 193. 194. #region INotifyPropertyChanged Members 195. 196. public event PropertyChangedEventHandler PropertyChanged; 197. 198. public void NotifyChanged(string propertyName) 199. { 200. if (string.IsNullOrEmpty(propertyName)) 201. throw new ArgumentException("propertyName"); 202. 203. PropertyChanged(this, new PropertyChangedEventArgs(propertyName)); 204. } 205. 206. #endregion 207.} Nice... right? :) One really important thing to note as well. See on line 51 where I set the DataContext before the Loaded event? This is super important, as if you don't have this set before the usercontrol is loaded, the DataContextProxy has no context to use and your EditAppointmentDialog Job/Applicant dropdowns will be blank and empty. Trust me on this, took a little bit of debugging to figure out that by setting the DataContext post-loaded would only lead to disaster and frustration. Otherwise, the only other real difference is that instead of sending an ActionHistory item through an event to get added to the database and saved, I do those right in the callback from submitting. The Result Again, I only have to post one picture because these bad boys used nearly identical code for both the MVVM and the code-behind views, so our end result is... So what have we learned here today? One, for the most part this MVVM thing is somewhat easy. Yeah, you sometimes have to write a bunch of extra code, but with the help of a few useful snippits you can turn the process into a pretty streamlined little workflow. Heck, this story gets even easier as you can see in this blog post by Michael Washington- specifically run a find on 'InvokeCommandAction' and you'll see the section regarding the command on TreeView in Blend 4. Brilliant! MVVM never looked so sweet! Otherwise, it is business as usual with RadScheduler for Silverlight whichever path you're choosing for your development. Between now and the next post, I'll be cleaning up styles a bit (those RadComboBoxes are a little too close to my labels!) and adding some to the RowDetailsViews for Applicants and Jobs, so you can see all the info for an appointment in the dropdown tab view. Otherwise, we're about ready to call a wrap on this oneDid you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

Read the article

Using Stub Objects

- by user9154181

Having told the long and winding tale of where stub objects came from and how we use them to build Solaris, I'd like to focus now on the the nuts and bolts of building and using them. The following new features were added to the Solaris link-editor (ld) to support the production and use of stub objects: -z stub This new command line option informs ld that it is to build a stub object rather than a normal object. In this mode, it accepts the same command line arguments as usual, but will quietly ignore any objects and sharable object dependencies. STUB_OBJECT Mapfile Directive In order to build a stub version of an object, its mapfile must specify the STUB_OBJECT directive. When producing a non-stub object, the presence of STUB_OBJECT causes the link-editor to perform extra validation to ensure that the stub and non-stub objects will be compatible. ASSERT Mapfile Directive All data symbols exported from the object must have an ASSERT symbol directive in the mapfile that declares them as data and supplies the size, binding, bss attributes, and symbol aliasing details. When building the stub objects, the information in these ASSERT directives is used to create the data symbols. When building the real object, these ASSERT directives will ensure that the real object matches the linking interface presented by the stub. Although ASSERT was added to the link-editor in order to support stub objects, they are a general purpose feature that can be used independently of stub objects. For instance you might choose to use an ASSERT directive if you have a symbol that must have a specific address in order for the object to operate properly and you want to automatically ensure that this will always be the case. The material presented here is derived from a document I originally wrote during the development effort, which had the dual goals of providing supplemental materials for the stub object PSARC case, and as a set of edits that were eventually applied to the Oracle Solaris Linker and Libraries Manual (LLM). The Solaris 11 LLM contains this information in a more polished form. Stub Objects A stub object is a shared object, built entirely from mapfiles, that supplies the same linking interface as the real object, while containing no code or data. Stub objects cannot be used at runtime. However, an application can be built against a stub object, where the stub object provides the real object name to be used at runtime, and then use the real object at runtime. When building a stub object, the link-editor ignores any object or library files specified on the command line, and these files need not exist in order to build a stub. Since the compilation step can be omitted, and because the link-editor has relatively little work to do, stub objects can be built very quickly. Stub objects can be used to solve a variety of build problems: Speed Modern machines, using a version of make with the ability to parallelize operations, are capable of compiling and linking many objects simultaneously, and doing so offers significant speedups. However, it is typical that a given object will depend on other objects, and that there will be a core set of objects that nearly everything else depends on. It is necessary to impose an ordering that builds each object before any other object that requires it. This ordering creates bottlenecks that reduce the amount of parallelization that is possible and limits the overall speed at which the code can be built. Complexity/Correctness In a large body of code, there can be a large number of dependencies between the various objects. The makefiles or other build descriptions for these objects can become very complex and difficult to understand or maintain. The dependencies can change as the system evolves. This can cause a given set of makefiles to become slightly incorrect over time, leading to race conditions and mysterious rare build failures. Dependency Cycles It might be desirable to organize code as cooperating shared objects, each of which draw on the resources provided by the other. Such cycles cannot be supported in an environment where objects must be built before the objects that use them, even though the runtime linker is fully capable of loading and using such objects if they could be built. Stub shared objects offer an alternative method for building code that sidesteps the above issues. Stub objects can be quickly built for all the shared objects produced by the build. Then, all the real shared objects and executables can be built in parallel, in any order, using the stub objects to stand in for the real objects at link-time. Afterwards, the executables and real shared objects are kept, and the stub shared objects are discarded. Stub objects are built from a mapfile, which must satisfy the following requirements. The mapfile must specify the STUB_OBJECT directive. This directive informs the link-editor that the object can be built as a stub object, and as such causes the link-editor to perform validation and sanity checking intended to guarantee that an object and its stub will always provide identical linking interfaces. All function and data symbols that make up the external interface to the object must be explicitly listed in the mapfile. The mapfile must use symbol scope reduction ('*'), to remove any symbols not explicitly listed from the external interface. All global data exported from the object must have an ASSERT symbol attribute in the mapfile to specify the symbol type, size, and bss attributes. In the case where there are multiple symbols that reference the same data, the ASSERT for one of these symbols must specify the TYPE and SIZE attributes, while the others must use the ALIAS attribute to reference this primary symbol. Given such a mapfile, the stub and real versions of the shared object can be built using the same command line for each, adding the '-z stub' option to the link for the stub object, and omiting the option from the link for the real object. To demonstrate these ideas, the following code implements a shared object named idx5, which exports data from a 5 element array of integers, with each element initialized to contain its zero-based array index. This data is available as a global array, via an alternative alias data symbol with weak binding, and via a functional interface. % cat idx5.c int _idx5[5] = { 0, 1, 2, 3, 4 }; #pragma weak idx5 = _idx5 int idx5_func(int index) { if ((index 4)) return (-1); return (_idx5[index]); } A mapfile is required to describe the interface provided by this shared object. % cat mapfile $mapfile_version 2 STUB_OBJECT; SYMBOL_SCOPE { _idx5 { ASSERT { TYPE=data; SIZE=4[5] }; }; idx5 { ASSERT { BINDING=weak; ALIAS=_idx5 }; }; idx5_func; local: *; }; The following main program is used to print all the index values available from the idx5 shared object. % cat main.c #include <stdio.h> extern int _idx5[5], idx5[5], idx5_func(int); int main(int argc, char **argv) { int i; for (i = 0; i The following commands create a stub version of this shared object in a subdirectory named stublib. elfdump is used to verify that the resulting object is a stub. The command used to build the stub differs from that of the real object only in the addition of the -z stub option, and the use of a different output file name. This demonstrates the ease with which stub generation can be added to an existing makefile. % cc -Kpic -G -M mapfile -h libidx5.so.1 idx5.c -o stublib/libidx5.so.1 -zstub % ln -s libidx5.so.1 stublib/libidx5.so % elfdump -d stublib/libidx5.so | grep STUB [11] FLAGS_1 0x4000000 [ STUB ] The main program can now be built, using the stub object to stand in for the real shared object, and setting a runpath that will find the real object at runtime. However, as we have not yet built the real object, this program cannot yet be run. Attempts to cause the system to load the stub object are rejected, as the runtime linker knows that stub objects lack the actual code and data found in the real object, and cannot execute. % cc main.c -L stublib -R '$ORIGIN/lib' -lidx5 -lc % ./a.out ld.so.1: a.out: fatal: libidx5.so.1: open failed: No such file or directory Killed % LD_PRELOAD=stublib/libidx5.so.1 ./a.out ld.so.1: a.out: fatal: stublib/libidx5.so.1: stub shared object cannot be used at runtime Killed We build the real object using the same command as we used to build the stub, omitting the -z stub option, and writing the results to a different file. % cc -Kpic -G -M mapfile -h libidx5.so.1 idx5.c -o lib/libidx5.so.1 Once the real object has been built in the lib subdirectory, the program can be run. % ./a.out [0] 0 0 0 [1] 1 1 1 [2] 2 2 2 [3] 3 3 3 [4] 4 4 4 Mapfile Changes The version 2 mapfile syntax was extended in a number of places to accommodate stub objects. Conditional Input The version 2 mapfile syntax has the ability conditionalize mapfile input using the $if control directive. As you might imagine, these directives are used frequently with ASSERT directives for data, because a given data symbol will frequently have a different size in 32 or 64-bit code, or on differing hardware such as x86 versus sparc. The link-editor maintains an internal table of names that can be used in the logical expressions evaluated by $if and $elif. At startup, this table is initialized with items that describe the class of object (_ELF32 or _ELF64) and the type of the target machine (_sparc or _x86). We found that there were a small number of cases in the Solaris code base in which we needed to know what kind of object we were producing, so we added the following new predefined items in order to address that need: NameMeaning ...... _ET_DYNshared object _ET_EXECexecutable object _ET_RELrelocatable object ...... STUB_OBJECT Directive The new STUB_OBJECT directive informs the link-editor that the object described by the mapfile can be built as a stub object. STUB_OBJECT; A stub shared object is built entirely from the information in the mapfiles supplied on the command line. When the -z stub option is specified to build a stub object, the presence of the STUB_OBJECT directive in a mapfile is required, and the link-editor uses the information in symbol ASSERT attributes to create global symbols that match those of the real object. When the real object is built, the presence of STUB_OBJECT causes the link-editor to verify that the mapfiles accurately describe the real object interface, and that a stub object built from them will provide the same linking interface as the real object it represents. All function and data symbols that make up the external interface to the object must be explicitly listed in the mapfile. The mapfile must use symbol scope reduction ('*'), to remove any symbols not explicitly listed from the external interface. All global data in the object is required to have an ASSERT attribute that specifies the symbol type and size. If the ASSERT BIND attribute is not present, the link-editor provides a default assertion that the symbol must be GLOBAL. If the ASSERT SH_ATTR attribute is not present, or does not specify that the section is one of BITS or NOBITS, the link-editor provides a default assertion that the associated section is BITS. All data symbols that describe the same address and size are required to have ASSERT ALIAS attributes specified in the mapfile. If aliased symbols are discovered that do not have an ASSERT ALIAS specified, the link fails and no object is produced. These rules ensure that the mapfiles contain a description of the real shared object's linking interface that is sufficient to produce a stub object with a completely compatible linking interface. SYMBOL_SCOPE/SYMBOL_VERSION ASSERT Attribute The SYMBOL_SCOPE and SYMBOL_VERSION mapfile directives were extended with a symbol attribute named ASSERT. The syntax for the ASSERT attribute is as follows: ASSERT { ALIAS = symbol_name; BINDING = symbol_binding; TYPE = symbol_type; SH_ATTR = section_attributes; SIZE = size_value; SIZE = size_value[count]; }; The ASSERT attribute is used to specify the expected characteristics of the symbol. The link-editor compares the symbol characteristics that result from the link to those given by ASSERT attributes. If the real and asserted attributes do not agree, a fatal error is issued and the output object is not created. In normal use, the link editor evaluates the ASSERT attribute when present, but does not require them, or provide default values for them. The presence of the STUB_OBJECT directive in a mapfile alters the interpretation of ASSERT to require them under some circumstances, and to supply default assertions if explicit ones are not present. See the definition of the STUB_OBJECT Directive for the details. When the -z stub command line option is specified to build a stub object, the information provided by ASSERT attributes is used to define the attributes of the global symbols provided by the object. ASSERT accepts the following: ALIAS Name of a previously defined symbol that this symbol is an alias for. An alias symbol has the same type, value, and size as the main symbol. The ALIAS attribute is mutually exclusive to the TYPE, SIZE, and SH_ATTR attributes, and cannot be used with them. When ALIAS is specified, the type, size, and section attributes are obtained from the alias symbol. BIND Specifies an ELF symbol binding, which can be any of the STB_ constants defined in <sys/elf.h>, with the STB_ prefix removed (e.g. GLOBAL, WEAK). TYPE Specifies an ELF symbol type, which can be any of the STT_ constants defined in <sys/elf.h>, with the STT_ prefix removed (e.g. OBJECT, COMMON, FUNC). In addition, for compatibility with other mapfile usage, FUNCTION and DATA can be specified, for STT_FUNC and STT_OBJECT, respectively. TYPE is mutually exclusive to ALIAS, and cannot be used in conjunction with it. SH_ATTR Specifies attributes of the section associated with the symbol. The section_attributes that can be specified are given in the following table: Section AttributeMeaning BITSSection is not of type SHT_NOBITS NOBITSSection is of type SHT_NOBITS SH_ATTR is mutually exclusive to ALIAS, and cannot be used in conjunction with it. SIZE Specifies the expected symbol size. SIZE is mutually exclusive to ALIAS, and cannot be used in conjunction with it. The syntax for the size_value argument is as described in the discussion of the SIZE attribute below. SIZE The SIZE symbol attribute existed before support for stub objects was introduced. It is used to set the size attribute of a given symbol. This attribute results in the creation of a symbol definition. Prior to the introduction of the ASSERT SIZE attribute, the value of a SIZE attribute was always numeric. While attempting to apply ASSERT SIZE to the objects in the Solaris ON consolidation, I found that many data symbols have a size based on the natural machine wordsize for the class of object being produced. Variables declared as long, or as a pointer, will be 4 bytes in size in a 32-bit object, and 8 bytes in a 64-bit object. Initially, I employed the conditional $if directive to handle these cases as follows: $if _ELF32 foo { ASSERT { TYPE=data; SIZE=4 } }; bar { ASSERT { TYPE=data; SIZE=20 } }; $elif _ELF64 foo { ASSERT { TYPE=data; SIZE=8 } }; bar { ASSERT { TYPE=data; SIZE=40 } }; $else $error UNKNOWN ELFCLASS $endif I found that the situation occurs frequently enough that this is cumbersome. To simplify this case, I introduced the idea of the addrsize symbolic name, and of a repeat count, which together make it simple to specify machine word scalar or array symbols. Both the SIZE, and ASSERT SIZE attributes support this syntax: The size_value argument can be a numeric value, or it can be the symbolic name addrsize. addrsize represents the size of a machine word capable of holding a memory address. The link-editor substitutes the value 4 for addrsize when building 32-bit objects, and the value 8 when building 64-bit objects. addrsize is useful for representing the size of pointer variables and C variables of type long, as it automatically adjusts for 32 and 64-bit objects without requiring the use of conditional input. The size_value argument can be optionally suffixed with a count value, enclosed in square brackets. If count is present, size_value and count are multiplied together to obtain the final size value. Using this feature, the example above can be written more naturally as: foo { ASSERT { TYPE=data; SIZE=addrsize } }; bar { ASSERT { TYPE=data; SIZE=addrsize[5] } }; Exported Global Data Is Still A Bad Idea As you can see, the additional plumbing added to the Solaris link-editor to support stub objects is minimal. Furthermore, about 90% of that plumbing is dedicated to handling global data. We have long advised against global data exported from shared objects. There are many ways in which global data does not fit well with dynamic linking. Stub objects simply provide one more reason to avoid this practice. It is always better to export all data via a functional interface. You should always hide your data, and make it available to your users via a function that they can call to acquire the address of the data item. However, If you do have to support global data for a stub, perhaps because you are working with an already existing object, it is still easilily done, as shown above. Oracle does not like us to discuss hypothetical new features that don't exist in shipping product, so I'll end this section with a speculation. It might be possible to do more in this area to ease the difficulty of dealing with objects that have global data that the users of the library don't need. Perhaps someday... Conclusions It is easy to create stub objects for most objects. If your library only exports function symbols, all you have to do to build a faithful stub object is to add STUB_OBJECT; and then to use the same link command you're currently using, with the addition of the -z stub option. Happy Stubbing!

Read the article

Microsoft Introduces WebMatrix

- by Rick Strahl

originally published in CoDe Magazine Editorial Microsoft recently released the first CTP of a new development environment called WebMatrix, which along with some of its supporting technologies are squarely aimed at making the Microsoft Web Platform more approachable for first-time developers and hobbyists. But in the process, it also provides some updated technologies that can make life easier for existing .NET developers. Let’s face it: ASP.NET development isn’t exactly trivial unless you already have a fair bit of familiarity with sophisticated development practices. Stick a non-developer in front of Visual Studio .NET or even the Visual Web Developer Express edition and it’s not likely that the person in front of the screen will be very productive or feel inspired. Yet other technologies like PHP and even classic ASP did provide the ability for non-developers and hobbyists to become reasonably proficient in creating basic web content quickly and efficiently. WebMatrix appears to be Microsoft’s attempt to bring back some of that simplicity with a number of technologies and tools. The key is to provide a friendly and fully self-contained development environment that provides all the tools needed to build an application in one place, as well as tools that allow publishing of content and databases easily to the web server. WebMatrix is made up of several components and technologies: IIS Developer Express IIS Developer Express is a new, self-contained development web server that is fully compatible with IIS 7.5 and based on the same codebase that IIS 7.5 uses. This new development server replaces the much less compatible Cassini web server that’s been used in Visual Studio and the Express editions. IIS Express addresses a few shortcomings of the Cassini server such as the inability to serve custom ISAPI extensions (i.e., things like PHP or ASP classic for example), as well as not supporting advanced authentication. IIS Developer Express provides most of the IIS 7.5 feature set providing much better compatibility between development and live deployment scenarios. SQL Server Compact 4.0 Database access is a key component for most web-driven applications, but on the Microsoft stack this has mostly meant you have to use SQL Server or SQL Server Express. SQL Server Compact is not new-it’s been around for a few years, but it’s been severely hobbled in the past by terrible tool support and the inability to support more than a single connection in Microsoft’s attempt to avoid losing SQL Server licensing. The new release of SQL Server Compact 4.0 supports multiple connections and you can run it in ASP.NET web applications simply by installing an assembly into the bin folder of the web application. In effect, you don’t have to install a special system configuration to run SQL Compact as it is a drop-in database engine: Copy the small assembly into your BIN folder (or from the GAC if installed fully), create a connection string against a local file-based database file, and then start firing SQL requests. Additionally WebMatrix includes nice tools to edit the database tables and files, along with tools to easily upsize (and hopefully downsize in the future) to full SQL Server. This is a big win, pending compatibility and performance limits. In my simple testing the data engine performed well enough for small data sets. This is not only useful for web applications, but also for desktop applications for which a fully installed SQL engine like SQL Server would be overkill. Having a local data store in those applications that can potentially be accessed by multiple users is a welcome feature. ASP.NET Razor View Engine What? Yet another native ASP.NET view engine? We already have Web Forms and various different flavors of using that view engine with Web Forms and MVC. Do we really need another? Microsoft thinks so, and Razor is an implementation of a lightweight, script-only view engine. Unlike the Web Forms view engine, Razor works only with inline code, snippets, and markup; therefore, it is more in line with current thinking of what a view engine should represent. There’s no support for a “page model” or any of the other Web Forms features of the full-page framework, but just a lightweight scripting engine that works with plain markup plus embedded expressions and code. The markup syntax for Razor is geared for minimal typing, plus some progressive detection of where a script block/expression starts and ends. This results in a much leaner syntax than the typical ASP.NET Web Forms alligator (<% %>) tags. Razor uses the @ sign plus standard C# (or Visual Basic) block syntax to delineate code snippets and expressions. Here’s a very simple example of what Razor markup looks like along with some comment annotations: <!DOCTYPE html> <html> <head> <title></title> </head> <body> <h1>Razor Test</h1>  @DateTime.Now <hr />  @DateTime.Now.ToString("T")  @{ List<string> names = new List<string>(); names.Add("Rick"); names.Add("Markus"); names.Add("Claudio"); names.Add("Kevin"); }  <ul> @foreach(string name in names){ <li>@name</li> } </ul>  @if(true) {  <text> true </text>; } else {  <text> false </text>; } </body> </html> Like the Web Forms view engine, Razor parses pages into code, and then executes that run-time compiled code. Effectively a “page” becomes a code file with markup becoming literal text written into the Response stream, code snippets becoming raw code, and expressions being written out with Response.Write(). The code generated from Razor doesn’t look much different from similar Web Forms code that only uses script tags; so although the syntax may look different, the operational model is fairly similar to the Web Forms engine minus the overhead of the large Page object model. However, there are differences: -Razor pages are based on a new base class, Microsoft.WebPages.WebPage, which is hosted in the Microsoft.WebPages assembly that houses all the Razor engine parsing and processing logic. Browsing through the assembly (in the generated ASP.NET Temporary Files folder or GAC) will give you a good idea of the functionality that Razor provides. If you look closely, a lot of the feature set matches ASP.NET MVC’s view implementation as well as many of the helper classes found in MVC. It’s not hard to guess the motivation for this sort of view engine: For beginning developers the simple markup syntax is easier to work with, although you obviously still need to have some understanding of the .NET Framework in order to create dynamic content. The syntax is easier to read and grok and much shorter to type than ASP.NET alligator tags (<% %>) and also easier to understand aesthetically what’s happening in the markup code. Razor also is a better fit for Microsoft’s vision of ASP.NET MVC: It’s a new view engine without the baggage of Web Forms attached to it. The engine is more lightweight since it doesn’t carry all the features and object model of Web Forms with it and it can be instantiated directly outside of the HTTP environment, which has been rather tricky to do for the Web Forms view engine. Having a standalone script parser is a huge win for other applications as well – it makes it much easier to create script or meta driven output generators for many types of applications from code/screen generators, to simple form letters to data merging applications with user customizability. For me personally this is very useful side effect and who knows maybe Microsoft will actually standardize they’re scripting engines (die T4 die!) on this engine. Razor also better fits the “view-based” approach where the view is supposed to be mostly a visual representation that doesn’t hold much, if any, code. While you can still use code, the code you do write has to be self-contained. Overall I wouldn’t be surprised if Razor will become the new standard view engine for MVC in the future – and in fact there have been announcements recently that Razor will become the default script engine in ASP.NET MVC 3.0. Razor can also be used in existing Web Forms and MVC applications, although that’s not working currently unless you manually configure the script mappings and add the appropriate assemblies. It’s possible to do it, but it’s probably better to wait until Microsoft releases official support for Razor scripts in Visual Studio. Once that happens, you can simply drop .cshtml and .vbhtml pages into an existing ASP.NET project and they will work side by side with classic ASP.NET pages. WebMatrix Development Environment To tie all of these three technologies together, Microsoft is shipping WebMatrix with an integrated development environment. An integrated gallery manager makes it easy to download and load existing projects, and then extend them with custom functionality. It seems to be a prominent goal to provide community-oriented content that can act as a starting point, be it via a custom templates or a complete standard application. The IDE includes a project manager that works with a single project and provides an integrated IDE/editor for editing the .cshtml and .vbhtml pages. A run button allows you to quickly run pages in the project manager in a variety of browsers. There’s no debugging support for code at this time. Note that Razor pages don’t require explicit compilation, so making a change, saving, and then refreshing your page in the browser is all that’s needed to see changes while testing an application locally. It’s essentially using the auto-compiling Web Project that was introduced with .NET 2.0. All code is compiled during run time into dynamically created assemblies in the ASP.NET temp folder. WebMatrix also has PHP Editing support with syntax highlighting. You can load various PHP-based applications from the WebMatrix Web Gallery directly into the IDE. Most of the Web Gallery applications are ready to install and run without further configuration, with Wizards taking you through installation of tools, dependencies, and configuration of the database as needed. WebMatrix leverages the Web Platform installer to pull the pieces down from websites in a tight integration of tools that worked nicely for the four or five applications I tried this out on. Click a couple of check boxes and fill in a few simple configuration options and you end up with a running application that’s ready to be customized. Nice! You can easily deploy completed applications via WebDeploy (to an IIS server) or FTP directly from within the development environment. The deploy tool also can handle automatically uploading and installing the database and all related assemblies required, making deployment a simple one-click install step. Simplified Database Access The IDE contains a database editor that can edit SQL Compact and SQL Server databases. There is also a Database helper class that facilitates database access by providing easy-to-use, high-level query execution and iteration methods: @{ var db = Database.OpenFile("FirstApp.sdf"); string sql = "select * from customers where Id > @0"; } <ul> @foreach(var row in db.Query(sql,1)){ <li>@row.FirstName @row.LastName</li> } </ul> The query function takes a SQL statement plus any number of positional (@0,@1 etc.) SQL parameters by simple values. The result is returned as a collection of rows which in turn have a row object with dynamic properties for each of the columns giving easy (though untyped) access to each of the fields. Likewise Execute and ExecuteNonQuery allow execution of more complex queries using similar parameter passing schemes. Note these queries use string-based queries rather than LINQ or Entity Framework’s strongly typed LINQ queries. While this may seem like a step back, it’s also in line with the expectations of non .NET script developers who are quite used to writing and using SQL strings in code rather than using OR/M frameworks. The only question is why was something not included from the beginning in .NET and Microsoft made developers build custom implementations of these basic building blocks. The implementation looks a lot like a DataTable-style data access mechanism, but to be fair, this is a common approach in scripting languages. This type of syntax that uses simple, static, data object methods to perform simple data tasks with one line of code are common in scripting languages and are a good match for folks working in PHP/Python, etc. Seems like Microsoft has taken great advantage of .NET 4.0’s dynamic typing to provide this sort of interface for row iteration where each row has properties for each field. FWIW, all the examples demonstrate using local SQL Compact files - I was unable to get a SQL Server connection string to work with the Database class (the connection string wasn’t accepted). However, since the code in the page is still plain old .NET, you can easily use standard ADO.NET code or even LINQ or Entity Framework models that are created outside of WebMatrix in separate assemblies as required. The good the bad the obnoxious - It’s still .NET The beauty (or curse depending on how you look at it :)) of Razor and the compilation model is that, behind it all, it’s still .NET. Although the syntax may look foreign, it’s still all .NET behind the scenes. You can easily access existing tools, helpers, and utilities simply by adding them to the project as references or to the bin folder. Razor automatically recognizes any assembly reference from assemblies in the bin folder. In the default configuration, Microsoft provides a host of helper functions in a Microsoft.WebPages assembly (check it out in the ASP.NET temp folder for your application), which includes a host of HTML Helpers. If you’ve used ASP.NET MVC before, a lot of the helpers should look familiar. Documentation at the moment is sketchy-there’s a very rough API reference you can check out here: http://www.asp.net/webmatrix/tutorials/asp-net-web-pages-api-reference Who needs WebMatrix? Uhm… good Question Clearly Microsoft is trying hard to create an environment with WebMatrix that is easy to use for newbie developers. The goal seems to be simplicity in providing a minimal development environment and an easy-to-use script engine/language that makes it easy to get started with. There’s also some focus on community features that can be used as starting points, such as Web Gallery applications and templates. The community features in particular are very nice and something that would be nice to eventually see in Visual Studio as well. The question is whether this is too little too late. Developers who have been clamoring for a simpler development environment on the .NET stack have mostly left for other simpler platforms like PHP or Python which are catering to the down and dirty developer. Microsoft will be hard pressed to win those folks-and other hardcore PHP developers-back. Regardless of how much you dress up a script engine fronted by the .NET Framework, it’s still the .NET Framework and all the complexity that drives it. While .NET is a fine solution in its breadth and features once you get a basic handle on the core features, the bar of entry to being productive with the .NET Framework is still pretty high. The MVC style helpers Microsoft provides are a good step in the right direction, but I suspect it’s not enough to shield new developers from having to delve much deeper into the Framework to get even basic applications built. Razor and its helpers is trying to make .NET more accessible but the reality is that in order to do useful stuff that goes beyond the handful of simple helpers you still are going to have to write some C# or VB or other .NET code. If the target is a hobby/amateur/non-programmer the learning curve isn’t made any easier by WebMatrix it’s just been shifted a tad bit further along in your development endeavor when you run out of canned components that are supplied either by Microsoft or the community. The database helpers are interesting and actually I’ve heard a lot of discussion from various developers who’ve been resisting .NET for a really long time perking up at the prospect of easier data access in .NET than the ridiculous amount of code it takes to do even simple data access with raw ADO.NET. It seems sad that such a simple concept and implementation should trigger this sort of response (especially since it’s practically trivial to create helpers like these or pick them up from countless libraries available), but there it is. It also shows that there are plenty of developers out there who are more interested in ‘getting stuff done’ easily than necessarily following the latest and greatest practices which are overkill for many development scenarios. Sometimes it seems that all of .NET is focused on the big life changing issues of development, rather than the bread and butter scenarios that many developers are interested in to get their work accomplished. And that in the end may be WebMatrix’s main raison d'être: To bring some focus back at Microsoft that simpler and more high level solutions are actually needed to appeal to the non-high end developers as well as providing the necessary tools for the high end developers who want to follow the latest and greatest trends. The current version of WebMatrix hits many sweet spots, but it also feels like it has a long way to go before it really can be a tool that a beginning developer or an accomplished developer can feel comfortable with. Although there are some really good ideas in the environment (like the gallery for downloading apps and components) which would be a great addition for Visual Studio as well, the rest of the development environment just feels like crippleware with required functionality missing especially debugging and Intellisense, but also general editor support. It’s not clear whether these are because the product is still in an early alpha release or whether it’s simply designed that way to be a really limited development environment. While simple can be good, nobody wants to feel left out when it comes to necessary tool support and WebMatrix just has that left out feeling to it. If anything WebMatrix’s technology pieces (which are really independent of the WebMatrix product) are what are interesting to developers in general. The compact IIS implementation is a nice improvement for development scenarios and SQL Compact 4.0 seems to address a lot of concerns that people have had and have complained about for some time with previous SQL Compact implementations. By far the most interesting and useful technology though seems to be the Razor view engine for its light weight implementation and it’s decoupling from the ASP.NET/HTTP pipeline to provide a standalone scripting/view engine that is pluggable. The first winner of this is going to be ASP.NET MVC which can now have a cleaner view model that isn’t inconsistent due to the baggage of non-implemented WebForms features that don’t work in MVC. But I expect that Razor will end up in many other applications as a scripting and code generation engine eventually. Visual Studio integration for Razor is currently missing, but is promised for a later release. The ASP.NET MVC team has already mentioned that Razor will eventually become the default MVC view engine, which will guarantee continued growth and development of this tool along those lines. And the Razor engine and support tools actually inherit many of the features that MVC pioneered, so there’s some synergy flowing both ways between Razor and MVC. As an existing ASP.NET developer who’s already familiar with Visual Studio and ASP.NET development, the WebMatrix IDE doesn’t give you anything that you want. The tools provided are minimal and provide nothing that you can’t get in Visual Studio today, except the minimal Razor syntax highlighting, so there’s little need to take a step back. With Visual Studio integration coming later there’s little reason to look at WebMatrix for tooling. It’s good to see that Microsoft is giving some thought about the ease of use of .NET as a platform For so many years, we’ve been piling on more and more new features without trying to take a step back and see how complicated the development/configuration/deployment process has become. Sometimes it’s good to take a step - or several steps - back and take another look and realize just how far we’ve come. WebMatrix is one of those reminders and one that likely will result in some positive changes on the platform as a whole. © Rick Strahl, West Wind Technologies, 2005-2010Posted in ASP.NET IIS7

Read the article

Nagging As A Strategy For Better Linking: -z guidance

- by user9154181

The link-editor (ld) in Solaris 11 has a new feature that we call guidance that is intended to help you build better objects. The basic idea behind guidance is that if (and only if) you request it, the link-editor will issue messages suggesting better options and other changes you might make to your ld command to get better results. You can choose to take the advice, or you can disable specific types of guidance while acting on others. In some ways, this works like an experienced friend leaning over your shoulder and giving you advice — you're free to take it or leave it as you see fit, but you get nudged to do a better job than you might have otherwise. We use guidance to build the core Solaris OS, and it has proven to be useful, both in improving our objects, and in making sure that regressions don't creep back in later. In this article, I'm going to describe the evolution in thinking and design that led to the implementation of the -z guidance option, as well as give a brief description of how it works. The guidance feature issues non-fatal warnings. However, experience shows that once developers get used to ignoring warnings, it is inevitable that real problems will be lost in the noise and ignored or missed. This is why we have a zero tolerance policy against build noise in the core Solaris OS. In order to get maximum benefit from -z guidance while maintaining this policy, I added the -z fatal-warnings option at the same time. Much of the material presented here is adapted from the arc case: PSARC 2010/312 Link-editor guidance The History Of Unfortunate Link-Editor Defaults The Solaris link-editor is one of the oldest Unix commands. It stands to reason that this would be true — in order to write an operating system, you need the ability to compile and link code. The original link-editor (ld) had defaults that made sense at the time. As new features were needed, command line option switches were added to let the user use them, while maintaining backward compatibility for those who didn't. Backward compatibility is always a concern in system design, but is particularly important in the case of the tool chain (compilers, linker, and related tools), since it is a basic building block for the entire system. Over the years, applications have grown in size and complexity. Important concepts like dynamic linking that didn't exist in the original Unix system were invented. Object file formats changed. In the case of System V Release 4 Unix derivatives like Solaris, the ELF (Extensible Linking Format) was adopted. Since then, the ELF system has evolved to provide tools needed to manage today's larger and more complex environments. Features such as lazy loading, and direct bindings have been added. In an ideal world, many of these options would be defaults, with rarely used options that allow the user to turn them off. However, the reality is exactly the reverse: For backward compatibility, these features are all options that must be explicitly turned on by the user. This has led to a situation in which most applications do not take advantage of the many improvements that have been made in linking over the last 20 years. If their code seems to link and run without issue, what motivation does a developer have to read a complex manpage, absorb the information provided, choose the features that matter for their application, and apply them? Experience shows that only the most motivated and diligent programmers will make that effort. We know that most programs would be improved if we could just get you to use the various whizzy features that we provide, but the defaults conspire against us. We have long wanted to do something to make it easier for our users to use the linkers more effectively. There have been many conversations over the years regarding this issue, and how to address it. They always break down along the following lines: Change ld Defaults Since the world would be a better place the newer ld features were the defaults, why not change things to make it so? This idea is simple, elegant, and impossible. Doing so would break a large number of existing applications, including those of ISVs, big customers, and a plethora of existing open source packages. In each case, the owner of that code may choose to follow our lead and fix their code, or they may view it as an invitation to reconsider their commitment to our platform. Backward compatibility, and our installed base of working software, is one of our greatest assets, and not something to be lightly put at risk. Breaking backward compatibility at this level of the system is likely to do more harm than good. But, it sure is tempting. New Link-Editor One might create a new linker command, not called 'ld', leaving the old command as it is. The new one could use the same code as ld, but would offer only modern options, with the proper defaults for features such as direct binding. The resulting link-editor would be a pleasure to use. However, the approach is doomed to niche status. There is a vast pile of exiting code in the world built around the existing ld command, that reaches back to the 1970's. ld use is embedded in large and unknown numbers of makefiles, and is used by name by compilers that execute it. A Unix link-editor that is not named ld will not find a majority audience no matter how good it might be. Finally, a new linker command will eventually cease to be new, and will accumulate its own burden of backward compatibility issues. An Option To Make ld Do The Right Things Automatically This line of reasoning is best summarized by a CR filed in 2005, entitled 6239804 make it easier for ld(1) to do what's best The idea is to have a '-z best' option that unchains ld from its backward compatibility commitment, and allows it to turn on the "best" set of features, as determined by the authors of ld. The specific set of features enabled by -z best would be subject to change over time, as requirements change. This idea is more realistic than the other two, but was never implemented because it has some important issues that we could never answer to our satisfaction: The -z best proposal assumes that the user can turn it on, and trust it to select good options without the user needing to be aware of the options being applied. This is a fallacy. Features such as direct bindings require the user to do some analysis to ensure that the resulting program will still operate properly. A user who is willing to do the work to verify that what -z best does will be OK for their application is capable of turning on those features directly, and therefore gains little added benefit from -z best. The intent is that when a user opts into -z best, that they understand that z best is subject to sometimes incompatible evolution. Experience teaches us that this won't work. People will use this feature, the meaning of -z best will change, code that used to build will fail, and then there will be complaints and demands to retract the change. When (not if) this occurs, we will of course defend our actions, and point at the disclaimer. We'll win some of those debates, and lose others. Ultimately, we'll end up with -z best2 (-z better), or other compromises, and our goal of simplifying the world will have failed. The -z best idea rolls up a set of features that may or may not be related to each other into a unit that must be taken wholesale, or not at all. It could be that only a subset of what it does is compatible with a given application, in which case the user is expected to abandon -z best and instead set the options that apply to their application directly. In doing so, they lose one of the benefits of -z best, that if you use it, future versions of ld may choose a different set of options, and automatically improve the object through the act of rebuilding it. I drew two conclusions from the above history: For a link-editor, backward compatibility is vital. If a given command line linked your application 10 years ago, you have every reason to expect that it will link today, assuming that the libraries you're linking against are still available and compatible with their previous interfaces. For an application of any size or complexity, there is no substitute for the work involved in examining the code and determining which linker options apply and which do not. These options are largely orthogonal to each other, and it can be reasonable not to use any or all of them, depending on the situation, even in modern applications. It is a mistake to tie them together. The idea for -z guidance came from consideration of these points. By decoupling the advice from the act of taking the advice, we can retain the good aspects of -z best while avoiding its pitfalls: -z guidance gives advice, but the decision to take that advice remains with the user who must evaluate its merit and make a decision to take it or not. As such, we are free to change the specific guidance given in future releases of ld, without breaking existing applications. The only fallout from this will be some new warnings in the build output, which can be ignored or dealt with at the user's convenience. It does not couple the various features given into a single "take it or leave it" option, meaning that there will never be a need to offer "-zguidance2", or other such variants as things change over time. Guidance has the potential to be our final word on this subject. The user is given the flexibility to disable specific categories of guidance without losing the benefit of others, including those that might be added to future versions of the system. Although -z fatal-warnings stands on its own as a useful feature, it is of particular interest in combination with -z guidance. Used together, the guidance turns from advice to hard requirement: The user must either make the suggested change, or explicitly reject the advice by specifying a guidance exception token, in order to get a build. This is valuable in environments with high coding standards. ld Command Line Options The guidance effort resulted in new link-editor options for guidance and for turning warnings into fatal errors. Before I reproduce that text here, I'd like to highlight the strategic decisions embedded in the guidance feature: In order to get guidance, you have to opt in. We hope you will opt in, and believe you'll get better objects if you do, but our default mode of operation will continue as it always has, with full backward compatibility, and without judgement. Guidance suggestions always offers specific advice, and not vague generalizations. You can disable some guidance without turning off the entire feature. When you get guidance warnings, you can choose to take the advice, or you can specify a keyword to disable guidance for just that category. This allows you to get guidance for things that are useful to you, without being bothered about things that you've already considered and dismissed. As the world changes, we will add new guidance to steer you in the right direction. All such new guidance will come with a keyword that let's you turn it off. In order to facilitate building your code on different versions of Solaris, we quietly ignore any guidance keywords we don't recognize, assuming that they are intended for newer versions of the link-editor. If you want to see what guidance tokens ld does and does not recognize on your system, you can use the ld debugging feature as follows: % ld -Dargs -z guidance=foo,nodefs debug: debug: Solaris Linkers: 5.11-1.2275 debug: debug: arg[1] option=-D: option-argument: args debug: arg[2] option=-z: option-argument: guidance=foo,nodefs debug: warning: unrecognized -z guidance item: foo The -z fatal-warning option is straightforward, and generally useful in environments with strict coding standards. Note that the GNU ld already had this feature, and we accept their option names as synonyms: -z fatal-warnings | nofatal-warnings --fatal-warnings | --no-fatal-warnings The -z fatal-warnings and the --fatal-warnings option cause the link-editor to treat warnings as fatal errors. The -z nofatal-warnings and the --no-fatal-warnings option cause the link-editor to treat warnings as non-fatal. This is the default behavior. The -z guidance option is defined as follows: -z guidance[=item1,item2,...] Provide guidance messages to suggest ld options that can improve the quality of the resulting object, or which are otherwise considered to be beneficial. The specific guidance offered is subject to change over time as the system evolves. Obsolete guidance offered by older versions of ld may be dropped in new versions. Similarly, new guidance may be added to new versions of ld. Guidance therefore always represents current best practices. It is possible to enable guidance, while preventing specific guidance messages, by providing a list of item tokens, representing the class of guidance to be suppressed. In this way, unwanted advice can be suppressed without losing the benefit of other guidance. Unrecognized item tokens are quietly ignored by ld, allowing a given ld command line to be executed on a variety of older or newer versions of Solaris. The guidance offered by the current version of ld, and the item tokens used to disable these messages, are as follows. Specify Required Dependencies Dynamic executables and shared objects should explicitly define all of the dependencies they require. Guidance recommends the use of the -z defs option, should any symbol references remain unsatisfied when building dynamic objects. This guidance can be disabled with -z guidance=nodefs. Do Not Specify Non-Required Dependencies Dynamic executables and shared objects should not define any dependencies that do not satisfy the symbol references made by the dynamic object. Guidance recommends that unused dependencies be removed. This guidance can be disabled with -z guidance=nounused. Lazy Loading Dependencies should be identified for lazy loading. Guidance recommends the use of the -z lazyload option should any dependency be processed before either a -z lazyload or -z nolazyload option is encountered. This guidance can be disabled with -z guidance=nolazyload. Direct Bindings Dependencies should be referenced with direct bindings. Guidance recommends the use of the -B direct, or -z direct options should any dependency be processed before either of these options, or the -z nodirect option is encountered. This guidance can be disabled with -z guidance=nodirect. Pure Text Segment Dynamic objects should not contain relocations to non-writable, allocable sections. Guidance recommends compiling objects with Position Independent Code (PIC) should any relocations against the text segment remain, and neither the -z textwarn or -z textoff options are encountered. This guidance can be disabled with -z guidance=notext. Mapfile Syntax All mapfiles should use the version 2 mapfile syntax. Guidance recommends the use of the version 2 syntax should any mapfiles be encountered that use the version 1 syntax. This guidance can be disabled with -z guidance=nomapfile. Library Search Path Inappropriate dependencies that are encountered by ld are quietly ignored. For example, a 32-bit dependency that is encountered when generating a 64-bit object is ignored. These dependencies can result from incorrect search path settings, such as supplying an incorrect -L option. Although benign, this dependency processing is wasteful, and might hide a build problem that should be solved. Guidance recommends the removal of any inappropriate dependencies. This guidance can be disabled with -z guidance=nolibpath. In addition, -z guidance=noall can be used to entirely disable the guidance feature. See Chapter 7, Link-Editor Quick Reference, in the Linker and Libraries Guide for more information on guidance and advice for building better objects. Example The following example demonstrates how the guidance feature is intended to work. We will build a shared object that has a variety of shortcomings: Does not specify all it's dependencies Specifies dependencies it does not use Does not use direct bindings Uses a version 1 mapfile Contains relocations to the readonly allocable text (not PIC) This scenario is sadly very common — many shared objects have one or more of these issues. % cat hello.c #include <stdio.h> #include <unistd.h> void hello(void) { printf("hello user %d\n", getpid()); } % cat mapfile.v1 # This version 1 mapfile will trigger a guidance message % cc hello.c -o hello.so -G -M mapfile.v1 -lelf As you can see, the operation completes without error, resulting in a usable object. However, turning on guidance reveals a number of things that could be better: % cc hello.c -o hello.so -G -M mapfile.v1 -lelf -zguidance ld: guidance: version 2 mapfile syntax recommended: mapfile.v1 ld: guidance: -z lazyload option recommended before first dependency ld: guidance: -B direct or -z direct option recommended before first dependency Undefined first referenced symbol in file getpid hello.o (symbol belongs to implicit dependency /lib/libc.so.1) printf hello.o (symbol belongs to implicit dependency /lib/libc.so.1) ld: warning: symbol referencing errors ld: guidance: -z defs option recommended for shared objects ld: guidance: removal of unused dependency recommended: libelf.so.1 warning: Text relocation remains referenced against symbol offset in file .rodata1 (section) 0xa hello.o getpid 0x4 hello.o printf 0xf hello.o ld: guidance: position independent (PIC) code recommended for shared objects ld: guidance: see ld(1) -z guidance for more information Given the explicit advice in the above guidance messages, it is relatively easy to modify the example to do the right things: % cat mapfile.v2 # This version 2 mapfile will not trigger a guidance message $mapfile_version 2 % cc hello.c -o hello.so -Kpic -G -Bdirect -M mapfile.v2 -lc -zguidance There are situations in which the guidance does not fit the object being built. For instance, you want to build an object without direct bindings: % cc -Kpic hello.c -o hello.so -G -M mapfile.v2 -lc -zguidance ld: guidance: -B direct or -z direct option recommended before first dependency ld: guidance: see ld(1) -z guidance for more information It is easy to disable that specific guidance warning without losing the overall benefit from allowing the remainder of the guidance feature to operate: % cc -Kpic hello.c -o hello.so -G -M mapfile.v2 -lc -zguidance=nodirect Conclusions The linking guidelines enforced by the ld guidance feature correspond rather directly to our standards for building the core Solaris OS. I'm sure that comes as no surprise. It only makes sense that we would want to build our own product as well as we know how. Solaris is usually the first significant test for any new linker feature. We now enable guidance by default for all builds, and the effect has been very positive. Guidance helps us find suboptimal objects more quickly. Programmers get concrete advice for what to change instead of vague generalities. Even in the cases where we override the guidance, the makefile rules to do so serve as documentation of the fact. Deciding to use guidance is likely to cause some up front work for most code, as it forces you to consider using new features such as direct bindings. Such investigation is worthwhile, but does not come for free. However, the guidance suggestions offer a structured and straightforward way to tackle modernizing your objects, and once that work is done, for keeping them that way. The investment is often worth it, and will replay you in terms of better performance and fewer problems. I hope that you find guidance to be as useful as we have.

Search Results

Search found 25362 results on 1015 pages for 'compiling from source'.

Page 832/1015 | < Previous Page | 828 829 830 831 832 833 834 835 836 837 838 839 | Next Page >

- by user2972227

- by Graham B

- by Dinakar Kulkarni

- by user3699736

- by Jarrod Roberson

- by Lokesh Kumar

- by suicideducky

- by Vijay Kumar Singh

- by Bill Mudry

- by Mark Booth

- by Ziv

- by Dave

- by sweeney

- by Haxed

- by user450062

- by Rick Strahl

- by Rick Strahl

- by Ricardo Ferreira

- by Valter Minute

- by Rick Strahl

- by user9154181

- by Rick Strahl

- by user9154181

< Previous Page | 828 829 830 831 832 833 834 835 836 837 838 839 | Next Page >