Search Results

Search found 26581 results on 1064 pages for 'multiple tables'.

Page 90/1064 | < Previous Page | 86 87 88 89 90 91 92 93 94 95 96 97  | Next Page >

• Share history in multiple zsh shell

  - by michael

  I am trying to setup zsh so that it shares command history between different zsh sessions: in multiple tabs in multiple gnome-terminals in different screen sessions I have put this in .zshrc #To save every command before it is executed (this is different from bash's history -a solution): setopt inc_append_history #To retrieve the history file everytime history is called upon. setopt share_history but that does not work. e.g. I type 1 command: gedit afile and then I go to and zsh and type history. I don't see gedit afile. output of 'setopt' is % setopt nohistbeep histexpiredupsfirst histfindnodups histignorealldups histignoredups histignorespace histnostore histreduceblanks histsavenodups histverify incappendhistory interactive monitor promptsubst sharehistory shinstdin zle How can I achieve this?

  Read the article

• archive all messages account on exchange 2003 receiving multiple copies

  - by aeolist

  Hello everyone I am using microsoft exchange 2003 on windows 2003 small business server. For the past month or so, the archiver account has been receiving multiple copies (about 15 or so) of each and every email. edit: All copies share the same Message ID. The machine that hosts exchange is updated religiously and an antivirus scan is run on a daily basis. So would anyone please have any ideas about how to deal with this and furthermore, how i would be able to delete the multiple copies of emails from outlook 2003 inbox. I will edit the entry, answering any questions or updating on my efforts Thanks in advance

  Read the article

• How to edit a table in the email reply (in Gmail)?

  - by imz

  I've received an email with an embedded table. I want to put some marks inside that table (i.e., edit the contentof the table) and send it back. Unfortunately, the Gmail interface doesn't seem to have table editing capabilities: after I hit reply, I see the table in the quoted text of the original message, but is not editable... If this is not possible in Gmail, how do I export the HTML source of this messsage and edit in another installed word processor?

  Read the article

• Linux - Multiple service statuses with one command

  - by Jimbo

  I'm trying to retrieve a list of multiple service statuses in Unix. I'm using the service command: man page. The statuses all start with the transmission-daemon string, for example. I require the ability to list multiple services' statuses, with a single command. Here is what I'm currently trying (and failing) with: Here I'm trying to grab a list of statuses using grep. service $(ls /etc/init.d | grep "transmission-daemon") status Here I'm trying to list all statuses, and then grep for them. service --status-all | grep "transmission-daemon" This produces the following, which isn't much help: How can I effectively achieve what I require with a single command, so that I can then continue piping to awk for further customisation? Desired example output: transmission-daemon started transmission-daemon2 stopped transmission-daemon3 started

  Read the article

• Use Excel Table Column in ComboBox Input Range property

  - by V7L

  I asked this in StackOverflow and was redirected here. Apologies for redundancy. I have an Excel worksheet with a combo box on Sheet1 that is populated via its Input Range property from a Dynamic Named Range on Sheet2. It works fine and no VBA is required. My data on Sheet2 is actually in an Excel Table (all data is in the XLS file, no external data sources). For clarity, I wanted to use a structured table reference for the combo box's Input Range, but cannot seem to find a syntax that works, e.g. myTable[[#Data],[myColumn3]] I cannot find any indications that the combo box WILL accept structured table references, though I cannot see why it wouldn't. So, two part question: 1. Is is possible to use a table column reference in the combo box input range property (not using VBA) and 2. HOW?

  Read the article

• OpenVPN + iptables / NAT routing

  - by Mikeage

  Hi, I'm trying to set up an OpenVPN VPN, which will carry some (but not all) traffic from the clients to the internet via the OpenVPN server. My OpenVPN server has a public IP on eth0, and is using tap0 to create a local network, 192.168.2.x. I have a client which connects from local IP 192.168.1.101 and gets VPN IP 192.168.2.3. On the server, I ran: iptables -A INPUT -i tap+ -j ACCEPT iptables -A FORWARD -i tap+ -j ACCEPT iptables -t nat -A POSTROUTING -s 192.168.2.0/24 -o eth0 -j MASQUERADE On the client, the default remains to route via 192.168.1.1. In order to point it to 192.168.2.1 for HTTP, I ran ip rule add fwmark 0x50 table 200 ip route add table 200 default via 192.168.2.1 iptables -t mangle -A OUTPUT -j MARK -p tcp --dport 80 --set-mark 80 Now, if I try accessing a website on the client (say, wget google.com), it just hangs there. On the server, I can see $ sudo tcpdump -n -i tap0 tcpdump: verbose output suppressed, use -v or -vv for full protocol decode listening on tap0, link-type EN10MB (Ethernet), capture size 96 bytes 05:39:07.928358 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 558838 0,nop,wscale 5> 05:39:10.751921 IP 192.168.1.101.34941 > 74.125.67.100.80: S 4254520618:4254520618(0) win 5840 <mss 1334,sackOK,timestamp 559588 0,nop,wscale 5> Where 74.125.67.100 is the IP it gets for google.com . Why isn't the MASQUERADE working? More precisely, I see that the source showing up as 192.168.1.101 -- shouldn't there be something to indicate that it came from the VPN? Edit: Some routes [from the client] $ ip route show table main 192.168.2.0/24 dev tap0 proto kernel scope link src 192.168.2.4 192.168.1.0/24 dev wlan0 proto kernel scope link src 192.168.1.101 metric 2 169.254.0.0/16 dev wlan0 scope link metric 1000 default via 192.168.1.1 dev wlan0 proto static $ ip route show table 200 default via 192.168.2.1 dev tap0

  Read the article

• Single NFS folder shared across multiple clients

  - by parthi_for_tech

  I'm trying to mount a single NFS folder from server say "/share/folder" to multiple clients up to 32 clients, and the clients tries to access the folder and create files. The problem I'm facing is that when I execute the write command I see only one client is able to access the folder the remaining clients are blocked and not able to proceed to write. So, is whatever I'm trying to do above is correct? Can we write/read files from the same folder on multiple clients? if yes how can I do it prallel? Kindly advice! Thanks

  Read the article

• Multiple Active Nodes in Server Clusters

  - by blog

  What does multiple active nodes mean in the context of Server Clusters using MS Windows Server 2003 or later versions?

  Read the article

• Looking for a router with multiple WAN ports and load balancing

  - by Cyrcle

  I'm going to be moving in a few months. The location I'm moving to is great except it's on a road with very few people, so the internet access option is limited to DSL at 1.6Mbps down, 384kbps up. This is much slower than I'm used to. One option is to get at least two of the DSL lines. There's also good possibility that I'll be able to get WiMax or similar. I've been looking around a bit and it seems like what I need is a load balancing router with multiple WAN ports. Can anyone recommend some good ones? I could also go with a small power efficient Linux box with multiple NICs. What would be good software for that? It'd need to be able to handle around 10Mbps. Thanks for any help

  Read the article

• wildcard host name bindings for multiple subdomains in multiple sites on IIS7 with a single IP address

  - by orca

  Situation: I have a single windows 2008 server with a single public IP address. I have multiple domains with wildcard A records pointing to the single IP address. I need each domain to be hosted by a different web site. (i.e. www.domain1.com by site domain1site) I need domain1.com to act like www.domain1.com I need each site to be able to have multiple subdomains (i.e. www.domain1.com, abc.domain1.com, xyz.domain1.com) Not relevant yet here it goes, I plan to handle each subdomain by a different application hosted in the same site (i.e. application /xyz in domain1site) However I found out that IIS7 does not support creating web sites with wildcard host name binding and setting it without any subdomain (i.e. domain1.com) does not work, even for www.domain1.com. Is there a simple solution? Does any IIS Extension like Application Request Routing provide such capability?

  Read the article

• Cisco ASA 5505 inside interface multiple ip addresses

  - by Oneiroi

  I have an issue this morning where I want to be able to assign multiple ip addresses to the inside interface to facilitate an ip range migration for an office. Namely from a 192.168.1.x range to the new range, with the minimum of interruption for those working in the office. (New DHCP leases will use the new range, whilst those still on the 192.168.1.x range can continue to work until their lease is renewed). However I can not for the life of me figure out how to achieve this, trying to create multiple interfaces for the job leads to complaints about the license only allowing 2 active interfaces. Any suggestions? thanks in advance.

  Read the article

• Multiple public keys for one user

  - by Russell

  This question is similar to SSH public key authentication - can one public key be used for multiple users? but it's the other way around. I'm experimenting on using ssh so any ssh server would work for your answers. Can I have multiple public keys link to the same user? What are the benefits of doing so? Also, can different home directories be set for different keys used (all of which link to the same user)? Please let me know if I'm unclear. Thanks.

  Read the article

• Dates not recognized as dates in pivot table pulling directly from SQL Server

  - by Michael K

  My pivot pulls from an external data source with a date column. Excel doesn't see this column as a date and the 'Format Cells' option panel doesn't change how the dates are displayed. The cell data is left-aligned, suggesting a string rather than a date. I have tried cast(myvar as date) and convert(varchar, myvar, 101) and convert(varchar, myvar, 1) in the base table, but none of these have been picked up by Excel as dates. If the column is recognized as a date, I can group by week and month. I understand that if I can't fix this, the next step is to add columns with weeks and months for each date to the table, but I'd like to give formatting the column one more shot before doing that.

  Read the article

• Ubuntu-style Multiple Desktops for Mac OS X

  - by David Brown

  Is it possible to set up multiple desktops on a Mac?

  Read the article

• Split a table in Word without losing row title

  - by Shane Hsu

  Word has the feature to repeat title row of a table when a table is so long that it spans a bunch of pages. I need to categorize my data into several pages, and I did that by splitting the table and insert page split to put them all in a page of itself. So now I got several page of data, but only the first page has title row. Is there anyway else to do this beside manually adding the title row to all the other pages? Original data: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | | 2 * | | 2 * | | 2 * | | 2 * | | 3 * | |___3______*______| And then turn it into: _________________ | Cat. Data | | 1 * | | 1 * | | 1 * | | 1 * | | 1 * | |___1______*______| Next page _________________ | Cat. Data | | 2 * | | 2 * | | 2 * | |___2______*______| Next Page _________________ | Cat. Data | | 3 * | |___3______*______|

  Read the article

• Audio switch with multiple 3.5mm input & outputs

  - by David Nguyen

  I've been searching for a device that simple allows me to pick one input and one output from multiple input/outputs. I thought this would be a called a switch but I can only find ones with one input. Is there such a device that can do this? I will be attaching various devices, i.e. multiple console sound, PC & Laptop inputs and outputting to my speakers or headphones. I'm looking for something small and simple. All inputs and outputs are 3.5mm.

  Read the article

• Table Formatting in Excel 2007: How do I remove it?

  - by RocketGoal

  I've used the new Table Formatting option in Excel 2007. Now I can't remove it. I've dragged the little blue square up to the last cell on the top left, but it just won't go any further. In fact it just won't go at all. Clear all doesn't remove it. What does? I want my table back! I'm not a beginner with Excel, but this little annoyance has made me feel like on. Surely there must be some way to remove table format without deleting something or clearing all! Thanks Mike

  Read the article

• MySQL: how to convert many MyISAM tables to InnoDB in a production database?

  - by Continuation

  We have a production database that is made up entirely of MyISAM tables. We are considering converting them to InnoDB to gain better concurrency & reliability. Can I just alter the myISAM tables to InnoDB without shutting down MySQL? What are the recommend procedures here? How long will such a conversion take? All the tables have a total size of about 700MB There are quite a large number of tables. Is there any way to apply ALTER TABLE to all the MyISAM tables at once instead of doing it one by one? Any pitfalls I need to be aware of? Thank you

  Read the article

• Problems creating a functioning table

  - by Hoser

  This is a pretty simple SQL query I would assume, but I'm having problems getting it to work. if (object_id('#InfoTable')is not null) Begin Drop Table #InfoTable End create table #InfoTable (NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue float(30), DayStamp datetime) insert into #InfoTable(NameOfObject, NameOfCounter, SampledValue, DayStamp) select vPerformanceRule.ObjectName AS NameOfObject, vPerformanceRule.CounterName AS NameOfCounter, Perf.vPerfRaw.SampleValue AS SampledValue, Perf.vPerfHourly.DateTime AS DayStamp from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfHourly, Perf.vPerfRaw where (ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 95 AND SampleValue < 100) order by DayStamp desc select NameOfObject, NameOfCounter, SampledValue, DayStamp from #InfoTable Drop Table #InfoTable I've tried various other forms of syntax, but no matter what I do, I get these error messages. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 10 Invalid column name 'DayStamp'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfObject'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'NameOfCounter'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'SampledValue'. Msg 207, Level 16, State 1, Line 22 Invalid column name 'DayStamp'. Line 10 is the first 'insert into' line, and line 22 is the second select line. Any ideas?

  Read the article

• Synergy configuration with multiple X screens

  - by Rob Drimmie

  I'm having a problem figuring out how to configure synergy to behave on a system with multiple X windows. On my desktop I am running Ubuntu 10.04 LTS. I have two monitors, setup as separate X screens by preference as well as to enable me to rotate the left-hand monitor. I also have a laptop, which I have on the desk in front of me, lower than the other two monitors. I have a very simple synergy.conf: section: screens desktop: laptop.local: end section: links desktop: down = laptop laptop: up = desktop end It works, but on the desktop only on whichever screen I run synergys from in terminal (I haven't set it up to run at startup yet because I've been playing with the configuration). I can't find any information how to reference multiple screens on one system, and would appreciate any help.

  Read the article

• Samba+Windows: Allow multiple connections by different users?

  - by rgoytacaz

  Hello there, I have a machine running Ubuntu with Samba that I use to share stuff with my family's Windows machines in our local network. Currently they access a share for movies/music/etc with one user. I want to connect them to another share as a different user (for example, user "goytacaz"). When I try connecting to this new share, Windows gives me "Error 1219" and complains about multiple connections by the same user. How do I get my machine to accept multiple connections by the same user?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Multiple Windows Desktop areas for Full-Screen applications

  - by arootbeer

  Is it possible to run multiple instances of Windows Explorer within a single user session, or configure multiple desktops that are portions of a screen? I don't know the best way to describe what I want to achieve, but here's a picture of what I've got: I've got a 4 monitor setup, 3 portrait and one landscape, and I am normally running a number of RDP sessions, outlook, chrome, a development environment or two, so on and so forth. Most of these applications support full-screen views which mostly or completely hide the window borders, but on the Windows Desktop they take up a full monitor to do so. What I want to do is have 7 "desktops", "regions", call them what you will, each of which is, for the purposes of applications running in it, a "full screen" environment: I'm not tied to Windows Explorer for this, in case it helps - a different window manager that will support this functionality would be a perfectly acceptable answer.

  Read the article

• Issues with "There is already an object named 'xxx' in the database'

  - by Hoser

  I'm fairly new to SQL so this may be an easy mistake, but I haven't been able to find a solid solution anywhere else. Problem is whenever I try to use my temp table, it tells me it cannot be used because there is already an object with that name. I frequently try switching up the names, and sometimes it'll let me work with the table for a little while, but it never lasts for long. Am I dropping the table incorrectly? Also, I've had people suggest to just use a permanent table, but this database does not allow me to do that. create table #RandomTableName(NameOfObject varchar(50), NameOfCounter varchar(50), SampledValue decimal) select vPerformanceRule.ObjectName, vPerformanceRule.CounterName, Perf.vPerfRaw.SampleValue into #RandomTableName from vPerformanceRule, vPerformanceRuleInstance, Perf.vPerfRaw where (ObjectName like 'Processor' AND CounterName like '% Processor Time') OR(ObjectName like 'System' AND CounterName like 'Processor Queue Length') OR(ObjectName like 'Memory' AND CounterName like 'Pages/Sec') OR(ObjectName like 'Physical Disk' AND CounterName like 'Avg. Disk Queue Length') OR(ObjectName like 'Physical Disk' AND CounterName like 'Avg. Disk sec/Read') OR(ObjectName like 'Physical Disk' and CounterName like '% Disk Time') OR(ObjectName like 'Logical Disk' and CounterName like '% Free Space' AND SampleValue > 70 AND SampleValue < 100) order by ObjectName, SampleValue drop table #RandomTableName

  Read the article

• Does OSB has any database dependency?

  - by Manoj Neelapu

  Major functionality of OSB is database independent. Most of the internal data-structures that re required by OSB are stored in-memory.Reporting functionality of OSB requires DB tables be accessible.http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABCJHDJ It should hover be noted that we can still run OSB with out creating any tables on database.In such cases the reporting functionality cannot be used where as other functions in OSB will work just as fine.We also see few errors in the log file indicating the absence of these tables which we can ignore.  If reporting function is required we will have to install few tables. http://download.oracle.com/docs/cd/E14571_01/doc.1111/e15017/before.htm#BABBBEHD indicates running RCU recommended. OSB reporting tables are bundled along with SOA schema in RCU. OSB requires two simple tables for reporting functionality and installing complete SOA schema is little far fetched. SOA schema contains lot of tables which OSB doesn't require at all. More over OSB tables are too simple to require a tool like an RCU.Solution to it would be to manually create those tables required for OSB. To make  life easier the definition of tables is available in dbscripts folder under OSB_HOME.eg. D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1\dbscripts. $OSB_HOME=D:\Oracle\Middleware\osb\11gPS2\Oracle_OSB1If you are not planning to use reporting feature in OSB, then we can also delete the JDBC data sources that comes along with standard OSB domain.WLST script to delete cgDataSources from OSB domain . OSB will work fine with out DB tables and JDBC Datasource.

  Read the article

< Previous Page | 86 87 88 89 90 91 92 93 94 95 96 97  | Next Page >