Search Results

Search found 5619 results on 225 pages for 'starts'.

Page 91/225 | < Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >

  • Firefox: How to get my home page in new tabs, instead of the recent sites 'tiles' thing :(

    - by Sheldon Pinkman
    In Firefox 25 (running on Windows 7), I have the following Startup settings: When Firefox starts = 'Show my home page' Home Page = (URL of the site I want) So when I click on the Home button, I get the right page. That's all good. However, when I open a new tab, I get the 'recently visited websites tiles' screen, i.e. this: Screenshot. How do I get Firefox to show my Home Page in new tabs as well?? Note: when I open a new Window, it works OK. I'm getting the Home Page there. The problem is just with New Tab!

    Read the article

  • Encrypt two drives with Truecrypt with password before boot

    - by Deshroom
    i'm using laptop and PC with single HDD with full disk encryption. I know how works truecrypt on single drive because i use it everyday. My second laptop has 2 HHDs. My question is how to encrypt first 128GB SSD and second 1TB HDD in same way. I have multiple applications installed on second drive so i want to have it accessible during boot in ex. Steam in installed on second drive and it starts with windows. How to do it? can i encrypt two drives in truecrypt and unlock it via password before boot? My main reason is i want to RMA laptop without removing disks or data - my data need to be encrypted. Thank you.

    Read the article

  • How do you disable the magnifier in Windows Vista?

    - by PhantomDrummer
    Every so often while I'm working, if I accidentally jolt the mouse, the magnifier starts. I'm fairly sure the cause is that some comination of mouse keys is supposed to start the magnifier, and I occasionally hit the right keys accidentally. However, I've never been able to reproduce the behaviour deliberately so I don't know which combination. This is very annoying since switching the magnifier off is non-trivial (control panel, or run dialog, which are hard to use when the magnifier keeps - ummm - windowing and magnifying the bit of screen you're about to click on :-) ). So I'm wondering if there's any way to disable the magnifier completely, so that it doesn't start when you do whatever it is you'd normally do to the mouse to start it? Anyone know?

    Read the article

  • what's POST code 18 / can I run an ASRock P55 Pro + Core i3 530?

    - by Michael Borgwardt
    When I switch my newly built PC on, the fans start up, but I get nothing on the monitor, and the POST display on the motherboard runs quickly through various codes and then stops at code 18, which does not appear in the manual (the list there seems identical to this one). This lasts about 10 seconds, after which the machine shuts down. After a pause (also about 10 seconds) it starts up again, and this repeats until I cut the power. Interestingly, when I push the reset button, it stops at POST code 16 (which is also not listed in the manual). Does anyone have information about the meaning of those codes? Motherboard: ASRock P55 Pro CPU: Intel Core i3 530 Graphics Card: Sapphire HHD 5750 Does anyone have experience with that Motherboard/CPU combination? It says on the packaging and in the manual that it's only compatible with Core i5 and i7 (no mention of i3), but on the maker's product page, the i3 is listed as compatible as well.

    Read the article

  • VirtualBox VRDP server doesn't start on Windows

    - by quanticle
    I've installed VirtualBox 4.1.8 on a Windows 7 Ultimate host system. I've set up an Arch Linux VM that starts just fine from the VirtualBox GUI. However, when I try to start it with VBoxHeadless --startvm <vm_name> it prints the following Oracle VM VirtualBox Headless Interface 4.1.6 (C) 2008-2011 Oracle Corporation All rights reserved. and then it just sits there. I never get the VRDE server is listening on port 3389 message like when I start a headless VM on a Linux machine. Do I have to configure anything else in order to get the VRDE server to run?

    Read the article

  • Monitor windows startup process

    - by vlad-ardelean
    My win7 starts up pretty slow lately. I think it's some kind of malware, but my antivirus software doesn't pick up anything. How could i monitor the startup processes myself? It seems to me like either something's doing a lot of work, or some important windows process hangs for a while, since there's stuff that i can do while it's starting (like start a console), and stuff that i can't do (like execute the systeminfo command in the console) So if you happen to know how i can monitor my system, that would be great. Thx, you guys rule.

    Read the article

  • Is it possible to view Facebook news feeds page by page rather than loading it all as I scroll?

    - by oscilatingcretin
    If you want to scroll through your Facebook news feed (be it on the main feed, your personal feed, or in groups) to older parts, you have to scroll to the bottom, wait for the ajax load of the next part of the feed, and repeat. The problem with this is that, if you're scrolling down very far, the HTML document just gets bigger and bigger until your browser starts to die due to the overload of resources brought on by added HTML, text, and even images. This pretty much sets a limit to how far back you can scroll. Clicking on months and years on your personal feed has the same effect of cumulatively adding feed segments to the HTML document. I notice that this month/year feature is not available on the main feed and for groups. If there were a way to literally page through the feed so that only a single page's worth of feed data is loaded at a time, that would make scrolling through it much more doable.

    Read the article

  • How to automount a Truecrypt volume before login in Windows 7?

    - by nonoitall
    I have an external hard drive containing all my documents, and it is encrypted with a password via Truecrypt. I'd like my desktop computer at home to automatically mount the volume prior to my logging in (so that it can be used as my user folder) without asking me for a password. (Yes, the password can be saved in plain text on my desktop's hard drive - that's okay.) For the life of me, I can't figure out a way to do this that actually works though. Tried using the Task Scheduler to schedule a mount when the computer starts up, and it works, but the volume is only accessible by my user account after I log in. (Haven't tried every combination of users/options for the scheduled task, so maybe there's something else there I need to try.) Also tried adding a startup script for my user account that runs on login, which evidently is too late to set up the user's profile folder. Anybody ever successfully achieve this or something like it?

    Read the article

  • Postfix not delivering mails

    - by Sotocan
    Hi all, I have problems with a recently configured postfix MTA. When postfix starts the following warning appears: "postfix/qmgr[5078]: warning: connect to transport private/filter: No such file or directory" I have amavis-new as a content-filter, but even if I comment-out the relevant line, the warning appears. As a result (I think), of the above, I get errors like below, for every virtual domain that I have: "postfix/error[5080]: 254851834107: to=, relay=none, delay=13082, delays=13082/0.01/0/0.01, dsn=4.3.0, status=deferred (mail transport unavailable)" The good news for me, is that somehow I managed to fix that (don't ask me how!!!!) The problem is that now I have 50 or so mails, that were affected by the aforementioned problem, in the mail-queue... If I "postqueue -f " I get the same style of error as before (mail transport unavailable)...however new mails are delivered to their final destination properly... Any suggestions? Kind regards. P.S. Local mail delivery from/to Unix and virtual users, was OK write from the beginning!

    Read the article

  • ionice idle is ignored

    - by Ferran Basora
    I have been testing the ionice command for a while and the idle (3) mode seems to be ignored in most cases. My test is to run both command at the same time: du <big folder> ionice -c 3 du <another big folder> If I check both process in iotop I see no difference in the percentage of io utilization for each process. To provide more information about the CFQ scheduler I'm using a 3.5.0 linux kernel. I started doing this test because I'm experimenting a system lag each time a daily cron job updatedb.mlocate is executed in my Ubuntu 12.10 machine. If you check the /etc/cron.daily/mlocate file you realize that the command is executed like: /usr/bin/ionice -c3 /usr/bin/updatedb.mlocate Also, the funny thing is that whenever my system for some reason starts using swap memory, the updatedb.mlocate io process is been scheduled faster than kswapd0 process, and then my system gets stuck. Some suggestion? References: http://ubuntuforums.org/showthread.php?t=1243951&page=2 https://bugs.launchpad.net/ubuntu/+source/findutils/+bug/332790

    Read the article

  • Network tries to reindentify itself now and then

    - by Don Young
    When the computer starts up it connects itself to the router (ZTE 4G router) automatically, but after I have surfed the web for a while, it tries to identify itself, meaning you get that little blue circle next to the little screen at the corner. When browsing it does not cause any problems, but if I'm streaming a video the video will then stop, I'll have to refresh the page to make the video start again. And if I'm playing a game, LoL for example, the game will freeze for about 2 seconds then continue again (due to lost connection to the internet). I have no virus on my computer, although I had before. I have reset my router, restarted my computer, updated my ethernet driver, checked so that the IPv4 is set on automatic and tried different router channels. I have had this router for a few months and the problem just started recently. Here is the ipconfig screen:

    Read the article

  • Add folder name to beginning of filename - getting multiple renames

    - by Flibble Wibble
    I've used dbenham's excellent response to the question of how to add the folder name to the beginning of a filename in a cmd script. @echo off pushd "Folder" for /d %%D in (*) do ( for %%F in ("%%~D\*") do ( for %%P in ("%%F\..") do ( ren "%%F" "%%~nxP_%%~nxF" ) ) ) popd What I'm finding is that seemingly randomly (though it probably isn't) sometimes the script will run through several child folders and rename correctly but then it gets to a folder where it gets stuck in a loop and starts adding the folder name repeatedly to the file inside. I have 90,000 files in 300 folders to rename this weekend. Any chance you can guess the cause? PS: Is there a maximum number of files that are acceptable in each folder?

    Read the article

  • Stopping/Starting windows services

    - by Geek
    I have four windows services which start up automatically when the machine starts. There after, I want to restart those services every 8 hours in a particular order. For eg. Stop s1,s2,s3,s4 and than restart them in some other order like s4,s3,s2,s1. The condition is that I should wait for each service to stop completely before I stop another one. I would want to write a .BAT or some script. Is it possible to define a CRON for 8 hours, this is not there in Advanced tasks ? Can I do it using windows scheduler ? Please suggest. thanks in advance.

    Read the article

  • disappearing emails

    - by Mike
    I have a few users (about 7 of 400) where their emails are disappearing intermittently on outlook, the emails are however still on OWA in the correct folders. After running the following Shell command in exchange and restarting outlook everything works fine again for about a week. [PS] C:\Windows\system32set-mailboxcalendarsettings [email protected] - AutomateProcessing:autoupdate Then for some odd reason AutoUpdate changes to AutoAccept and the problem starts again. They are all using office 2007 with SP3 but I suspect the problem is on exchange and not on the local machine. any help will be appreciated FrustratedMike

    Read the article

  • How to scrub a document of all text between brackets with find and replace

    - by sam
    I have a log file and I need to find all instances of <password> hash here </password> and remove the hash and replace it with some dummy text like aaa-aaa-aaa-aaaa. The recurring search argument is anything that matches a bracket that starts with <password> and ends with </password>. All the hashes being replaced will be different. What's the easiest way to go a bout this? The log is on a windows machine. Probably easiest would be to use MS word for me, unless it's achievable with wordpad, notepad, or some other light weight editor like textpad. thanks

    Read the article

  • preloading RSS contents in thunderbird, before actually reading them

    - by Berry Tsakala
    i have thunderbird 3.x, and i'm subscribed to several RSS feeds. How can I tell thunderbird to load/download any new RSS items in the background? The usual behavior with RSS feeds is that it download the headrs, or few introductory lines from the contents, but only when i'm clicking a feed item it starts loading "for real". I really want to receive the feeds and not to wait for them to load, the same way i receive emails in any email client - all messages are fully downloaded at once. there could be several reasons, BTW. - e.g. if i have short connection time, i'd rather connect, sync everything at once, and read it later. - or if i have a slow wifi connection, it's annoying to wait for each and every message, but the computer is idle while reading.. thanks

    Read the article

  • Starting VM as an executable with as low overhead as possible

    - by Robert Koritnik
    Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

    Read the article

  • Nagios service active only when other service is failing

    - by Laimoncijus
    Is is possible to define service to be active only the times while other service is failing? Consider following example: 2 hosts available: HostA (primary) and HostB (backup). Nagios service, which monitors amount of active connections to the host: gives OK when amount of connections to host 0 gives FAILURE when amount of connections to host = 0 If setup nagios service to monitor both hosts: HostA and HostB - it will give me OK for HostA (while it is primary and all connections normally goes to it) and FAIL for HostB (while it is backup and will receive no connections while HostA is alive). Can I make the nagios service for HostB somehow depend on sevice of HostA and give no failures (or maybe be inactive) up to the moment the service of HostA starts failing?

    Read the article

  • How to boot directly into an application

    - by denonth
    I have an application that I want to boot in directly when windows xp starts. So after that "welcome" screen I don't want to see anything and load directly into the app. How can I do that? I tried adding a exe file to startup folder. But he is loading some 2-3 thing and then my app and I see windows desktop normally. Is it possible to load it directly? It is a windows form application not an cmd.

    Read the article

  • Windows Recovery partition unusable after Ubuntu 12.04 install on Eee PC 1005P

    - by Crivat Camilar
    Installed Ubuntu 12.04 over the secondary (D:) partition with Grub2 handling multi-boot. Never accessed the 'Recovery' option in the boot menu until Windows7 Starter became unusable due to HDD failure (bad sectors on C:). Tried creating an USB recovery stick using the OEM's recovery application (F9) on hidden partition: all I got was a clean C:\ and an error telling me the recovery images cannot be found [R:\recovery\windowsre\ - or something very much like that] although everything is there (changed 'hidden' flag to check and copy contents). Nothing happens upon pressing F9, then Grub takes over giving the recovery option. The application starts but halts about 30s after initializing, very briefly displaying the error message above. I guess every time it goes through this it actually wipes C:\ but crashes immediately afterwards not being able to find what-ever .wim image files it needs. How to make it work?

    Read the article

  • searchd under runit continues writing to the runit's log

    - by Eugene
    searchd (Sphinx) run file: #!/bin/sh set -e APP_PATH=/srv/application TARGET_USER=user exec chpst -u $TARGET_USER /usr/bin/searchd --pidfile --nodetach --config $APP_PATH/current/config/production.sphinx.conf tail /var/log/sphinx/current 2014-06-07_18:13:56.87885 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.13740 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.88113 precached 9 indexes in 0.497 sec 2014-06-07_18:13:57.89167 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.75555 precached 9 indexes in 0.497 sec 2014-06-07_18:13:59.81554 precached 9 indexes in 0.497 sec 2014-06-07_18:14:00.33466 precached 9 indexes in 0.497 sec ... it continues to write the same line until sv stop sphinx ... Everything works fine, seachd starts and responds to the queries. But how to make logs to be less repetitive? When I start Sphinx manually it prints the "precached 9 indexes" just once.

    Read the article

  • Vista Home Premium won't upload

    - by longhairedsi
    Hi, I have a sony vaio laptop(VGN-FW31J) running windows Vista Home Premium . I've had it over a year and file upload in a browser has never worked on any website in any browser(IE, Firefox, Chrome). I can select a file and the upload starts running but I always get a timeout. Sometimes it has worked once out of many attempts but only if the file is very small( < 50k). FTP does work. I've tried the following: Disabling anti virus Disabling firewall Can anyone help me here? i'm wondering if this is a vista problem or a vaio problem. Cheers

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Ubuntu 9.10 Dowload Speed Very Slow

    - by Don
    I'm running Ubuntu 9.10 desktop and I'm new to the Linux world, so bear with me. I'm on a corporate network of 3 T1s shared across 50-60 users. I typically get about 300 KB/sec for downloads, but for whatever reason, the Linux box will start out in that range, then drop to less than 1KB/Sec sometimes. Doesn't seen to matter where I'm downloading from. Right now I'm trying to get Eclipse for PHP and it's running at 3-6KB/sec. Getting the updates for the system will also drop to very slow rates. Our IT person has set up the machine to get the same 10.0.0.x address when it starts, and moved this IP to bypass our Proxy/Firewall going out, so that shouldn't be the issue. Can anyone recommend something I can try to better diagnose the problem. Again, I'm new to the Linux world and the hardware/OS setup side in general (coming form more of a coding background). Thanks for any advice.

    Read the article

  • bursty streaming video

    - by broiyan
    What is the cause and solution for the bursty streaming media problem? Example: when streaming from youtube, audio (and video) will pause and start intermittently. When it starts it will be bursty, that is, it will play several seconds of sound in just a fraction of a second. Normal sounds are rendered unrecognizable. Then it may pause and after a few seconds, resume with another burst. The video seems to burst along with the audio. This was observed on Ubuntu 12.04 with Google Chrome.

    Read the article

< Previous Page | 87 88 89 90 91 92 93 94 95 96 97 98  | Next Page >