Search Results

Search found 25022 results on 1001 pages for 'lua table'.

Page 92/1001 | < Previous Page | 88 89 90 91 92 93 94 95 96 97 98 99  | Next Page >

  • Trouble upgrading OS X, because HD doesn't use GUID Partition Table Scheme

    - by Erik Vold
    So I have a MacBook with Mac OS X 10.5 and I'm trying to upgrade to 10.6, but when I run the upgrade 'install' I quickly get to a page where I am supposed to 'Select the disk where you want to install Mac OS X' and there is only the one hard drive, so it is auto selected, and below that I see a warning message and the only button available is the 'Go Back' button. The warning message says: "Macintosh HD" can't be used because it doesn't use the GUID Partition Table scheme. Use Disk Utility to change the partition scheme. Select the disk, choose the Partition tab, select the Volume Scheme and then click Options. So I followed the above instructions, and I got to the last step, where I'm supposed to click the 'Options' button, the problem is that I cannot click that button, it is disabled.. So what am I supposed to do?

    Read the article

  • Listing the routing table takes long time to complete

    - by Rafal Rawicki
    When I print routes defined on my computer using route, it takes about 5 to 20 seconds to complete. Why does it take so much time? With VPN enabled: $ time sudo route Kernel IP routing table (...) real 0m21.423s user 0m0.000s sys 0m0.012s With no VPN, this is about 5 seconds - still, computer can do a lot in this time. I've repeated my measurements few times, getting very similar results each try. My machine is Ubuntu with 3.0.0 kernel, but as far as I know, route on the other computers works the same way.

    Read the article

  • Packets marked by iptables only sent to the correct routing table sometimes

    - by cookiecaper
    I am trying to route packets generated by a specific user out over a VPN. I have this configuration: $ sudo iptables -S -t nat -P PREROUTING ACCEPT -P OUTPUT ACCEPT -P POSTROUTING ACCEPT -A POSTROUTING -o tun0 -j MASQUERADE $ sudo iptables -S -t mangle -P PREROUTING ACCEPT -P INPUT ACCEPT -P FORWARD ACCEPT -P OUTPUT ACCEPT -P POSTROUTING ACCEPT -A OUTPUT -m owner --uid-owner guy -j MARK --set-xmark 0xb/0xffffffff $ sudo ip rule show 0: from all lookup local 32765: from all fwmark 0xb lookup 11 32766: from all lookup main 32767: from all lookup default $ sudo ip route show table 11 10.8.0.5 dev tun0 proto kernel scope link src 10.8.0.6 10.8.0.6 dev tun0 scope link 10.8.0.1 via 10.8.0.5 dev tun0 0.0.0.0/1 via 10.8.0.5 dev tun0 $ sudo iptables -S -t raw -P PREROUTING ACCEPT -P OUTPUT ACCEPT -A OUTPUT -m owner --uid-owner guy -j TRACE -A OUTPUT -p tcp -m tcp --dport 80 -j TRACE It seems that some sites work fine and use the VPN, but others don't and fall back to the normal interface. This is bad. This is a packet trace that used VPN: Oct 27 00:24:28 agent kernel: [612979.976052] TRACE: raw:OUTPUT:rule:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 Oct 27 00:24:28 agent kernel: [612979.976105] TRACE: raw:OUTPUT:policy:3 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 Oct 27 00:24:28 agent kernel: [612979.976164] TRACE: mangle:OUTPUT:rule:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 Oct 27 00:24:28 agent kernel: [612979.976210] TRACE: mangle:OUTPUT:policy:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976269] TRACE: nat:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976320] TRACE: filter:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976367] TRACE: mangle:POSTROUTING:policy:1 IN= OUT=tun0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:24:28 agent kernel: [612979.976414] TRACE: nat:POSTROUTING:rule:1 IN= OUT=tun0 SRC=XXX.YYY.ZZZ.AAA DST=23.1.17.194 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=14494 DF PROTO=TCP SPT=57502 DPT=80 SEQ=2294732931 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6E01D0000000001030307) UID=999 GID=999 MARK=0xb and this is one that didn't: Oct 27 00:22:41 agent kernel: [612873.662559] TRACE: raw:OUTPUT:rule:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 Oct 27 00:22:41 agent kernel: [612873.662609] TRACE: raw:OUTPUT:policy:3 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 Oct 27 00:22:41 agent kernel: [612873.662664] TRACE: mangle:OUTPUT:rule:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 Oct 27 00:22:41 agent kernel: [612873.662709] TRACE: mangle:OUTPUT:policy:2 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:22:41 agent kernel: [612873.662761] TRACE: nat:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:22:41 agent kernel: [612873.662808] TRACE: filter:OUTPUT:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb Oct 27 00:22:41 agent kernel: [612873.662855] TRACE: mangle:POSTROUTING:policy:1 IN= OUT=eth0 SRC=XXX.YYY.ZZZ.AAA DST=209.68.27.16 LEN=60 TOS=0x00 PREC=0x00 TTL=64 ID=40425 DF PROTO=TCP SPT=45305 DPT=80 SEQ=604973951 ACK=0 WINDOW=5840 RES=0x00 SYN URGP=0 OPT (020405B40402080A03A6B6960000000001030307) UID=999 GID=999 MARK=0xb I have already tried "ip route flush cache", to no avail. I do not know why the first packet goes through the correct routing table, and the second doesn't. Both are marked. Once again, I do not want ALL packets system-wide to go through the VPN, I only want packets from a specific user (UID=999) to go through the VPN. I am testing ipchicken.com and walmart.com via links, from the same user, same shell. walmart.com appears to use the VPN; ipchicken.com does not. Any help appreciated. Will send 0.5 bitcoins to answerer who makes this fixed.

    Read the article

  • Routing table change to access Internet over mifi

    - by Randall Blake
    I have two networks at home. One uses a Verizon mifi wireless on 192.168.1.1. The other uses a dlink router on 192.168.0.1. I have one laptop with two nics, one wireless and one not. The wireless nic connects to the mifi. The Ethernet nic connects to the dlink router. It's ip is 192.168.0.2. I also have a laptop with only one nic connected to the dlink on 192.168.0.3. I want to connect laptop 2 to the Internet. Can I do that by adding an entry to the routing table so that destination 0.0.0.0 routes to 192.168.0.2? If I do that, will laptop 1 "know" that it should route traffic from 192.168.0.3 to 192.168.1.1? Thanks for any assistance.

    Read the article

  • GUID Partition Table & Linux

    - by Zac
    (1) Is it true that the new GUID Partition Table scheme allows a user to partition a drive however he/she like, outside of the traditional MBR "4 primaries or 3 primaries + 1 extension" paradigm? If so, are there any limitations to the GPT? If my assumption is wrong, what are its advantages over the MBR model? (2) I'm getting a new laptop this week and will be installing Ubuntu (and, more generally, Linux) for the first time ever. Does Ubunutu come pre-configured with MBR as a default? If so, how do I get Ubuntu w/ GPT? If not, how do I specify GPT over MBR? Thanks!

    Read the article

  • SQL-Server 2008 : Table Insert and Range Check ?

    - by LB .
    I'm using the Table Value constructor to insert a bunch of rows at a time. However if i'm using sql replication, I run into a range check constraint on the publisher on my id column managed automatically. The reason is the fact that the id range doesn't seem to be increased during an insert of several values, meaning that the max id is reached before the actual range expansion could occur (or the id threshold). It looks like this problem for which the solution is either running the merge agent or run the sp_adjustpublisheridentityrange stored procedure. I'm litteraly doing something like : INSERT INTO dbo.MyProducts (Name, ListPrice) VALUES ('Helmet', 25.50), ('Wheel', 30.00), ((SELECT Name FROM Production.Product WHERE ProductID = 720), (SELECT ListPrice FROM Production.Product WHERE ProductID = 720)); GO What are my options (if I don't want or can't adopt any of the proposed solution) ? Expand the range ? Decrease the threshold ? Can I programmatically modify my request to circumvent this problem ? thanks.

    Read the article

  • Excel 2007: Filtering out rows in a table based on a list

    - by Sam Johnson
    I have a large table that looks like this: ID String 1 abcde 2 defgh 3 defgh 4 defgh 5 ijkl 6 ijkl 7 mnop 8 qrst I want to selectivley hide rows by populating a list of filterd values. For example, I'd like to filter out (hide) all rows that contain 'ef', 'kl', and 'qr'. Is there an easy way to do this? I know how to use Advanced filters to include only the rows that contain those substrings, but not the inverse. Has anyone does this before?

    Read the article

  • mysql error code 13 on windows xampp caused by lower case table names = 0

    - by user127379
    I can import an sql (from test linux server mysql) file if the lower case setting is removed. But then the table names are lower case and the web site doesn't work. Originally it was working (my.ini with the lower case settings), I then exported to a linux server, it was working there. Now importing back to my windows (xampp setup) fails. After wild goose chase looking at disks and permissions, I found that if I remove the lower_case_table_names=0, the import works! But I need the case sensitive command so that I can deploy on the linux server.

    Read the article

  • Filling up bounded form with information from another table while creating new record

    - by amir shadaab
    I have an excel sheet with information about each employee. I keep getting new updated spreadsheet every month. I have to create a database managing cases related to the employees. I have a database and the bounded form already created for the cases which also contain emp info fields. What I am trying to do is to only type in the emp id in the form and want the form to look up in the spreadsheet(which can be a table in the cases db) and populate other fields in the form and that information can go into the cases db. Can this be done?

    Read the article

  • Hiding a directory through the FAT table

    - by hennobal
    I've looked into the FAT file system, trying to find a way to make a directory hidden from view of the user. This has been done with malware previously, so it should be possible. The SpyEye trojan hid inside a directory C:\cleansweep.exe\ which was only reachable through the command line. I know deletion is possible by substituting the first character of the directory in the FAT table with 0xE5, but then it will not be accessible. Any ideas on how the scenario from SpyEye can be recreated? Any filesystem is interesting, but ideally FAT or NTFS.

    Read the article

  • MS Word showing unwanted table borders on screen (but not on print preview)

    - by Jivlain
    I have a MS Word document with a number of tables. The other day when I created it, the tables all had no borders. Today, I opened it up to find that the tables did have borders. However, when I check the border properties on each table, it says that there are no borders. The tables are displayed with cell borders in all view modes except for the reading layout, and they do not show up on print preview. As this document is going to generally be for on-screen viewing, I need to get rid of the borders. How can I accomplish this? (this is a MS Word 2003 *.doc document, in MS Word 2003, which has been the only editor involved.)

    Read the article

  • Some strange things in the db table of mysql database

    - by 0al0
    I noticed some weird things in the db table of mysql database in a client's server, after having the Mysql service stopping for no reason what are the test, and test_% entries? Why are there two entries for the database AQUA? Why is there a entry with a blank name? Should I worry about any of those? What should I do for each specific case? Is it safe to just delete the ones that should not be there, after backing up?

    Read the article

  • Recover partition table after DD command

    - by Shreedhar
    I executed the following command from a Ubuntu live cd terminal (dont ask why). dd if=/dev/zero of=/dev/sdb2 bs=512 count=1 Where sdb2 is a NTFS partition (third partition) on a disk. Suffice to say it is now messed up. When I boot into windows 7, it does show me E drive but when I click on it it asks me to format it. I am not ever sure what I did, did I mess up partition table or only the MFT? Is there any way to get the data back PLEASE HELP! this is very important :(

    Read the article

  • Network Table assistance

    - by mitchnufc
    I am designing a small network and have came up with the following table I am just wondering if this seems right, would appreciate some feedback, thanks. Network/Router First IP Last IP Subnet Host Broadcast Router 1 162.10.0.1 162.10.0.7 255.255.255.248 162.10.0.0 162.10.0.8 Network 1 162.10.1.1 162.10.2.253 255.255.254.0 162.10.1.0 162.10.2.254 Network 2 162.10.0.9 162.10.0.14 255.255.255.248 162.10.0.8 162.10.0.15 Router 2 162.10.0.17 162.10.0.18 255.255.255.252 162.10.0.16 162.10.0.19 Network 3 162.10.0.21 162.10.0.146 255.255.255.128 162.10.0.20 162.10.0.147 Router one is the IP assigned by the ISP

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • SQL SERVER – Weekly Series – Memory Lane – #032

    - by Pinal Dave
    Here is the list of selected articles of SQLAuthority.com across all these years. Instead of just listing all the articles I have selected a few of my most favorite articles and have listed them here with additional notes below it. Let me know which one of the following is your favorite article from memory lane. 2007 Complete Series of Database Coding Standards and Guidelines SQL SERVER Database Coding Standards and Guidelines – Introduction SQL SERVER – Database Coding Standards and Guidelines – Part 1 SQL SERVER – Database Coding Standards and Guidelines – Part 2 SQL SERVER Database Coding Standards and Guidelines Complete List Download Explanation and Example – SELF JOIN When all of the data you require is contained within a single table, but data needed to extract is related to each other in the table itself. Examples of this type of data relate to Employee information, where the table may have both an Employee’s ID number for each record and also a field that displays the ID number of an Employee’s supervisor or manager. To retrieve the data tables are required to relate/join to itself. Insert Multiple Records Using One Insert Statement – Use of UNION ALL This is very interesting question I have received from new developer. How can I insert multiple values in table using only one insert? Now this is interesting question. When there are multiple records are to be inserted in the table following is the common way using T-SQL. Function to Display Current Week Date and Day – Weekly Calendar Straight blog post with script to find current week date and day based on the parameters passed in the function.  2008 In my beginning years, I have almost same confusion as many of the developer had in their earlier years. Here are two of the interesting question which I have attempted to answer in my early year. Even if you are experienced developer may be you will still like to read following two questions: Order Of Column In Index Order of Conditions in WHERE Clauses Example of DISTINCT in Aggregate Functions Have you ever used DISTINCT with the Aggregation Function? Here is a simple example about how users can do it. Create a Comma Delimited List Using SELECT Clause From Table Column Straight to script example where I explained how to do something easy and quickly. Compound Assignment Operators SQL SERVER 2008 has introduced new concept of Compound Assignment Operators. Compound Assignment Operators are available in many other programming languages for quite some time. Compound Assignment Operators is operator where variables are operated upon and assigned on the same line. PIVOT and UNPIVOT Table Examples Here is a very interesting question – the answer to the question can be YES or NO both. “If we PIVOT any table and UNPIVOT that table do we get our original table?” Read the blog post to get the explanation of the question above. 2009 What is Interim Table – Simple Definition of Interim Table The interim table is a table that is generated by joining two tables and not the final result table. In other words, when two tables are joined they create an interim table as resultset but the resultset is not final yet. It may be possible that more tables are about to join on the interim table, and more operations are still to be applied on that table (e.g. Order By, Having etc). Besides, it may be possible that there is no interim table; sometimes final table is what is generated when the query is run. 2010 Stored Procedure and Transactions If Stored Procedure is transactional then, it should roll back complete transactions when it encounters any errors. Well, that does not happen in this case, which proves that Stored Procedure does not only provide just the transactional feature to a batch of T-SQL. Generate Database Script for SQL Azure When talking about SQL Azure the most common complaint I hear is that the script generated from stand-along SQL Server database is not compatible with SQL Azure. This was true for some time for sure but not any more. If you have SQL Server 2008 R2 installed you can follow the guideline below to generate a script which is compatible with SQL Azure. Convert IN to EXISTS – Performance Talk It is NOT necessary that every time when IN is replaced by EXISTS it gives better performance. However, in our case listed above it does for sure give better performance. You can read about this subject in the associated blog post. Subquery or Join – Various Options – SQL Server Engine Knows the Best Every single time whenever there is a performance tuning exercise, I hear the conversation from developer where some prefer subquery and some prefer join. In this two part blog post, I explain the same in the detail with examples. Part 1 | Part 2 Merge Operations – Insert, Update, Delete in Single Execution MERGE is a new feature that provides an efficient way to do multiple DML operations. In earlier versions of SQL Server, we had to write separate statements to INSERT, UPDATE, or DELETE data based on certain conditions; however, at present, by using the MERGE statement, we can include the logic of such data changes in one statement that even checks when the data is matched and then just update it, and similarly, when the data is unmatched, it is inserted. 2011 Puzzle – Statistics are not updated but are Created Once Here is the quick scenario about my setup. Create Table Insert 1000 Records Check the Statistics Now insert 10 times more 10,000 indexes Check the Statistics – it will be NOT updated – WHY? Question to You – When to use Function and When to use Stored Procedure Personally, I believe that they are both different things - they cannot be compared. I can say, it will be like comparing apples and oranges. Each has its own unique use. However, they can be used interchangeably at many times and in real life (i.e., production environment). I have personally seen both of these being used interchangeably many times. This is the precise reason for asking this question. 2012 In year 2012 I had two interesting series ran on the blog. If there is no fun in learning, the learning becomes a burden. For the same reason, I had decided to build a three part quiz around SEQUENCE. The quiz was to identify the next value of the sequence. I encourage all of you to take part in this fun quiz. Guess the Next Value – Puzzle 1 Guess the Next Value – Puzzle 2 Guess the Next Value – Puzzle 3 Guess the Next Value – Puzzle 4 Simple Example to Configure Resource Governor – Introduction to Resource Governor Resource Governor is a feature which can manage SQL Server Workload and System Resource Consumption. We can limit the amount of CPU and memory consumption by limiting /governing /throttling on the SQL Server. If there are different workloads running on SQL Server and each of the workload needs different resources or when workloads are competing for resources with each other and affecting the performance of the whole server resource governor is a very important task. Tricks to Replace SELECT * with Column Names – SQL in Sixty Seconds #017 – Video  Retrieves unnecessary columns and increases network traffic When a new columns are added views needs to be refreshed manually Leads to usage of sub-optimal execution plan Uses clustered index in most of the cases instead of using optimal index It is difficult to debug SQL SERVER – Load Generator – Free Tool From CodePlex The best part of this SQL Server Load Generator is that users can run multiple simultaneous queries again SQL Server using different login account and different application name. The interface of the tool is extremely easy to use and very intuitive as well. A Puzzle – Swap Value of Column Without Case Statement Let us assume there is a single column in the table called Gender. The challenge is to write a single update statement which will flip or swap the value in the column. For example if the value in the gender column is ‘male’ swap it with ‘female’ and if the value is ‘female’ swap it with ‘male’. Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Memory Lane, PostADay, SQL, SQL Authority, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology

    Read the article

  • Bind DropDownList with Hierarchy from MSSQL Table with ASP.NET C#

    - by Gal V
    Hello all, I have the following sql table which contains menu (website menu) data. Table Name: MenuItems Columns: Id, MenuId, ParentMenuItemId, Text. My goal is to bind a DDL according to the following hierarchy (example): Id: 1, MenuId: 1, ParentMenuItemId: -1, Text: 'One' Id: 2, MenuId: 1, ParentMenuItemId: 1, Text: 'Two' Id: 3, MenuId: 1, ParentMenuItemId: 1, Text: 'Three' Id: 4, MenuId: 1, ParentMenuItemId: 2, Text: 'Four' Id: 5, MenuId: 1, ParentMenuItemId: 4, Text: 'Five' Requested result in DDL: One -- Two ---- Four ------ Five -- Three I think it should contain 'WITH' SQL command. Thanks all!

    Read the article

  • Silverlight: After adding table no datacontext classes are available for the new DomainService class

    - by Gabriel
    I'm using a Silverlight 4 WCF RIA Services demo application that uses LinqToSql, that works well. I add a new database table, move the new table to the LinqToSql designer and build the project I add a new DomainService class I get a dialog with the only option to create an empty DomainService and no DataContext classes are available. What am I missed? Thanks in advance Gabriel

    Read the article

  • Fluent Nhibernate - Mapping two entities to same table

    - by Andy
    Hi, I'm trying to map two domain entities to the same table. We're doing a smart entity for our domain model, so we have the concept of an Editable Address and a readonly Address. I have both mapped using Classmaps, and everything seems to go fine until we try to export the schema using the SchemaExport class from NHibernate. It errors out saying the table already exists. I assume it's something simple that I'm just not seeing. Any ideas? Thanks

    Read the article

  • Register applications via Registry table rather than TLBs

    - by Mmarquee
    We register the capabilities of Delphi applications using TLB files. However, from reading MSDN documentation, "Installation package authors are strongly advised against using the TypeLib table. Instead, they should register type libraries by using the Registry table". Does anyone have any advice on how to do this in a 'Delphi' way for Windows 7?

    Read the article

  • Zend Form, table decorators

    - by levacjeep
    Hello, I am having an incredibly difficult time to decorate a Zend form the way I need to. This is the HTML structure I am in need of: <table> <thead><tr><th>one</th><th>two</th><th>three</th><th>four</th></thead> <tbody> <tr> <td><input type='checkbox' id='something'/></td> <td><img src='src'/></td> <td><input type='text' id='something'/></td> <td><input type='radio' group='justonegroup'/></td> </tr> <tr> <td><input type='checkbox' id='something'/></td> <td><img src='src'/></td> <td><input type='text' id='something'/></td> <td><input type='radio' group='justonegroup'/></td> </tr> </tbody> </table> The number of rows in the body is determined by my looping structure inside my form class. All ids will be unique of course. All radio buttons in the form belongs to one group. My issue really is that I am unsure how to create and then style the object Zend_Form_Element_MultiCheckbox and Zend_Form_Element_Radio inside my table. Where/how would I apply the appropriate decoraters to the checkboxes and radio buttons to have a form structure like above? My Form class so far: class Form_ManageAlbums extends Zend_Form { public function __construct($album_id) { $photos = Model_DbTable_Photos::getAlbumPhotos($album_id); $selector = new Zend_Form_Element_MultiCheckbox('selector'); $radio = new Zend_Form_Element_Radio('group'); $options = array(); while($photo = $photos->fetchObject()) { $options[$photo->id] = ''; $image = new Zend_Form_Element_Image('image'.$photo->id); $image->setImageValue('/dog/upload/'.$photo->uid.'/photo/'.$photo->src); $caption = new Zend_Form_Element_Text('caption'.$photo->id); $caption->setValue($photo->caption); $this->addElements(array($image, $caption)); } $selector->addMultiOptions($options); $radio->addMultiOptions($options); $this->addElement($selector); $this->setDecorators(array( 'FormElements', array('HtmlTag', array('tag' => 'table')), 'Form' )); } } I have tried a few combination of decoraters for the td and tr, but no success to date. Thank you for any help, very appreciated. JP Levac

    Read the article

  • Validate a string in a table in SQL Server - CLR function or T-SQL

    - by Ashish Gupta
    I need to check If a column value (string) in SQL server table starts with a small letter and can only contain '_', '-', numbers and alphabets. I know I can use a SQL server CLR function for that. However, I am trying to implement that validation using a scalar UDF and could make very little here...I can use 'NOT LIKE', but I am not sure how to make sure I validate the string irrespective of the order of characters or in other words write a pattern in SQL for this. Am I better off using a SQL CLR function? Any help will be appreciated.. Thanks in advance Thank you everyone for their comments. This morning, I chose to go CLR function way. For the purpose of what I was trying to achieve, I created one CLR function which does the validation of an input string and have that called from a SQL UDF and It works well. Just to measure the performance of t-SQL UDF using SQL CLR function vs t- SQL UDF, I created a SQL CLR function which will just check if the input string contains only small letters, it should return true else false and have that called from a UDF (IsLowerCaseCLR). After that I also created a regular t-SQL UDF(IsLowerCaseTSQL) which does the same thing using the 'NOT LIKE'. Then I created a table (Person) with columns Name(varchar) and IsValid(bit) columns and populate that with names to test. Data :- 1000 records with 'Ashish' as value for Name column 1000 records with 'ashish' as value for Name column then I ran the following :- UPDATE Person Set IsValid=1 WHERE dbo.IsLowerCaseTSQL (Name) Above updated 1000 records (with Isvalid=1) and took less than a second. I deleted all the data in the table and repopulated the same with same data. Then updated the same table using Sql CLR UDF (with Isvalid=1) and this took 3 seconds! If update happens for 5000 records, regular UDF takes 0 seconds compared to CLR UDF which takes 16 seconds! I am very less knowledgeable on t-SQL regular expression or I could have tested my actual more complex validation criteria. But I just wanted to know, even I could have written that, would that have been faster than the SQL CLR function considering the example above. Are we using SQL CLR because we can implement we can implement lot richer logic which would have been difficult otherwise If we write in regular SQL. Sorry for this long post. I just want to know from the experts. Please feel free to ask if you could not understand anything here. Thank you again for your time.

    Read the article

  • No such table android_metadata, what's the problem?

    - by flybirdtt
    i use a existed slqite database, and copy it to /data/data/packagename/databases, The code learned from this blog: http://www.reigndesign.com/blog/using-your-own-sqlite-database-in-android-applications/ after copy the database, I open the databse. But the log message show the error: No such table android_metadata So i need creat a table named android_metadata? And what the value i need insert into this database Thanks very much

    Read the article

< Previous Page | 88 89 90 91 92 93 94 95 96 97 98 99  | Next Page >