Search Results

Search found 40168 results on 1607 pages for 'text processing'.

Page 93/1607 | < Previous Page | 89 90 91 92 93 94 95 96 97 98 99 100  | Next Page >

  • Can't install graphic drivers in 12.04

    - by yinon
    The driver is ATI/AMD proprietary FGLRX graphics driver. After clicking Activate, it asks for my password and starts downloading. Then it shows an error message: 2012-10-03 16:16:04,227 DEBUG: updating <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> 2012-10-03 16:16:06,172 DEBUG: reading modalias file /lib/modules/3.2.0-29-generic-pae/modules.alias 2012-10-03 16:16:06,383 DEBUG: reading modalias file /usr/share/jockey/modaliases/b43 2012-10-03 16:16:06,386 DEBUG: reading modalias file /usr/share/jockey/modaliases/disable-upstream-nvidia 2012-10-03 16:16:06,456 DEBUG: loading custom handler /usr/share/jockey/handlers/pvr-omap4.py 2012-10-03 16:16:06,506 WARNING: modinfo for module omapdrm_pvr failed: ERROR: modinfo: could not find module omapdrm_pvr 2012-10-03 16:16:06,509 DEBUG: Instantiated Handler subclass __builtin__.PVROmap4Driver from name PVROmap4Driver 2012-10-03 16:16:06,682 DEBUG: PowerVR SGX proprietary graphics driver for OMAP 4 not available 2012-10-03 16:16:06,682 DEBUG: loading custom handler /usr/share/jockey/handlers/cdv.py 2012-10-03 16:16:06,727 WARNING: modinfo for module cedarview_gfx failed: ERROR: modinfo: could not find module cedarview_gfx 2012-10-03 16:16:06,728 DEBUG: Instantiated Handler subclass __builtin__.CdvDriver from name CdvDriver 2012-10-03 16:16:06,728 DEBUG: cdv.available: falling back to default 2012-10-03 16:16:06,772 DEBUG: Intel Cedarview graphics driver availability undetermined, adding to pool 2012-10-03 16:16:06,772 DEBUG: loading custom handler /usr/share/jockey/handlers/vmware-client.py 2012-10-03 16:16:06,781 WARNING: modinfo for module vmxnet failed: ERROR: modinfo: could not find module vmxnet 2012-10-03 16:16:06,781 DEBUG: Instantiated Handler subclass __builtin__.VmwareClientHandler from name VmwareClientHandler 2012-10-03 16:16:06,795 DEBUG: VMWare Client Tools availability undetermined, adding to pool 2012-10-03 16:16:06,796 DEBUG: loading custom handler /usr/share/jockey/handlers/fglrx.py 2012-10-03 16:16:06,801 WARNING: modinfo for module fglrx_updates failed: ERROR: modinfo: could not find module fglrx_updates 2012-10-03 16:16:06,805 DEBUG: Instantiated Handler subclass __builtin__.FglrxDriverUpdate from name FglrxDriverUpdate 2012-10-03 16:16:06,805 DEBUG: fglrx.available: falling back to default 2012-10-03 16:16:06,833 DEBUG: ATI/AMD proprietary FGLRX graphics driver (post-release updates) availability undetermined, adding to pool 2012-10-03 16:16:06,836 WARNING: modinfo for module fglrx failed: ERROR: modinfo: could not find module fglrx 2012-10-03 16:16:06,840 DEBUG: Instantiated Handler subclass __builtin__.FglrxDriver from name FglrxDriver 2012-10-03 16:16:06,840 DEBUG: fglrx.available: falling back to default 2012-10-03 16:16:06,873 DEBUG: ATI/AMD proprietary FGLRX graphics driver availability undetermined, adding to pool 2012-10-03 16:16:06,873 DEBUG: loading custom handler /usr/share/jockey/handlers/dvb_usb_firmware.py 2012-10-03 16:16:06,925 DEBUG: Instantiated Handler subclass __builtin__.DvbUsbFirmwareHandler from name DvbUsbFirmwareHandler 2012-10-03 16:16:06,926 DEBUG: Firmware for DVB cards not available 2012-10-03 16:16:06,926 DEBUG: loading custom handler /usr/share/jockey/handlers/nvidia.py 2012-10-03 16:16:06,961 WARNING: modinfo for module nvidia_96 failed: ERROR: modinfo: could not find module nvidia_96 2012-10-03 16:16:06,967 DEBUG: Instantiated Handler subclass __builtin__.NvidiaDriver96 from name NvidiaDriver96 2012-10-03 16:16:06,968 DEBUG: nvidia.available: falling back to default 2012-10-03 16:16:06,980 DEBUG: XorgDriverHandler(nvidia_96, nvidia-96, None): Disabling as package video ABI xorg-video-abi-10 does not match X.org video ABI xorg-video-abi-11 2012-10-03 16:16:06,980 DEBUG: NVIDIA accelerated graphics driver not available 2012-10-03 16:16:06,983 WARNING: modinfo for module nvidia_current failed: ERROR: modinfo: could not find module nvidia_current 2012-10-03 16:16:06,987 DEBUG: Instantiated Handler subclass __builtin__.NvidiaDriverCurrent from name NvidiaDriverCurrent 2012-10-03 16:16:06,987 DEBUG: nvidia.available: falling back to default 2012-10-03 16:16:07,015 DEBUG: NVIDIA accelerated graphics driver availability undetermined, adding to pool 2012-10-03 16:16:07,018 WARNING: modinfo for module nvidia_current_updates failed: ERROR: modinfo: could not find module nvidia_current_updates 2012-10-03 16:16:07,021 DEBUG: Instantiated Handler subclass __builtin__.NvidiaDriverCurrentUpdates from name NvidiaDriverCurrentUpdates 2012-10-03 16:16:07,022 DEBUG: nvidia.available: falling back to default 2012-10-03 16:16:07,066 DEBUG: NVIDIA accelerated graphics driver (post-release updates) availability undetermined, adding to pool 2012-10-03 16:16:07,069 WARNING: modinfo for module nvidia_173_updates failed: ERROR: modinfo: could not find module nvidia_173_updates 2012-10-03 16:16:07,072 DEBUG: Instantiated Handler subclass __builtin__.NvidiaDriver173Updates from name NvidiaDriver173Updates 2012-10-03 16:16:07,073 DEBUG: nvidia.available: falling back to default 2012-10-03 16:16:07,105 DEBUG: NVIDIA accelerated graphics driver (post-release updates) availability undetermined, adding to pool 2012-10-03 16:16:07,112 WARNING: modinfo for module nvidia_173 failed: ERROR: modinfo: could not find module nvidia_173 2012-10-03 16:16:07,118 DEBUG: Instantiated Handler subclass __builtin__.NvidiaDriver173 from name NvidiaDriver173 2012-10-03 16:16:07,119 DEBUG: nvidia.available: falling back to default 2012-10-03 16:16:07,159 DEBUG: NVIDIA accelerated graphics driver availability undetermined, adding to pool 2012-10-03 16:16:07,166 WARNING: modinfo for module nvidia_96_updates failed: ERROR: modinfo: could not find module nvidia_96_updates 2012-10-03 16:16:07,171 DEBUG: Instantiated Handler subclass __builtin__.NvidiaDriver96Updates from name NvidiaDriver96Updates 2012-10-03 16:16:07,171 DEBUG: nvidia.available: falling back to default 2012-10-03 16:16:07,188 DEBUG: XorgDriverHandler(nvidia_96_updates, nvidia-96-updates, None): Disabling as package video ABI xorg-video-abi-10 does not match X.org video ABI xorg-video-abi-11 2012-10-03 16:16:07,188 DEBUG: NVIDIA accelerated graphics driver (post-release updates) not available 2012-10-03 16:16:07,188 DEBUG: loading custom handler /usr/share/jockey/handlers/madwifi.py 2012-10-03 16:16:07,195 WARNING: modinfo for module ath_pci failed: ERROR: modinfo: could not find module ath_pci 2012-10-03 16:16:07,195 DEBUG: Instantiated Handler subclass __builtin__.MadwifiHandler from name MadwifiHandler 2012-10-03 16:16:07,196 DEBUG: Alternate Atheros "madwifi" driver availability undetermined, adding to pool 2012-10-03 16:16:07,196 DEBUG: loading custom handler /usr/share/jockey/handlers/sl_modem.py 2012-10-03 16:16:07,213 DEBUG: Instantiated Handler subclass __builtin__.SlModem from name SlModem 2012-10-03 16:16:07,234 DEBUG: Software modem not available 2012-10-03 16:16:07,234 DEBUG: loading custom handler /usr/share/jockey/handlers/broadcom_wl.py 2012-10-03 16:16:07,239 WARNING: modinfo for module wl failed: ERROR: modinfo: could not find module wl 2012-10-03 16:16:07,277 DEBUG: Instantiated Handler subclass __builtin__.BroadcomWLHandler from name BroadcomWLHandler 2012-10-03 16:16:07,277 DEBUG: Broadcom STA wireless driver availability undetermined, adding to pool 2012-10-03 16:16:07,278 DEBUG: all custom handlers loaded 2012-10-03 16:16:07,278 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'pci:v00008086d000027D8sv00001043sd000082EAbc04sc03i00') 2012-10-03 16:16:07,568 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'snd_hda_intel'} 2012-10-03 16:16:07,699 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'snd_hda_intel', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,699 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'snd_hda_intel'} 2012-10-03 16:16:07,699 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'snd_hda_intel', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,699 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'input:b0000v0000p0000e0000-e0,5,kramlsfw6,') 2012-10-03 16:16:07,704 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'evbug'} 2012-10-03 16:16:07,704 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'evbug', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,704 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'pci:v00008086d000027DAsv00001043sd00008179bc0Csc05i00') 2012-10-03 16:16:07,707 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'i2c_i801'} 2012-10-03 16:16:07,707 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'i2c_i801', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,707 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'acpi:PNP0C01:') 2012-10-03 16:16:07,707 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'acpi:PNP0B00:') 2012-10-03 16:16:07,707 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'pci:v00001969d00001026sv00001043sd00008304bc02sc00i00') 2012-10-03 16:16:07,710 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'atl1e'} 2012-10-03 16:16:07,710 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'atl1e', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,710 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'input:b0003v04F2p0816e0111-e0,1,4,11,14,k71,72,73,74,75,77,79,7A,7B,7C,7D,7E,7F,80,81,82,83,84,85,86,87,88,89,8A,8C,8E,96,98,9E,9F,A1,A3,A4,A5,A6,AD,B0,B1,B2,B3,B4,B7,B8,B9,BA,BB,BC,BD,BE,BF,C0,C1,C2,F0,ram4,l0,1,2,sfw') 2012-10-03 16:16:07,711 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'evbug'} 2012-10-03 16:16:07,711 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'evbug', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,711 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'mac_hid'} 2012-10-03 16:16:07,711 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'mac_hid', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,711 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'platform:pcspkr') 2012-10-03 16:16:07,711 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'pcspkr'} 2012-10-03 16:16:07,711 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'pcspkr', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,712 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'snd_pcsp'} 2012-10-03 16:16:07,712 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'snd_pcsp', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,712 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'usb:v1D6Bp0001d0302dc09dsc00dp00ic09isc00ip00') 2012-10-03 16:16:07,724 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'input:b0019v0000p0001e0000-e0,1,k74,ramlsfw') 2012-10-03 16:16:07,724 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'evbug'} 2012-10-03 16:16:07,724 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'evbug', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,724 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'mac_hid'} 2012-10-03 16:16:07,724 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'mac_hid', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,724 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'acpi:PNP0C04:') 2012-10-03 16:16:07,724 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'platform:eisa') 2012-10-03 16:16:07,725 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'pci:v00008086d000027CCsv00001043sd00008179bc0Csc03i20') 2012-10-03 16:16:07,728 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'platform:Fixed MDIO bus') 2012-10-03 16:16:07,728 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'pci:v00008086d000029C0sv00001043sd000082B0bc06sc00i00') 2012-10-03 16:16:07,731 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'usb:v045Ep0766d0101dcEFdsc02dp01ic01isc01ip00') 2012-10-03 16:16:07,777 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'snd_usb_audio'} 2012-10-03 16:16:07,777 DEBUG: no corresponding handler available for {'driver_type': 'kernel_module', 'kernel_module': 'snd_usb_audio', 'jockey_handler': 'KernelModuleHandler'} 2012-10-03 16:16:07,777 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'acpi:PNP0F03:PNP0F13:') 2012-10-03 16:16:07,777 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'acpi:PNP0000:') 2012-10-03 16:16:07,777 DEBUG: querying driver db <jockey.detection.LocalKernelModulesDriverDB instance at 0xb7231a0c> about HardwareID('modalias', 'pci:v00001002d000095C5sv0000174Bsd0000E400bc03sc00i00') 2012-10-03 16:16:08,072 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'fglrx_updates', 'package': 'fglrx-updates'} 2012-10-03 16:16:08,133 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/i386-linux-gnu/mesa/ld.so.conf other target alt None other current alt None 2012-10-03 16:16:08,134 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:16:08,072 DEBUG: found match in handler pool xorg:fglrx_updates([FglrxDriverUpdate, nonfree, disabled] ATI/AMD proprietary FGLRX graphics driver (post-release updates)) 2012-10-03 16:16:08,136 WARNING: modinfo for module fglrx_updates failed: ERROR: modinfo: could not find module fglrx_updates 2012-10-03 16:16:08,147 DEBUG: fglrx.available: falling back to default 2012-10-03 16:16:08,173 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/i386-linux-gnu/mesa/ld.so.conf other target alt None other current alt None 2012-10-03 16:16:08,173 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:16:08,162 DEBUG: got handler xorg:fglrx_updates([FglrxDriverUpdate, nonfree, disabled] ATI/AMD proprietary FGLRX graphics driver (post-release updates)) 2012-10-03 16:16:08,173 DEBUG: searching handler for driver ID {'driver_type': 'kernel_module', 'kernel_module': 'fglrx', 'package': 'fglrx'} 2012-10-03 16:16:08,184 DEBUG: fglrx.enabled(fglrx): target_alt None current_alt /usr/lib/i386-linux-gnu/mesa/ld.so.conf other target alt None other current alt None 2012-10-03 16:16:08,184 DEBUG: fglrx is not the alternative in use 2012-10-03 16:16:08,173 DEBUG: found match in handler pool xorg:fglrx([FglrxDriver, nonfree, disabled] ATI/AMD proprietary FGLRX graphics driver) 2012-10-03 16:16:08,187 WARNING: modinfo for module fglrx failed: ERROR: modinfo: could not find module fglrx 2012-10-03 16:16:08,190 DEBUG: fglrx.available: falling back to default 2012-10-03 16:16:08,216 DEBUG: fglrx.enabled(fglrx): target_alt None current_alt /usr/lib/i386-linux-gnu/mesa/ld.so.conf other target alt None other current alt None . . . 2012-10-03 16:18:10,552 DEBUG: install progress initramfs-tools 62.500000 2012-10-03 16:18:22,249 DEBUG: install progress libc-bin 62.500000 2012-10-03 16:18:23,251 DEBUG: Selecting previously unselected package dkms. (Reading database ... 142496 files and directories currently installed.) Unpacking dkms (from .../dkms_2.2.0.3-1ubuntu3_all.deb) ... Selecting previously unselected package fakeroot. Unpacking fakeroot (from .../fakeroot_1.18.2-1_i386.deb) ... Selecting previously unselected package fglrx-updates. Unpacking fglrx-updates (from .../fglrx-updates_2%3a8.960-0ubuntu1.1_i386.deb) ... Selecting previously unselected package fglrx-amdcccle-updates. Unpacking fglrx-amdcccle-updates (from .../fglrx-amdcccle-updates_2%3a8.960-0ubuntu1.1_i386.deb) ... Processing triggers for man-db ... Processing triggers for ureadahead ... ureadahead will be reprofiled on next reboot dpkg: error processing libxss1 (--configure): package libxss1 is already installed and configured dpkg: error processing chromium-codecs-ffmpeg (--configure): package chromium-codecs-ffmpeg is already installed and configured dpkg: error processing chromium-browser (--configure): package chromium-browser is already installed and configured dpkg: error processing chromium-browser-l10n (--configure): package chromium-browser-l10n is already installed and configured Setting up dkms (2.2.0.3-1ubuntu3) ... No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already Setting up fakeroot (1.18.2-1) ... update-alternatives: using /usr/bin/fakeroot-sysv to provide /usr/bin/fakeroot (fakeroot) in auto mode. Setting up fglrx-updates (2:8.960-0ubuntu1.1) ... update-alternatives: using /usr/lib/fglrx/ld.so.conf to provide /etc/ld.so.conf.d/i386-linux-gnu_GL.conf (i386-linux-gnu_gl_conf) in auto mode. update-alternatives: warning: skip creation of /etc/OpenCL/vendors/amdocl64.icd because associated file /usr/lib/fglrx/etc/OpenCL/vendors/amdocl64.icd (of link group i386-linux-gnu_gl_conf) doesn't exist. update-alternatives: warning: skip creation of /usr/lib32/libaticalcl.so because associated file /usr/lib32/fglrx/libaticalcl.so (of link group i386-linux-gnu_gl_conf) doesn't exist. update-alternatives: warning: skip creation of /usr/lib32/libaticalrt.so because associated file /usr/lib32/fglrx/libaticalrt.so (of link group i386-linux-gnu_gl_conf) doesn't exist. update-alternatives: using /usr/lib/fglrx/alt_ld.so.conf to provide /etc/ld.so.conf.d/x86_64-linux-gnu_GL.conf (x86_64-linux-gnu_gl_conf) in auto mode. update-initramfs: deferring update (trigger activated) Loading new fglrx-updates-8.960 DKMS files... First Installation: checking all kernels... Building only for 3.2.0-29-generic-pae Building for architecture i686 Building initial module for 3.2.0-29-generic-pae Done. fglrx_updates: Running module version sanity check. - Original module - No original module exists within this kernel - Installation - Installing to /lib/modules/3.2.0-29-generic-pae/updates/dkms/ depmod...... DKMS: install completed. update-initramfs: deferring update (trigger activated) Processing triggers for bamfdaemon ... Rebuilding /usr/share/applications/bamf.index... Setting up fglrx-amdcccle-updates (2:8.960-0ubuntu1.1) ... Processing triggers for initramfs-tools ... update-initramfs: Generating /boot/initrd.img-3.2.0-29-generic-pae Processing triggers for libc-bin ... ldconfig deferred processing now taking place Errors were encountered while processing: libxss1 chromium-codecs-ffmpeg chromium-browser chromium-browser-l10n Error in function: SystemError: E:Sub-process /usr/bin/dpkg returned an error code (1) 2012-10-03 16:18:23,256 ERROR: Package failed to install: Selecting previously unselected package dkms. (Reading database ... 142496 files and directories currently installed.) Unpacking dkms (from .../dkms_2.2.0.3-1ubuntu3_all.deb) ... Selecting previously unselected package fakeroot. Unpacking fakeroot (from .../fakeroot_1.18.2-1_i386.deb) ... Selecting previously unselected package fglrx-updates. Unpacking fglrx-updates (from .../fglrx-updates_2%3a8.960-0ubuntu1.1_i386.deb) ... Selecting previously unselected package fglrx-amdcccle-updates. Unpacking fglrx-amdcccle-updates (from .../fglrx-amdcccle-updates_2%3a8.960-0ubuntu1.1_i386.deb) ... Processing triggers for man-db ... Processing triggers for ureadahead ... ureadahead will be reprofiled on next reboot dpkg: error processing libxss1 (--configure): package libxss1 is already installed and configured dpkg: error processing chromium-codecs-ffmpeg (--configure): package chromium-codecs-ffmpeg is already installed and configured dpkg: error processing chromium-browser (--configure): package chromium-browser is already installed and configured dpkg: error processing chromium-browser-l10n (--configure): package chromium-browser-l10n is already installed and configured Setting up dkms (2.2.0.3-1ubuntu3) ... No apport report written because MaxReports is reached already No apport report written because MaxReports is reached already Setting up fakeroot (1.18.2-1) ... update-alternatives: using /usr/bin/fakeroot-sysv to provide /usr/bin/fakeroot (fakeroot) in auto mode. Setting up fglrx-updates (2:8.960-0ubuntu1.1) ... update-alternatives: using /usr/lib/fglrx/ld.so.conf to provide /etc/ld.so.conf.d/i386-linux-gnu_GL.conf (i386-linux-gnu_gl_conf) in auto mode. update-alternatives: warning: skip creation of /etc/OpenCL/vendors/amdocl64.icd because associated file /usr/lib/fglrx/etc/OpenCL/vendors/amdocl64.icd (of link group i386-linux-gnu_gl_conf) doesn't exist. update-alternatives: warning: skip creation of /usr/lib32/libaticalcl.so because associated file /usr/lib32/fglrx/libaticalcl.so (of link group i386-linux-gnu_gl_conf) doesn't exist. update-alternatives: warning: skip creation of /usr/lib32/libaticalrt.so because associated file /usr/lib32/fglrx/libaticalrt.so (of link group i386-linux-gnu_gl_conf) doesn't exist. update-alternatives: using /usr/lib/fglrx/alt_ld.so.conf to provide /etc/ld.so.conf.d/x86_64-linux-gnu_GL.conf (x86_64-linux-gnu_gl_conf) in auto mode. update-initramfs: deferring update (trigger activated) Loading new fglrx-updates-8.960 DKMS files... First Installation: checking all kernels... Building only for 3.2.0-29-generic-pae Building for architecture i686 Building initial module for 3.2.0-29-generic-pae Done. fglrx_updates: Running module version sanity check. - Original module - No original module exists within this kernel - Installation - Installing to /lib/modules/3.2.0-29-generic-pae/updates/dkms/ depmod...... DKMS: install completed. update-initramfs: deferring update (trigger activated) Processing triggers for bamfdaemon ... Rebuilding /usr/share/applications/bamf.index... Setting up fglrx-amdcccle-updates (2:8.960-0ubuntu1.1) ... Processing triggers for initramfs-tools ... update-initramfs: Generating /boot/initrd.img-3.2.0-29-generic-pae Processing triggers for libc-bin ... ldconfig deferred processing now taking place Errors were encountered while processing: libxss1 chromium-codecs-ffmpeg chromium-browser chromium-browser-l10n Error in function: SystemError: E:Sub-process /usr/bin/dpkg returned an error code (1) 2012-10-03 16:18:23,590 WARNING: /sys/module/fglrx_updates/drivers does not exist, cannot rebind fglrx_updates driver 2012-10-03 16:18:43,601 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:43,601 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:43,617 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:43,617 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:54,143 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,144 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:54,154 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,154 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:54,182 DEBUG: fglrx.enabled(fglrx): target_alt /usr/lib/fglrx/ld.so.conf current_alt /usr/lib/fglrx/ld.so.conf other target alt /usr/lib/fglrx/alt_ld.so.conf other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,182 DEBUG: XorgDriverHandler(%s, %s).enabled(): No X.org driver set, not checking 2012-10-03 16:18:54,215 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,215 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:54,229 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,229 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:54,268 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,268 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:54,279 DEBUG: fglrx.enabled(fglrx_updates): target_alt None current_alt /usr/lib/fglrx/ld.so.conf other target alt None other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,279 DEBUG: fglrx_updates is not the alternative in use 2012-10-03 16:18:54,298 DEBUG: fglrx.enabled(fglrx): target_alt /usr/lib/fglrx/ld.so.conf current_alt /usr/lib/fglrx/ld.so.conf other target alt /usr/lib/fglrx/alt_ld.so.conf other current alt /usr/lib/fglrx/alt_ld.so.conf 2012-10-03 16:18:54,298 DEBUG: XorgDriverHandler(%s, %s).enabled(): No X.org driver set, not checking 2012-10-03 16:18:57,828 DEBUG: Shutting down I don't know how to troubleshoot from looking at the log file, could somebody assist me with this please? You can download the log file at: https://www.dropbox.com/s/a59d2hyabo02q5z/jockey.log

    Read the article

  • Can't update Nvidia driver and having error near the end of the installation

    - by user94843
    I had just got Ubuntu (first timer to Ubuntu so be very descriptive). I think there a problem with my Nvida update it won't let me update it. This is the name of the update in update manager NVIDIA binary xorg driver, kernel module and VDPAU library. When i attempt to install it, it starts out fine but near the end i get a window titaled package operation failed with these under the details installArchives() failed: Setting up nvidia-current (295.40-0ubuntu1) ... update-initramfs: deferring update (trigger activated) INFO:Enable nvidia-current DEBUG:Parsing /usr/share/nvidia-common/quirks/put_your_quirks_here DEBUG:Parsing /usr/share/nvidia-common/quirks/dell_latitude DEBUG:Parsing /usr/share/nvidia-common/quirks/lenovo_thinkpad DEBUG:Processing quirk Latitude E6530 DEBUG:Failure to match Gigabyte Technology Co., Ltd. with Dell Inc. DEBUG:Quirk doesn't match DEBUG:Processing quirk ThinkPad T420s DEBUG:Failure to match Gigabyte Technology Co., Ltd. with LENOVO DEBUG:Quirk doesn't match Removing old nvidia-current-295.40 DKMS files... Loading new nvidia-current-295.40 DKMS files... Error! DKMS tree already contains: nvidia-current-295.40 You cannot add the same module/version combo more than once. dpkg: error processing nvidia-current (--configure): subprocess installed post-installation script returned error exit status 3 Processing triggers for bamfdaemon ... Rebuilding /usr/share/applications/bamf.index... Processing triggers for initramfs-tools ... update-initramfs: Generating /boot/initrd.img-3.2.0-31-generic Warning: No support for locale: en_US.utf8 Errors were encountered while processing: nvidia-current Error in function: Setting up nvidia-current (295.40-0ubuntu1) ... update-initramfs: deferring update (trigger activated) INFO:Enable nvidia-current DEBUG:Parsing /usr/share/nvidia-common/quirks/put_your_quirks_here DEBUG:Parsing /usr/share/nvidia-common/quirks/dell_latitude DEBUG:Parsing /usr/share/nvidia-common/quirks/lenovo_thinkpad DEBUG:Processing quirk Latitude E6530 DEBUG:Failure to match Gigabyte Technology Co., Ltd. with Dell Inc. DEBUG:Quirk doesn't match DEBUG:Processing quirk ThinkPad T420s DEBUG:Failure to match Gigabyte Technology Co., Ltd. with LENOVO DEBUG:Quirk doesn't match Removing old nvidia-current-295.40 DKMS files... Loading new nvidia-current-295.40 DKMS files... Error! DKMS tree already contains: nvidia-current-295.40 You cannot add the same module/version combo more than once. dpkg: error processing nvidia-current (--configure): subprocess installed post-installation script returned error exit status 3 Processing triggers for bamfdaemon ... Rebuilding /usr/share/applications/bamf.index... Processing triggers for initramfs-tools ... update-initramfs: Generating /boot/initrd.img-3.2.0-31-generic Warning: No support for locale: en_US.utf8

    Read the article

  • can't update nvida having error near the end of the install

    - by user94843
    I had just got Ubuntu (first timer to Ubuntu so be very descriptive). I think there a problem with my Nvida update it won't let me update it. This is the name of the update in update manager NVIDIA binary xorg driver, kernel module and VDPAU library. When i attempt to install it, it starts out fine but near the end i get a window titaled package operation failed with these under the details installArchives() failed: Setting up nvidia-current (295.40-0ubuntu1) ... update-initramfs: deferring update (trigger activated) INFO:Enable nvidia-current DEBUG:Parsing /usr/share/nvidia-common/quirks/put_your_quirks_here DEBUG:Parsing /usr/share/nvidia-common/quirks/dell_latitude DEBUG:Parsing /usr/share/nvidia-common/quirks/lenovo_thinkpad DEBUG:Processing quirk Latitude E6530 DEBUG:Failure to match Gigabyte Technology Co., Ltd. with Dell Inc. DEBUG:Quirk doesn't match DEBUG:Processing quirk ThinkPad T420s DEBUG:Failure to match Gigabyte Technology Co., Ltd. with LENOVO DEBUG:Quirk doesn't match Removing old nvidia-current-295.40 DKMS files... Loading new nvidia-current-295.40 DKMS files... Error! DKMS tree already contains: nvidia-current-295.40 You cannot add the same module/version combo more than once. dpkg: error processing nvidia-current (--configure): subprocess installed post-installation script returned error exit status 3 Processing triggers for bamfdaemon ... Rebuilding /usr/share/applications/bamf.index... Processing triggers for initramfs-tools ... update-initramfs: Generating /boot/initrd.img-3.2.0-31-generic Warning: No support for locale: en_US.utf8 Errors were encountered while processing: nvidia-current Error in function: Setting up nvidia-current (295.40-0ubuntu1) ... update-initramfs: deferring update (trigger activated) INFO:Enable nvidia-current DEBUG:Parsing /usr/share/nvidia-common/quirks/put_your_quirks_here DEBUG:Parsing /usr/share/nvidia-common/quirks/dell_latitude DEBUG:Parsing /usr/share/nvidia-common/quirks/lenovo_thinkpad DEBUG:Processing quirk Latitude E6530 DEBUG:Failure to match Gigabyte Technology Co., Ltd. with Dell Inc. DEBUG:Quirk doesn't match DEBUG:Processing quirk ThinkPad T420s DEBUG:Failure to match Gigabyte Technology Co., Ltd. with LENOVO DEBUG:Quirk doesn't match Removing old nvidia-current-295.40 DKMS files... Loading new nvidia-current-295.40 DKMS files... Error! DKMS tree already contains: nvidia-current-295.40 You cannot add the same module/version combo more than once. dpkg: error processing nvidia-current (--configure): subprocess installed post-installation script returned error exit status 3 Processing triggers for bamfdaemon ... Rebuilding /usr/share/applications/bamf.index... Processing triggers for initramfs-tools ... update-initramfs: Generating /boot/initrd.img-3.2.0-31-generic Warning: No support for locale: en_US.utf8

    Read the article

  • Filter rule for SMS / text messages in exchange active sync (SMS sync)

    - by kynan
    Exchange server 2010 introduces SMS Sync (via exchange active sync), which works fine with my android device and the Samsung email app. However, all text messages are synced to my exchange inbox, which is a pain. I'd like to have them filtered to a specific folder. So far, I haven't figured out a useful filter rule for achieving that, since there seems to be no header indicating it's a text message. Has anyone managed to do that? Note that I'm not using Outlook as an email client, so I'm specifically looking for a server-side rule.

    Read the article

  • Mac OSX: Adobe Flash player 10.1.85.3 text issue

    - by sparkey
    Running Flash Player 10.1.85.3. on OS-X 10.6.4 I've run into a very strange issue with Adobe/Macromedia Flash. Text in dialogs sometimes is not displayed, and the containing boxes are distorted. It occurs in all browsers. This is best demonstrated on YouTube in some of their ads, as well as in Google Analytics overlays on graphs. You can see the issue here: As you can see, where I have moused over the high point, there should be a dialog with some text, but instead it is quite broken. I've tried uninstalling and reinstalling the Flash plugin several times, reinstalling Google Chrome, validating my fonts with FontBook (removed all dupes/ fonts with warnings). Also as a last resort I checked/ repaired perms on my disk. What should I do?

    Read the article

  • Windows apps keep switching to accented text

    - by Josh Kelley
    Somehow I keep hitting a shortcut key (or something similar) that enables the input of accented text. Whenever this accented text mode is enabled, pressing ' doesn't respond immediately; instead, the ' key is remembered, so if I press a vowel after that, I get the vowel with an acute accent mark, and if I press any other key, I immediately get an apostrophe followed by the other key. I don't want this to happen. It's very annoying. How do I disable this mode? I only remember seeing this in Firefox 3.6.3 and Pidgin 2.6.6, so maybe it's a GTK feature. It apparently happens on a per-application basis, and restarting the application fixes it. I checked Windows 7's "Region and Language" control panel and didn't see anything relevant (although I'm not intimately familiar with all of those settings, so I may have overlooked something).

    Read the article

  • How to color highlight text in a black/white document easily

    - by Lateron
    I am editing a 96 chapter book. The text is in normal black letters on a white background. What I want to be able to do is: I want to have any changes or additions automatically shown in another (per-selected) color. Without having to a)high lite a word or phrase to be changed or added and then b)going to the toolbar and clicking on the font color In other words I want the original color of the text to remain as it is and any additions or changes to be visible in another color without having to use the toolbar. Can this be done? I use OpenOffice or Word 2007 in Windows 7.

    Read the article

  • Text template or tool for documentation of computer configurations

    - by mjustin
    I regularly write and update technical documentation which will be used to set up a new virtual machine, or to have a lookup for system dependencies in networks with around 20-50 (server-side) computers. At the moment I use OpenOffice Writer with text tables, and create one document per intranet domain. To improve this documentation, I would like to collect some examples to identify areas where my documents can be improved, regarding general structure and content, to make it easy to read and use not only for me but also for technical staff, helpdesk etc. Are there simple text templates (for example for OpenOffice Writer) or tools (maybe database-driven) for structured documentation of a computer configuration? Such a template / tool should provide required and optional configuration sections, like 'operating system', 'installed services', 'mapped network drives', 'scheduled tasks', 'remote servers', 'logon user account', 'firewall settings', 'hard disk size' ... It is not so much low-level hardware docs but more infrastructure / integration information in these documents (no BIOS settings, MAC addresses).

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

  • Format text to 5 chars from a number

    - by Wheelersg
    In Access, I used a query to sum some numbers and appended the answer to another table(table2). Now I need to export the number as a text with 5 positions but can't seem to get it to hard code all 5 positions. I have it formatted as text, field length 5, custom foramt "00000" (also tried @@@@@). Example: 3 + 3 + 1 = 7. THen append the 7 to table2. It always shows as 7. I need it to shows as 00007.

    Read the article

  • Forcing a mixed ISO-8859-1 and UTF-8 multi-line string into UTF-8

    - by knorv
    Consider the following problem: A multi-line string $junk contains some lines which are encoded in UTF-8 and some in ISO-8859-1. I don't know a priori which lines are in which encoding, so heuristics will be needed. I want to turn $junk into pure UTF-8 with proper re-encoding of the ISO-8859-1 lines. Also, in the event of errors in the processing I want to provide a "best effort result" rather than throwing an error. My current attempt looks like this: $junk = &force_utf8($junk); sub force_utf8 { my $input = shift; my $output = ''; foreach my $line (split(/\n/, $input)) { if (utf8::valid($line)) { utf8::decode($line); } $output .= "$line\n"; } return $output; } While this appears to work I'm certain this is not the optimal solution. How would you improve my force_utf8(...) sub?

    Read the article

  • Differences between AForge and OpenCV

    - by vrish88
    Hello, I am just learning about computer vision and C#. It seems like two prominent image processing libraries are OpenCV and AForge. What are some of the differences of the two? I am making a basic image editor in C# and while researching I have come across articles on both. But I don't really know why I would choose one over the other. I would like to eventually improve the app to include more advanced functions. Thanks.

    Read the article

  • Displaying Fourier transforms in OpenCV

    - by Simonw
    Hi, I'm just learning to use OpenCV and am having a problem with using DFT. I've done a signal processing class which used MatLab, so I'm trying to go through some of the exercises we did in that class. I'm trying to get and display the FT of an image, so I can mask some of the frequencies. I'd like to be able to see the FT, so I know how big to make the mask, but when I tried, I got an image like this: rather than like one of these Am I forgetting a step somewhere? I'm loading the image, converting its type to CV_32FC1, getting the matrix of it, getting the DFT, and then getting turning the resulting matrix back into an image. I'll post the code I'm using if it will be of any help? Or if someone has a link to an example of displaying the FT? I could only find ones which used it for the convolution. EDIT: Did I get the Phase of the image?

    Read the article

  • F# performance in scientific computing

    - by aaa
    hello. I am curious as to how F# performance compares to C++ performance? I asked a similar question with regards to Java, and the impression I got was that Java is not suitable for heavy numbercrunching. I have read that F# is supposed to be more scalable and more performant, but how is this real-world performance compares to C++? specific questions about current implementation are: How well does it do floating-point? Does it allow vector instructions how friendly is it towards optimizing compilers? How big a memory foot print does it have? Does it allow fine-grained control over memory locality? does it have capacity for distributed memory processors, for example Cray? what features does it have that may be of interest to computational science where heavy number processing is involved? Are there actual scientific computing implementations that use it? Thanks

    Read the article

  • How to paint fully transparent pixels/points in P2D mode?

    - by netzwerg
    According to the Processing Reference, stroke(gray, alpha) allows to set the color and opacity of the stroke. With the default color mode, an alpha value of 255 denotes full opacity, while a value of 0 should correspond to complete transparency. While this works with the (default) JAVA2D renderer, I can't seem to paint fully transparent points in P2D mode. This code clearly renders a pixel at the center of the canvas, even though the alpha value is set to 0 (fully transparent): public class Transparency extends PApplet { @Override public void setup() { size(200, 200, P2D); } @Override public void draw() { stroke(0, 0); point(width / 2, height / 2); } public static void main(String[] args) { PApplet.main(new String[] { Transparency.class.getSimpleName() }); } } What's wrong here?

    Read the article

  • Image 8-connectivity without excessive branching?

    - by shoosh
    I'm writing a low level image processing algorithm which needs to do alot of 8-connectivity checks for pixels. For every pixel I often need to check the pixels above it, below it and on its sides and diagonals. On the edges of the image there are special cases where there are only 5 or 3 neighbors instead of 8 neighbors for a pixels. The naive way to do it is for every access to check if the coordinates are in the right range and if not, return some default value. I'm looking for a way to avoid all these checks since they introduce a large overhead to the algorithm. Are there any tricks to avoid it altogether?

    Read the article

< Previous Page | 89 90 91 92 93 94 95 96 97 98 99 100  | Next Page >