Search Results

Search found 24177 results on 968 pages for 'true'.

Page 950/968 | < Previous Page | 946 947 948 949 950 951 952 953 954 955 956 957  | Next Page >

• Optimistic non-locking copy of InnoDB .frm files

  - by jothir

  MySQL Enterprise Backup(MEB) does hot backup of innodb data and log files. Till MEB 3.6.1, the user backs up the only innodb tables in a 3 step process: STEP 1. Take backup using --only-innodb option STEP 2. Temporarily make the table read only by executing “FLUSH TABLES WITH READ LOCK” MEB 3.7.0 has an enhancement to innodb file copying. The .frm files gets copied along with the hot backup done for innodb files. I would like to make the blog a little interactive by explaining the feature as answers: 1. What are these .frm files? The files containing the metadata, such as the table definition, of a MySQL table. For backups, the full set of .frm files are always required along with the backup data, to be able to restore tables that are altered or dropped after the backup. 2. Can the .frm files not be copied by MEB itself? --only-innodb-with-frm is the new option introduced in MEB 3.7.1 to do a copy of .frm files without locking the tables during backup operation itself. This is to reduce the pain of manually copying the .frm files. The option is intended for backups where you can ensure that no ALTER TABLE, CREATE TABLE, DROP TABLE, or other DDL statements modify the .frm files for InnoDB tables during the backup operation. 3. How is data consistency ensured? MEB does validation of the .frm files after copying by comparing with the server directory to see if the timestamps of any of the .frm files is greater than the saved system time (check .frm time).  This change in timestamp of the .frm files will show if a table is altered during the process of backup. The total number of frm files in the server directory is also verified against the copied contents. If the number of .frm files is less compared to server directory, it shows that table/tables have been dropped during the process of backup. If the number of .frm files is more compared to server directory, it shows that new table/tables have been created during backup operation. 4. How does MEB handle data inconsistency? MEB copies the .frm files through several iterations,  does the validation and throws a WARNING if there is any inconsistency found in .frm files at the end of backup operation. This means the user is warned of some DDL operations that had occurred during backup operation, and has to manually copy the .frm files or do a backup again. 5. What is the option and explain its usage? The option introduced is --only-innodb-with-frm which does optimistic copy of .frm files without locking. This can be used when the user wants to backup only innodb tables along with .frm files. The option can take one of the 2 values: all | related. --only-innodb-with-frm=all does copy of all .frm files of all innodb tables. --only-innodb-with-frm=related works in conjunction with --include option.This is to allow partial backup of .frm files corresponding to the tables specified in --include. Let me show the usage with example output: ./mysqlbackup -uroot --backup-dir=/logs/backupWithFrmAll --only-innodb-with-frm=all backup MySQL Enterprise Backup version 3.7.1 [2012/06/05] Copyright (c) 2003, 2012, Oracle and/or its affiliates. All Rights Reserved. INFO: Starting with following command line ... ./mysqlbackup -uroot --backup-dir=/logs/backupWithFrmAll        --only-innodb-with-frm=all backup INFO: Got some server configuration information from running server. IMPORTANT: Please check that mysqlbackup run completes successfully.            At the end of a successful 'backup' run mysqlbackup            prints "mysqlbackup completed OK!". --------------------------------------------------------------------                       Server Repository Options: --------------------------------------------------------------------  datadir                          =  /mysql/trydb/  innodb_data_home_dir             =    innodb_data_file_path            =  ibdata1:10M:autoextend  innodb_log_group_home_dir        =  /mysql/trydb/  innodb_log_files_in_group        =  2  innodb_log_file_size             =  5242880 --------------------------------------------------------------------                       Backup Config Options: --------------------------------------------------------------------  datadir                          =  /logs/backupWithFrmAll/datadir  innodb_data_home_dir             =  /logs/backupWithFrmAll/datadir  innodb_data_file_path            =  ibdata1:10M:autoextend  innodb_log_group_home_dir        =  /logs/backupWithFrmAll/datadir  innodb_log_files_in_group        =  2  innodb_log_file_size             =  5242880 mysqlbackup: INFO: Unique generated backup id for this is 13451979804504860 mysqlbackup: INFO: Uses posix_fadvise() for performance optimization. mysqlbackup: INFO: System tablespace file format is Antelope. mysqlbackup: INFO: Found checkpoint at lsn 1656792. mysqlbackup: INFO: Starting log scan from lsn 1656320. 120817 15:36:22 mysqlbackup: INFO: Copying log... 120817 15:36:22 mysqlbackup: INFO: Log copied, lsn 1656792.          We wait 1 second before starting copying the data files... 120817 15:36:23 mysqlbackup: INFO: Copying /mysql/trydb/ibdata1 (Antelope file format). 120817 15:36:23 mysqlbackup: INFO: Copying /mysql/trydb/innodb1/table2.ibd (Antelope file format). 120817 15:36:23 mysqlbackup: INFO: Copying /mysql/trydb/innodb1/table3.ibd (Antelope file format). 120817 15:36:23 mysqlbackup: INFO: Copying /mysql/trydb/innodb1/table1.ibd (Antelope file format). mysqlbackup: INFO: Opening backup source directory '/mysql/trydb/' 120817 15:36:23 mysqlbackup: INFO: Starting to backup .frm files in the subdirectories of /mysql/trydb/ mysqlbackup: INFO: Copying innodb data and logs during final stage ... mysqlbackup: INFO: A copied database page was modified at 1656792.          (This is the highest lsn found on page)          Scanned log up to lsn 1656792.          Was able to parse the log up to lsn 1656792.          Maximum page number for a log record 0 mysqlbackup: INFO: Copying non-innodb files took 2.000 seconds 120817 15:36:25 mysqlbackup: INFO: Full backup completed! mysqlbackup: INFO: Backup created in directory '/logs/backupWithFrmAll' -------------------------------------------------------------   Parameters Summary          -------------------------------------------------------------   Start LSN                  : 1656320   End LSN                    : 1656792 ------------------------------------------------------------- mysqlbackup completed OK! bash$ ls /logs/backupWithFrmAll/datadir/innodb1/ table1.frm  table1.ibd  table2.frm  table2.ibd  table3.frm  table3.ibd Here the backup directory contains all the .frm files of all the innodb tables. ./mysqlbackup -uroot --backup-dir=/logs/backupWithFrm --include="innodb1.table3.*" --only-innodb-with-frm=related backup MySQL Enterprise Backup version 3.7.1 [2012/06/05] Copyright (c) 2003, 2012, Oracle and/or its affiliates. All Rights Reserved. INFO: Starting with following command line ... ./mysqlbackup -uroot --backup-dir=/logs/backup371frm        --include=innodb1.table3.* --only-innodb-with-frm=related backup INFO: Got some server configuration information from running server. IMPORTANT: Please check that mysqlbackup run completes successfully.            At the end of a successful 'backup' run mysqlbackup            prints "mysqlbackup completed OK!". --------------------------------------------------------------------                       Server Repository Options: --------------------------------------------------------------------  datadir                          = /mysql/trydb/  innodb_data_home_dir             =    innodb_data_file_path            =  ibdata1:10M:autoextend  innodb_log_group_home_dir        =  /mysql/trydb  innodb_log_files_in_group        =  2  innodb_log_file_size             =  5242880 --------------------------------------------------------------------                       Backup Config Options: --------------------------------------------------------------------  datadir                          =  /logs/backupWithFrm/datadir  innodb_data_home_dir             =  /logs/backupWithFrm/datadir  innodb_data_file_path            =  ibdata1:10M:autoextend  innodb_log_group_home_dir        =  /logs/backupWithFrm/datadir  innodb_log_files_in_group        =  2  innodb_log_file_size             =  5242880 mysqlbackup: INFO: Unique generated backup id for this is 13451973458118162 mysqlbackup: INFO: Uses posix_fadvise() for performance optimization. mysqlbackup: INFO: The --include option specified: innodb1.table3.* mysqlbackup: INFO: System tablespace file format is Antelope. mysqlbackup: INFO: Found checkpoint at lsn 1656792. mysqlbackup: INFO: Starting log scan from lsn 1656320. 120817 15:25:47 mysqlbackup: INFO: Copying log... 120817 15:25:47 mysqlbackup: INFO: Log copied, lsn 1656792.          We wait 1 second before starting copying the data files... 120817 15:25:48 mysqlbackup: INFO: Copying /mysql/trydbibdata1 (Antelope file format). 120817 15:25:49 mysqlbackup: INFO: Copying /mysql/trydbinnodb1/table3.ibd (Antelope file format). mysqlbackup: INFO: Opening backup source directory '/mysql/trydb' 120817 15:25:49 mysqlbackup: INFO: Starting to backup .frm files in the subdirectories of /mysql/trydb mysqlbackup: INFO: Copying innodb data and logs during final stage ... mysqlbackup: INFO: A copied database page was modified at 1656792.          (This is the highest lsn found on page)          Scanned log up to lsn 1656792.          Was able to parse the log up to lsn 1656792.          Maximum page number for a log record 0 mysqlbackup: INFO: Copying non-innodb files took 2.000 seconds 120817 15:25:51 mysqlbackup: INFO: Full backup completed! mysqlbackup: INFO: Backup created in directory '/logs/backupWithFrm' -------------------------------------------------------------   Parameters Summary          -------------------------------------------------------------   Start LSN                  : 1656320   End LSN                    : 1656792 ------------------------------------------------------------- mysqlbackup completed OK! bash$ ls /logs/backupWithFrm/datadir/innodb1/ table3.frm table3.ibd Thus the backup directory contains only the .frm file matching the innodb table name specified in --include option. In a nutshell, we present our great new option --only-innodb-with-frm which is a true hot InnoDB-only backup with .frm files, but with an additional check, if any DDL happened during the backup. If a DDL has happened, the DBA can decide if to repeat the backup, or to live with the potential inconsistency. This is the ideal solution for users that have all their "real" data in InnoDB and seldom change their schemas. You may also like: http://dev.mysql.com/doc/mysql-enterprise-backup/3.7/en/backup-partial-options.html   STEP 3. Manually copy the .frm files of innodb tables to the destination directory where backup is stored.

  Read the article

• does log4net AdoNetAppender support sql server 2008?

  - by schrodinger's code

  my config file below: very strange, i have spent a day to find out where i am wrong, but still not working, it still not log anything in the database,but i can output them using RollingFileAppender. Also, the store procedure WriteLog is working well.(I have tested it using sql server studio). I have tried to change the connectionType but not working. Unfortunately I dont have sql server 2000/2005 to test, my log4net version should be the latest one: log4net 1.2.10. Any help is appreciated. <?xml version="1.0" encoding="utf-8"?> <configuration> <configSections> <section name="log4net" type="log4net.Config.Log4NetConfigurationSectionHandler, log4net" /> </configSections> <log4net> <appender name="AdoNetAppender_SqlServer" type="log4net.Appender.AdoNetAppender"> <!--<threshold value="OFF" />--> <bufferSize value="1" /> <connectionType value="System.Data.SqlClient.SqlConnection, System.Data, System.Data, Version=2.0.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089" /> <!--<connectionType value="System.Data.SqlClient.SqlConnection, System.Data, Version=1.0.3300.0, Culture=neutral, PublicKeyToken=b77a5c561934e089" />--> <connectionString value="Data Source=.\MSSQLSERVER2008,2222;Initial Catalog=UnleashedSaaS;User ID=sa;Password=dogblack;" /> <commandType value="StoredProcedure" /> <commandText value="WriteLog" /> <parameter> <parameterName value="@log_date" /> <dbType value="DateTime" /> <layout type="log4net.Layout.PatternLayout" value="%date{yyyy'-'MM'-'dd HH':'mm':'ss'.'fff}" /> </parameter> <parameter> <parameterName value="@thread" /> <dbType value="String" /> <size value="255" /> <layout type="log4net.Layout.PatternLayout" value="%thread" /> </parameter> <parameter> <parameterName value="@log_level" /> <dbType value="String" /> <size value="50" /> <layout type="log4net.Layout.PatternLayout" value="%level" /> </parameter> <parameter> <parameterName value="@logger" /> <dbType value="String" /> <size value="255" /> <layout type="log4net.Layout.PatternLayout" value="%logger" /> </parameter> <parameter> <parameterName value="@message" /> <dbType value="String" /> <size value="4000" /> <layout type="log4net.Layout.PatternLayout" value="%message" /> </parameter> <parameter> <parameterName value="@exception" /> <dbType value="String" /> <size value="4000" /> <layout type="log4net.Layout.ExceptionLayout" /> </parameter> </appender> <appender name="RollingLogFileAppender" type="log4net.Appender.RollingFileAppender" > <!--<threshold value="OFF" />--> <file value="LogData\\" /> <appendToFile value="true" /> <datePattern value="ul_yyyy-MM-dd.LOG" /> <maxSizeRollBackups value="10" /> <rollingStyle value="Date" /> <maximumFileSize value="2MB" /> <staticLogFileName value="false" /> <layout type="log4net.Layout.PatternLayout"> <param name="ConversionPattern" value="%d{yyyy-MM-dd HH:mm:ss} %p %u %c %l %m %n%n%n" /> </layout> </appender> <root> <level value="ALL"/> <appender-ref ref="AdoNetAppender_SqlServer" /> <appender-ref ref="RollingLogFileAppender" /> </root> </log4net> </configuration>

  Read the article

• Help with MVC controller: passing a string from view to controller

  - by 109221793

  Hi guys, I'm having trouble with one particular issue, I was hoping someone could help me out. I've completed the MVC Music Store tutorial, and now I'm trying to add some administrator functionality - practice as I will have to do this in an MVC application in my job. The application is using the aspnet membership api, and what I have done so far is created a view to list the users. What I want to be able to do, is click on the users name in order to change their password. To try and carry the username to the changeUserPassword controller (custom made). I registered a new route in the global.asax.cs file in order to display the username in the URL, which is working so far. UserList View <%: Html.RouteLink(user.UserName, "AdminPassword", new { controller="StoreManager", action="changeUserPassword", username = user.UserName }) %> Global.asax.cs routes.MapRoute( "AdminPassword", //Route name "{controller}/{action}/{username}", //URL with parameters new { controller = "StoreManager", action = "changeUserPassword", username = UrlParameter.Optional} ); So now the URL looks like this when I reach the changeUserPassword view: http://localhost:51236/StoreManager/changeUserPassword/Administrator Here is the GET changeUserPassword action: public ActionResult changeUserPassword(string username) { ViewData["username"] = username; return View(); } I wanted to store the username in ViewData as I would like to use it in the GET changeUserPassword for display purposes, and also as a hidden value in the form. This is in order to pass it through to enable me to reset the password. Having debugged through the code, it seems that 'username' is null. How can I get this to work so that the username carries over from the Html.RouteLink, to the changeUserPassword action? Any help would be appreciated :) Here is my complete code: UserList.aspx <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage<System.Web.Security.MembershipUserCollection>" %> <asp:Content ID="Content1" ContentPlaceHolderID="TitleContent" runat="server"> UserList </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="MainContent" runat="server"> <h2>UserList</h2> <table> <tr> <th>User Name</th> <th>Last Activity date</th> <th>Locked Out</th> </tr> <%foreach (MembershipUser user in Model){ %> <tr> <td><%: Html.RouteLink(user.UserName, "AdminPassword", new { controller="StoreManager", action="changeUserPassword", username = user.UserName }) %></td> <td><%: user.LastActivityDate %></td> <td><%: user.IsLockedOut %></td> </tr> <% }%> </table> </asp:Content> changeUserPassword.aspx <%@ Page Title="" Language="C#" MasterPageFile="~/Views/Shared/Site.Master" Inherits="System.Web.Mvc.ViewPage<musicStoreMVC.ViewModels.ResetPasswordAdmin>" %> <asp:Content ID="Content1" ContentPlaceHolderID="TitleContent" runat="server"> changeUserPassword </asp:Content> <asp:Content ID="Content2" ContentPlaceHolderID="MainContent" runat="server"> <h2>Change Password: <%: ViewData["username"] %></h2> <% using (Html.BeginForm()) {%> <%: Html.ValidationSummary(true) %> <fieldset> <legend>Fields</legend> <div class="editor-label"> <%: Html.Hidden("username",ViewData["username"]) %> <%: Html.LabelFor(model => model.password) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.password) %> <%: Html.ValidationMessageFor(model => model.password) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.confirmPassword) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.confirmPassword) %> <%: Html.ValidationMessageFor(model => model.confirmPassword) %> </div> <p> <input type="submit" value="Create" /> </p> </fieldset> <% } %> <div> <%: Html.ActionLink("Back to List", "Index") %> </div> </asp:Content> My actions public ActionResult UserList() { var users = Membership.GetAllUsers(); return View(users); } public ActionResult changeUserPassword(string username) { ViewData["username"] = username; return View(); }

  Read the article

• Session caching problem

  - by Levani

  I have a strange problem with php sessions. I use them for authorization on my site. I store two variables - currently logged in user's id and username in session. When I log in with one username, than log out and log in again with another username the previous user's id is returned using the session variable instead of the current user. The most strange thing is that this happens only when it comes to insert some data into database. When I directly echo this variable the correct id is displayed, but when I insert new record into database this variable sends incorrect id. Here is the php code I use for sending data into database: <?php session_start(); //connect database require_once 'dbc.php'; $authorID = $_SESSION['user_id']; if ( $authorID != 0 ) { $content = htmlentities($_POST["answ_content"],ENT_COMPAT,'UTF-8'); $dro = date('Y-m-d H:i:s'); $qID = $_POST["question_ID"]; $author = 'avtori'; $sql="INSERT INTO comments (comment_ID, comment_post_ID, comment_author, comment_date, comment_content, user_id) VALUES (NULL, '$qID', '$author', '$dro', '$content', '$authorID')"; $result = mysql_query($sql); } else { echo 'error'; } ?> Can anyone please help? Here is the logout function: function logout() { global $db; session_start(); if(isset($_SESSION['user_id']) || isset($_COOKIE['user_id'])) { mysql_query("update `users` set `ckey`= '', `ctime`= '' where `id`='$_SESSION[user_id]' OR `id` = '$_COOKIE[user_id]'") or die(mysql_error()); } /************ Delete the sessions****************/ unset($_SESSION['user_id']); unset($_SESSION['user_name']); unset($_SESSION['user_level']); unset($_SESSION['HTTP_USER_AGENT']); session_unset(); session_destroy(); /* Delete the cookies*******************/ setcookie("user_id", '', time()-60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_name", '', time()-60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_key", '', time()-60*60*24*COOKIE_TIME_OUT, "/"); header("Location: index.php"); } Here is the authentication script: include 'dbc.php'; $err = array(); foreach($_GET as $key => $value) { $get[$key] = filter($value); //get variables are filtered. } if ($_POST['doLogin']=='Login') { foreach($_POST as $key => $value) { $data[$key] = filter($value); // post variables are filtered } $user_email = $data['usr_email']; $pass = $data['pwd']; if (strpos($user_email,'@') === false) { $user_cond = "user_name='$user_email'"; } else { $user_cond = "user_email='$user_email'"; } $result = mysql_query("SELECT `id`,`pwd`,`full_name`,`approved`,`user_level` FROM users WHERE $user_cond AND `banned` = '0' ") or die (mysql_error()); $num = mysql_num_rows($result); // Match row found with more than 1 results - the user is authenticated. if ( $num > 0 ) { list($id,$pwd,$full_name,$approved,$user_level) = mysql_fetch_row($result); if(!$approved) { //$msg = urlencode("Account not activated. Please check your email for activation code"); $err[] = "Account not activated. Please check your email for activation code"; //header("Location: login.php?msg=$msg"); //exit(); } //check against salt if ($pwd === PwdHash($pass,substr($pwd,0,9))) { // this sets session and logs user in session_start(); session_regenerate_id (true); //prevent against session fixation attacks. // this sets variables in the session $_SESSION['user_id']= $id; $_SESSION['user_name'] = $full_name; $_SESSION['user_level'] = $user_level; $_SESSION['HTTP_USER_AGENT'] = md5($_SERVER['HTTP_USER_AGENT']); //update the timestamp and key for cookie $stamp = time(); $ckey = GenKey(); mysql_query("update users set `ctime`='$stamp', `ckey` = '$ckey' where id='$id'") or die(mysql_error()); //set a cookie if(isset($_POST['remember'])){ setcookie("user_id", $_SESSION['user_id'], time()+60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_key", sha1($ckey), time()+60*60*24*COOKIE_TIME_OUT, "/"); setcookie("user_name",$_SESSION['user_name'], time()+60*60*24*COOKIE_TIME_OUT, "/"); } if(empty($err)){ header("Location: myaccount.php"); } } else { //$msg = urlencode("Invalid Login. Please try again with correct user email and password. "); $err[] = "Invalid Login. Please try again with correct user email and password."; //header("Location: login.php?msg=$msg"); } } else { $err[] = "Error - Invalid login. No such user exists"; } }

  Read the article

• ForEach with EditorFor

  - by hermiod

  I have got an Entity model which contains a collection of Message objects which are of the type Message which has several properties, including content, MessageID, from, and to. I have created an EditorTemplate for type Message, however, I cannot get it to display the contents of the Messages collection. There are no errors, but nothing is output. Please note that the view code is from an EditorTemplate for the parent Talkback class. Can you have an EditorTemplate calling another EditorTemplate for a child collection? Both the Talkback and Message class are generated by Entity framework from an existing database. View code: <% foreach (TalkbackEntityTest.Message msg in Model.Messages) { Html.EditorFor(x=> msg, "Message"); } %> This is my template code. It is the standard auto-generated view code with some minor changes. <%@ Control Language="C#" Inherits="System.Web.Mvc.ViewUserControl<TalkbackEntityTest.Message>" %> <%: Html.ValidationSummary(true) %> <fieldset> <legend>Fields</legend> <div class="editor-label"> <%: Html.LabelFor(model => model.MessageID) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.MessageID) %> <%: Html.ValidationMessageFor(model => model.MessageID) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.acad_period) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.acad_period) %> <%: Html.ValidationMessageFor(model => model.acad_period) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.talkback_id) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.talkback_id) %> <%: Html.ValidationMessageFor(model => model.talkback_id) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.From) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.From) %> <%: Html.ValidationMessageFor(model => model.From) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.To) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.To) %> <%: Html.ValidationMessageFor(model => model.To) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.SentDatetime) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.SentDatetime, String.Format("{0:g}", Model.SentDatetime)) %> <%: Html.ValidationMessageFor(model => model.SentDatetime) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.content) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.content) %> <%: Html.ValidationMessageFor(model => model.content) %> </div> <div class="editor-label"> <%: Html.LabelFor(model => model.MessageTypeID) %> </div> <div class="editor-field"> <%: Html.TextBoxFor(model => model.MessageTypeID) %> <%: Html.ValidationMessageFor(model => model.MessageTypeID) %> </div> <p> <input type="submit" value="Save" /> </p> </fieldset> There is definitely content in the Message collection as, if I remove EditorFor and put in response.write on the content property of the Message class, I get the content field for 3 Message objects on the page, which is exactly as expected.

  Read the article

• Getting a NullPointerException at seemingly random intervals, not sure why

  - by Miles

  I'm running an example from a Kinect library for Processing (http://www.shiffman.net/2010/11/14/kinect-and-processing/) and sometimes get a NullPointerException pointing to this line: int rawDepth = depth[offset]; The depth array is created in this line: int[] depth = kinect.getRawDepth(); I'm not exactly sure what a NullPointerException is, and much googling hasn't really helped. It seems odd to me that the code compiles 70% of the time and returns the error unpredictably. Could the hardware itself be affecting it? Here's the whole example if it helps: // Daniel Shiffman // Kinect Point Cloud example // http://www.shiffman.net // https://github.com/shiffman/libfreenect/tree/master/wrappers/java/processing import org.openkinect.*; import org.openkinect.processing.*; // Kinect Library object Kinect kinect; float a = 0; // Size of kinect image int w = 640; int h = 480; // We'll use a lookup table so that we don't have to repeat the math over and over float[] depthLookUp = new float[2048]; void setup() { size(800,600,P3D); kinect = new Kinect(this); kinect.start(); kinect.enableDepth(true); // We don't need the grayscale image in this example // so this makes it more efficient kinect.processDepthImage(false); // Lookup table for all possible depth values (0 - 2047) for (int i = 0; i < depthLookUp.length; i++) { depthLookUp[i] = rawDepthToMeters(i); } } void draw() { background(0); fill(255); textMode(SCREEN); text("Kinect FR: " + (int)kinect.getDepthFPS() + "\nProcessing FR: " + (int)frameRate,10,16); // Get the raw depth as array of integers int[] depth = kinect.getRawDepth(); // We're just going to calculate and draw every 4th pixel (equivalent of 160x120) int skip = 4; // Translate and rotate translate(width/2,height/2,-50); rotateY(a); for(int x=0; x<w; x+=skip) { for(int y=0; y<h; y+=skip) { int offset = x+y*w; // Convert kinect data to world xyz coordinate int rawDepth = depth[offset]; PVector v = depthToWorld(x,y,rawDepth); stroke(255); pushMatrix(); // Scale up by 200 float factor = 200; translate(v.x*factor,v.y*factor,factor-v.z*factor); // Draw a point point(0,0); popMatrix(); } } // Rotate a += 0.015f; } // These functions come from: http://graphics.stanford.edu/~mdfisher/Kinect.html float rawDepthToMeters(int depthValue) { if (depthValue < 2047) { return (float)(1.0 / ((double)(depthValue) * -0.0030711016 + 3.3309495161)); } return 0.0f; } PVector depthToWorld(int x, int y, int depthValue) { final double fx_d = 1.0 / 5.9421434211923247e+02; final double fy_d = 1.0 / 5.9104053696870778e+02; final double cx_d = 3.3930780975300314e+02; final double cy_d = 2.4273913761751615e+02; PVector result = new PVector(); double depth = depthLookUp[depthValue];//rawDepthToMeters(depthValue); result.x = (float)((x - cx_d) * depth * fx_d); result.y = (float)((y - cy_d) * depth * fy_d); result.z = (float)(depth); return result; } void stop() { kinect.quit(); super.stop(); } And here are the errors: processing.app.debug.RunnerException: NullPointerException at processing.app.Sketch.placeException(Sketch.java:1543) at processing.app.debug.Runner.findException(Runner.java:583) at processing.app.debug.Runner.reportException(Runner.java:558) at processing.app.debug.Runner.exception(Runner.java:498) at processing.app.debug.EventThread.exceptionEvent(EventThread.java:367) at processing.app.debug.EventThread.handleEvent(EventThread.java:255) at processing.app.debug.EventThread.run(EventThread.java:89) Exception in thread "Animation Thread" java.lang.NullPointerException at org.openkinect.processing.Kinect.enableDepth(Kinect.java:70) at PointCloud.setup(PointCloud.java:48) at processing.core.PApplet.handleDraw(PApplet.java:1583) at processing.core.PApplet.run(PApplet.java:1503) at java.lang.Thread.run(Thread.java:637)

  Read the article

• jQuery Form Processing With PHP to MYSQL Database Using $.ajax Request

  - by FrustratedUser

  Question: How can I process a form using jQuery and the $.ajax request so that the data is passed to a script which writes it to a database? Problem: I have a simple email signup form that when processed, adds the email along with the current date to a table in a MySQL database. Processing the form without jQuery works as intended, adding the email and date. With jQuery, the form submits successfully and returns the success message. However, no data is added to the database. Any insight would be greatly appreciated! <!-- PROCESS.PHP --> <?php // DB info $dbhost = '#'; $dbuser = '#'; $dbpass = '#'; $dbname = '#'; // Open connection to db $conn = mysql_connect($dbhost, $dbuser, $dbpass) or die ('Error connecting to mysql'); mysql_select_db($dbname); // Form variables $email = $_POST['email']; $submitted = $_POST['submitted']; // Clean up function cleanData($str) { $str = trim($str); $str = strip_tags($str); $str = strtolower($str); return $str; } $email = cleanData($email); $error = ""; if(isset($submitted)) { if($email == '') { $error .= '<p class="error">Please enter your email address.</p>' . "\n"; } else if (!eregi("^[A-Z0-9._%-]+@[A-Z0-9._%-]+\.[A-Z]{2,4}$", $email)) { $error .= '<p class="error">Please enter a valid email address.</p>' . "\n"; } if(!$error){ echo '<p id="signup-success-nojs">You have successfully subscribed!</p>'; // Add to database $add_email = "INSERT INTO subscribers (email,date) VALUES ('$email',CURDATE())"; mysql_query($add_email) or die(mysql_error()); }else{ echo $error; } } ?> <!-- SAMPLE.PHP --> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Sample</title> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.2.6/jquery.min.js"></script> <script type="text/javascript"> $(document).ready(function(){ // Email Signup $("form#newsletter").submit(function() { var dataStr = $("#newsletter").serialize(); alert(dataStr); $.ajax({ type: "POST", url: "process.php", data: dataStr, success: function(del){ $('form#newsletter').hide(); $('#signup-success').fadeIn(); } }); return false; }); }); </script> <style type="text/css"> #email { margin-right:2px; padding:5px; width:145px; border-top:1px solid #ccc; border-left:1px solid #ccc; border-right:1px solid #eee; border-bottom:1px solid #eee; font-size:14px; color:#9e9e9e; } #signup-success { margin-bottom:20px; padding-bottom:10px; background:url(../img/css/divider-dots.gif) repeat-x 0 100%; display:none; } #signup-success p, #signup-success-nojs { padding:5px; background:#fff; border:1px solid #dedede; text-align:center; font-weight:bold; color:#3d7da5; } </style> </head> <body> <?php include('process.php'); ?> <form id="newsletter" class="divider" name="newsletter" method="post" action=""> <fieldset> <input id="email" type="text" name="email" /> <input id="submit-button" type="image" src="<?php echo $base_url; ?>/assets/img/css/signup.gif" alt=" SIGNUP " /> <input id="submitted" type="hidden" name="submitted" value="true" /> </fieldset> </form> <div id="signup-success"><p>You have successfully subscribed!</p></div> </body> </html>

  Read the article

• parentNode.parentNode.rowindex to delete a row in a dynamic table

  - by billy85

  I am creating my rows dynamically when the user clicks on "Ajouter". <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <script> function getXhr(){ var xhr = null; if(window.XMLHttpRequest) // Firefox and others xhr = new XMLHttpRequest(); else if(window.ActiveXObject){ // Internet Explorer try { xhr = new ActiveXObject("Msxml2.XMLHTTP"); } catch (e) { xhr = new ActiveXObject("Microsoft.XMLHTTP"); } } else { // XMLHttpRequest not supported by your browser alert("Votre navigateur ne supporte pas les objets XMLHTTPRequest..."); xhr = false; } return xhr } /** * method called when the user clicks on the button */ function go(){ var xhr = getXhr() // We defined what we gonna do with the response xhr.onreadystatechange = function(){ // We do somthing once the server's response is OK if(xhr.readyState == 4 && xhr.status == 200){ //alert(xhr.responseText); var body = document.getElementsByTagName("body")[0]; // Retrieve <table> ID and create a <tbody> element var tbl = document.getElementById("table"); var tblBody = document.createElement("tbody"); var row = document.createElement("tr"); // Create <td> elements and a text node, make the text // node the contents of the <td>, and put the <td> at // the end of the table row var cell_1 = document.createElement("td"); var cell_2 = document.createElement("td"); var cell_3 = document.createElement("td"); var cell_4 = document.createElement("td"); // Create the first cell which is a text zone var cell1=document.createElement("input"); cell1.type="text"; cell1.name="fname"; cell1.size="20"; cell1.maxlength="50"; cell_1.appendChild(cell1); // Create the second cell which is a text area var cell2=document.createElement("textarea"); cell2.name="fdescription"; cell2.rows="2"; cell2.cols="30"; cell_2.appendChild(cell2); var cell3 = document.createElement("div"); cell3.innerHTML=xhr.responseText; cell_3.appendChild(cell3); // Create the fourth cell which is a href var cell4 = document.createElement("a"); cell4.appendChild(document.createTextNode("[Delete]")); cell4.setAttribute("href","javascrit:deleteRow();"); cell_4.appendChild(cell4); // add cells to the row row.appendChild(cell_1); row.appendChild(cell_2); row.appendChild(cell_3); row.appendChild(cell_4); // add the row to the end of the table body tblBody.appendChild(row); // put the <tbody> in the <table> tbl.appendChild(tblBody); // appends <table> into <body> body.appendChild(tbl); // sets the border attribute of tbl to 2; tbl.setAttribute("border", "1"); } } xhr.open("GET","fstatus.php",true); xhr.send(null); } </head> <body > <h1> Create an Item </h1> <form method="post"> <table align="center" border = "2" cellspacing ="0" cellpadding="3" id="table"> <tr><td><b>Functionality Name:</b></td> <td><b>Description:</b></td> <td><b>Status:</b></td> <td><input type="button" Name= "Ajouter" Value="Ajouter" onclick="go()"></td></tr> </table> </form> </body> </html> Now, I would like to use the href [Delete] to delete one particular row. I wrote this: <script type="text/javascript"> function deleteRow(r){ var i=r.parentNode.parentNode.rowIndex; document.getElementById('table').deleteRow(i); } </script> When I change the first code like this: cell4.setAttribute("href","javascrit:deleteRow(this);"); I got an error: The page cannot be displayed. I am redirected to a new pagewhich can not be displayed. How could I delete my row by using the function deleteRow(r)? table is the id of my table Thanks. Billy85

  Read the article

• CodePlex Daily Summary for Thursday, May 15, 2014

  CodePlex Daily Summary for Thursday, May 15, 2014Popular ReleasesVisualizers: Visualizer: This dll is the core of the project just copy and paste it in the following folder %Microsoft Visual Studio%\Common7\Packages\Debugger\Visualizers where %Microsoft Visual Studio% is the Visual studio installation folderQuickMon: Version 3.10: Adding the ability to see 'history' of Collector states (including details of errors or warnings at that time). The history size is configurable (default is switched off) and the Windows Service completely ignores keeping history (no UI or user to access it anyway). The Collector stats window now displays this history plus multiple collector stats windows can be opened at the same time. Additionally fixed a bug in the event log collector that reported an 'Error' state when an 'out of bounds' ...xFunc: xFunc 2.15.4: Fixed bug in Processor.csTFS Planning and Disaster Recovery Avoidance Guide: v1.4.BETA - TFS, DR and Azure IaaS Planning Guides: Welcome to the TFS Planning and DR Avoidance Guidance What is new? A new crisper, more compact style, which is easier to consume on multiple devices without sacrificing any content. Also included are the new TFS on Azure IaaS guide and supplementary guides. Note Capacity planning workbook and posters are included in the Everything Zip package. Quality-Bar Detail Documentation has been reviewed by Visual Studio ALM Rangers Documentation has been through an independent technical review ...WinAudit: WinAudit Freeware v3.0: WinAudit.exe v3.0 MD5: 88750CCF49FF7418199B2645755830FA Known Issues: 1. Report creation can be very slow when right-to-left (Hebrew) characters are present. 2. Emsisoft Anti-Malware may stop and/or quarantine WinAudit. This happens when WinAudit attempts to obtain a list if running programmes. You will need to set an exception rule in Emsisoft to allow WinAudit to run.MVCwCMS - ASP.NET MVC CMS: MVCwCMS 2.2.2: Updated CKFinder config. For the installation instructions visit the documentation page: https://mvcwcms.codeplex.com/documentationTerraMap (Terraria World Map Viewer): TerraMap 1.0.4: Added support for the new Terraria v1.2.4 update. New items, walls, and tiles Fixed Issue 35206: Hightlight/Find doesn't work for Demon Altars Fixed finding Demon Hearts/Shadow Orbs Added ability to find Enchanted Swords (in the stone) and Water Bolt books Fixed installer not uninstalling older versions The setup file will make sure .NET 4 is installed, install TerraMap, create desktop and start menu shortcuts, add a .wld file association, and launch TerraMap. If you prefer the zip ...WPF Localization Extension: v2.2.1: Issue #9277 Issue #9292 Issue #9311 Issue #9312 Issue #9313 Issue #9314CtrlAltStudio Viewer: CtrlAltStudio Viewer 1.2.1.41167 Release: This release of the CtrlAltStudio Viewer includes the following significant features: Oculus Rift support. Stereoscopic 3D display support. Variable walking / flying speed. Xbox 360 Controller support. Kinect for Windows support. Based on Firestorm viewer 4.6.5 codebase. For more details, see the release notes linked to below. Release notes: http://ctrlaltstudio.com/viewer/release-notes/1-2-1-41167-release Support info: http://ctrlaltstudio.com/viewer/support Privacy policy: http:/...ExtJS based ASP.NET Controls: FineUI v4.0.6: FineUI（???） ?? ExtJS ??? ASP.NET ??? FineUI??? ?? No JavaScript，No CSS，No UpdatePanel，No ViewState，No WebServices ??????? ?????? IE 8.0+、Chrome、Firefox、Opera、Safari ???? Apache License v2.0 ?：ExtJS ?? GPL v3 ?????(http://www.sencha.com/license) ???? ??：http://fineui.com/ ??：http://fineui.com/bbs/ ??：http://fineui.com/demo/ ??：http://fineui.com/doc/ ??：http://fineui.codeplex.com/ FineUI ???? ExtJS ????????，???? ExtJS ?，?????： 1. ????? FineUI ? ExtJS ? http://fineui.com/bbs/forum.ph...Office App Model Samples: Office App Model Samples v2.0: Office App Model Samples v2.0Readable Passphrase Generator: KeePass Plugin 0.13.0: Version 0.13.0 Added "mutators" which add uppercase and numbers to passphrases (to help complying with upper, lower, number complexity rules). Additional API methods which help consuming the generator from 3rd party c# projects. 13,160 words in the default dictionary (~600 more than previous release).CS-Script for Notepad++ (C# intellisense and code execution): Release v1.0.25.0: Release v1.0.25.0 MemberInfo/MethodInfo popup is now positioned properly to fit the screen In MethodInfo popup method signatures are word-wrapped Implemented Debug text value visualizer Pining sub-values from Watch PanelWrapper for the PAYMILL API: Paymill API Wrapper: Add Description in PreauthorizationHow to develop an autodialer / predictive dialer in C#: VoIP AutoDialer in C Sharp: This is the downloadable source code for this example project that is intended to help you in developing your own VoIP autodialer application in C#.R.NET: R.NET 1.5.12: R.NET 1.5.12 is a beta release towards R.NET 1.6. You are encouraged to use 1.5.12 now and give feedback. See the documentation for setup and usage instructions. Main changes for R.NET 1.5.12: The C stack limit was not disabled on Windows. For reasons possibly peculiar to R, this means that non-concurrent access to R from multiple threads was not stable. This is now fixed, with the fix validated with a unit test. Thanks to Odugen, skyguy94, and previously others (evolvedmicrobe, tomasp) fo...SEToolbox: SEToolbox 01.029.006 Release 1: Fix to allow keyboard search on load dialog. (type the first few letters of your save) Fixed check for new release. Changed the way ship details are loaded to alleviate load time for worlds with very large ships (100,000+ blocks). Fixed Image importer, was incorrectly listing 'Asteroid' as import option. Minor changes to menus (text and appearance) for clarity and OS consistency. Added in reading of world palette for color dialog editor. WIP on subsystem editor. Can now multiselec...Thaumcraft4 Research: Alpha 2 release, lots of awesome improvements: Performance inprovements asynchronous running of the search Search result-cap ( usefull for long routes, it wont try to find 3000 results ) statistics addedTiny Wifi Host: Tiny Wifi Host 3.0.0.0: Tiny Wifi Hotspot Creator (Portable) v3 size: 50KB-140KB New Features: Friendly name for connected devices instead of Mac-Address (Double click selected device to enter friendly name) Saves device names to devices.xml Better error reporting+solutions Warning sound when number of connected devices exceed a certain number. (useful when only certain number of devices must be connected at a time) Many Bug Fixes. NoAudio files does not include connect, disconnect and warning audio to dec...Media Companion: Media Companion MC3.597b: Thank you for being patient, againThere are a number of fixes in place with this release. and some new features added. Most are self explanatory, so check out the options in Preferences. Couple of new Features:* Movie - Allow save Title and Sort Title in Title Case format. * Movie - Allow save fanart.jpg if movie in folder. * TV - display episode source. Get episode source from episode filename. Fixed:* Movie - Added Fill Tags from plot keywords to Batch Rescraper. * Movie - Fixed TMDB s...New ProjectsBLADE View Engine - An independent RAZOR alternative: An alternative parser and view engine to Asp.net Razor that does not depend on Asp.net or .NET 4.5BPL++: A basic object orientated programming language built upon a virtual machine using C#Caedisi - A Cellular Automata Editor and Simulator for Network Decontamination: A research tool that explores the use of cellular automata in order to decontaminate a network attacked or infected by a virus. Cosmos Software Distrobution 1.0: No content until project released!ETCQuality: ETC QUALITY STAT SYSTEM. ????????????，??????????????。F.A.Q.: F.A.Q. project about Frequently asked questions. Help Viewer Redirector: Enables use of Help Viewer 2.0 or 2.1 with SQL Server instead of Help Viewer 1.0Jet.Payment.Cielo: Projeto contém integração com o serviço e-commerce Cielo, desenvolvido em C#. Criamos esse Helper para nossa própria necessidade. Nos ajude a melhorá-lo.Learning with Pati: Learning Javascript with PatiLeRenard: LeRenard is a collection of solutions (from core helper, extension methods) to libraries, all written in C# to help build applications.MCMP.NET: MCMP.NET allows ASP.NET applications to be added as contexts using mod_cluster.PowerShell Deployment Automation Framework: This project contains resources related to my blog at www.powershellcoach.compravda-f: ??????????? ? ?????? ??? ?????????? ??????sdir: Colorful, sorted and optionally rich directory enumeration for Windows.SienSchoofsProject: school project for .NET ExpertSorting collection of any type by several fields: Sorting collection of any type by several fields with using Reflection and Expression TreesTPS BarCode Scanner: This is going to be a collaboration platform for TPS team. We want to develop a simple low cost bar code generator and scanner system. This project is currentlVerifyDomainOutlookAddIn: ??????????????????????????????。Ynote Packages: Ynote Packages are a collection of tools which a play a crucial role in extending Ynote Classic and understanding it's true potential.??????-??????【??】??????????: ??????????????????,???、???!???????,????????????????,????????????,???! ?????-?????【??】?????????: ????????????、?????、?????、?????、?????、????,???????????,?????,??????！ ?????-?????【??】?????????: ???????????????,?????????????? ??。??????????、????、????、?????????? ???????。 ??????-??????【??】??????????: ????????????????????,?????,???????,???????????,??????! ??????-??????【??】??????????: ??????????????、??????、????、?????、?????!????,????????????????!????。 ?????-?????【??】?????????: ???????????????????,?????????????????????,?????,????,???????. ?????-?????【??】?????????: ???????????????????、????????、????????、????????、???????,????????????。 ??????-??????【??】??????????: ????????????????、?????、?????、????、?????,??????????。????????????????! ??????-??????【??】??????????: ???????????????????????:????、????、??????????????,????????。????????! ????-????【??】????????: ?????????????????????,????????????,?????、??、????,?????,??????！ ?????-?????【??】?????????: ???????????????????,??????????,????????、????,??????????,??????????。 ?????-?????【??】?????????: ???????,??????:?????,?????,??????,??????????,????????。????????! ????: ????????，????????????????????????，?????????，????????????????。????????????????????，??????????????，?????????????。 ????????????，?： 　　?????？ 　　?????？ 　　???????？ 　　??????-??????【??】??????????: ??????????????????????,???????????????,????????????????????! ??????-??????【??】??????????: ??????????????????、????,??100%????,??????,????????????,???????????! ????-????【??】????????: ???????????、??????????????????,????????,?????,??????,????,????,????! ?????-?????【??】?????????: ????????????????,??????????、??????,??????????、????、????、???????。 ?????--?????【??】?????????: ?????????????????????,???????????????,???????,?????,?????,????? !!!

  Read the article

• Email php isn't working, please help?

  - by laurence-benson

  Hey Guys, My email code isn't working, can anyone help? Thanks. <?php if(isset($_POST['send'])){ $to = "[email protected]" ; // change all the following to $_POST $from = $_REQUEST['Email'] ; $name = $_REQUEST['Name'] ; $headers = "From: $from"; $subject = "Web Contact Data"; $fields = array(); $fields{"Name"} = "Name"; $fields{"Email"} = "Email"; $body = "We have received the following information:\n\n"; foreach($fields as $a => $b){ $body .= sprintf("%20s: %s\n",$b,$_REQUEST[$a]); } $subject2 = "Thank you for contacting us."; $autoreply = "<html><body><p>Dear " . $name . ",</p><p>Thank you for registering with ERB Images.</p> <p>To make sure that you continue to receive our email communications, we suggest that you add [email protected] to your address book or Safe Senders list. </p> <p>In Microsoft Outlook, for example, you can add us to your address book by right clicking our address in the 'From' area above and selecting 'Add to Outlook Contacts' in the list that appears.</p> <p>We look forward to you visiting the site, and can assure you that your privacy will continue to be respected at all times.</p><p>Yours sincerely.</p><p>Edward R Benson</p><p>Edward Benson Esq.<br />Founder<br />ERB Images</p><p>www.erbimages.com</p></body></html>"; $headers2 = 'MIME-Version: 1.0' . "\r\n"; $headers2 .= 'Content-type: text/html; charset=iso-8859-1' . "\r\n"; $headers2 .= 'From: [email protected]' . "\r\n"; mail($from, $subject2, $autoreply, $headers2); $send=false; if($name == '') {$error= "You did not enter your name, please try again.";} else { if(!preg_match("/^[[:alnum:]][a-z0-9_.'+-]*@[a-z0-9-]+(\.[a-z0-9-]{2,})+$/",$from)) {$error= "You did not enter a valid email address, please try again.";} else { $send = mail($to, $subject, $body, $headers); $send2 = mail($from, $subject2, $autoreply, $headers2); } if(!isset($error) && !$send) $error= "We have encountered an error sending your mail, please notify [email protected]"; } }// end of if(isset($_POST['send'])) ?> <?php include("http://erbimages.com/php/doctype/index.php"); ?> <?php include("http://erbimages.com/php/head/index.php"); ?> <div class="newsletter"> <ul> <form method="post" action="http://lilyandbenson.com/newletter/index.php"> <li> <input size="20" maxlength="50" name="Name" value="Name" onfocus="if(this.value==this.defaultValue) this.value='';" onblur="if(this.value=='') this.value=this.defaultValue;"> </li> <li> <input size="20" maxlength="50" name="Email" value="Email" onfocus="if(this.value==this.defaultValue) this.value='';" onblur="if(this.value=='') this.value=this.defaultValue;"> </li> <li> <input type="submit" name="send" value="Send" id="register_send"> </li> </form> <?php ?> </ul> <div class="clear"></div> </div> <div class="section_error"> <?php if(isset($error)) echo '<span id="section_error">'.$error.'</span>'; if(isset($send) && $send== true){ echo 'Thank you, your message has been sent.'; } if(!isset($_POST['send']) || isset($error)) ?> <div class="clear"></div> </div> </body> </html>

  Read the article

• Need help on Coda slider tabs to move inside an overflow:hidden div

  - by Reden

  I'm not too good at javascript. and hope I can get a bit of help. I'm using Coda Slider 2.0, and have designed it to where the tabs are another slider to the right of the main slider, and each item. Basically like this mootools plugin http://landofcoder.com/demo/mootool/lofslidernews/index2.1.html Problem is the items will not scroll. How do I make the items (or tabs to the right) scroll down as the slider rotates? Otherwise the slider will show the 4th slide but not scroll to the 4th item on the right, but Thanks everyone. Here is the Coda-Slider plugin: // when the DOM is ready... $(document).ready(function () { var $panels = $('#slider .scrollContainer > div'); var $container = $('#slider .scrollContainer'); // if false, we'll float all the panels left and fix the width // of the container var horizontal = true; // float the panels left if we're going horizontal if (horizontal) { $panels.css({ 'float' : 'left', 'position' : 'relative' // IE fix to ensure overflow is hidden }); // calculate a new width for the container (so it holds all panels) $container.css('width', $panels[0].offsetWidth * $panels.length); } // collect the scroll object, at the same time apply the hidden overflow // to remove the default scrollbars that will appear var $scroll = $('#slider .scroll').css('overflow', 'hidden'); // apply our left + right buttons $scroll .before('<img class="scrollButtons left" src="images/scroll_left.png" />') .after('<img class="scrollButtons right" src="images/scroll_right.png" />'); // handle nav selection function selectNav() { $(this) .parents('ul:first') .find('a') .removeClass('selected') .end() .end() .addClass('selected'); } $('#slider .navigation').find('a').click(selectNav); // go find the navigation link that has this target and select the nav function trigger(data) { var el = $('#slider .navigation').find('a[href$="' + data.id + '"]').get(0); selectNav.call(el); } if (window.location.hash) { trigger({ id : window.location.hash.substr(1) }); } else { $('ul.navigation a:first').click(); } // offset is used to move to *exactly* the right place, since I'm using // padding on my example, I need to subtract the amount of padding to // the offset. Try removing this to get a good idea of the effect var offset = parseInt((horizontal ? $container.css('paddingTop') : $container.css('paddingLeft')) || 0) * -1; var scrollOptions = { target: $scroll, // the element that has the overflow // can be a selector which will be relative to the target items: $panels, navigation: '.navigation a', // selectors are NOT relative to document, i.e. make sure they're unique prev: 'img.left', next: 'img.right', // allow the scroll effect to run both directions axis: 'xy', onAfter: trigger, // our final callback offset: offset, // duration of the sliding effect duration: 500, // easing - can be used with the easing plugin: // http://gsgd.co.uk/sandbox/jquery/easing/ easing: 'swing' }; // apply serialScroll to the slider - we chose this plugin because it // supports// the indexed next and previous scroll along with hooking // in to our navigation. $('#slider').serialScroll(scrollOptions); // now apply localScroll to hook any other arbitrary links to trigger // the effect $.localScroll(scrollOptions); // finally, if the URL has a hash, move the slider in to position, // setting the duration to 1 because I don't want it to scroll in the // very first page load. We don't always need this, but it ensures // the positioning is absolutely spot on when the pages loads. scrollOptions.duration = 1; $.localScroll.hash(scrollOptions); /////////////////////////////////////////////// // autoscroll /////////////////////////////////////////////// // start to automatically cycle the tabs cycleTimer = setInterval(function () { $scroll.trigger('next'); }, 2000); // how many milliseconds, change this to whatever you like // select some trigger elements to stop the auto-cycle var $stopTriggers = $('#slider .navigation').find('a') // tab headers .add('.scroll') // panel itself .add('.stopscroll') // links to the stop class div .add('.navigation') // links to navigation id for tabs .add("a[href^='#']"); // links to a tab // this is the function that will stop the auto-cycle function stopCycle() { // remove the no longer needed stop triggers clearInterval(cycleTimer); // stop the auto-cycle itself $buttons.show(); // show the navigation buttons document.getElementById('stopscroll').style.display='none'; // hide the stop div document.getElementById('startscroll').style.display='block'; // block the start div } // bind stop cycle function to the click event using namespaces $stopTriggers.bind('click.cycle', stopCycle); /////////////////////////////////////////////// // end autoscroll /////////////////////////////////////////////// // edit to start again /////////////////////////////////////////////// // select some trigger elements to stop the auto-cycle var $startTriggers_start = $('#slider .navigation').find('a') // tab headers .add('.startscroll'); // links to the start class div // this is the function that will stop the auto-cycle function startCycle() { // remove the no longer needed stop triggers $buttons.hide(); // show the navigation buttons $scroll.trigger('next'); // directly to the next first cycleTimer = setInterval(function () { // now set timer again $scroll.trigger('next'); }, 5000); // how many milliseconds, change this to whatever you like document.getElementById('stopscroll').style.display='block'; // block the stop div document.getElementById('startscroll').style.display='none'; // hide the start div } // bind stop cycle function to the click event using namespaces $startTriggers_start.bind('click.cycle', startCycle); /////////////////////////////////////////////// // end edit to start /////////////////////////////////////////////// });

  Read the article

• Spritebatch drawing sprite with jagged borders

  - by Mutoh

  Alright, I've been on the making of a sprite class and a sprite sheet manager, but have come across this problem. Pretty much, the project is acting like so; for example: Let's take this .png image, with a transparent background. Note how it has alpha-transparent pixels around it in the lineart. Now, in the latter link's image, in the left (with CornflowerBlue background) it is shown the image drawn in another project (let's call it "Project1") with a simpler sprite class - there, it works. The right (with Purple background for differentiating) shows it drawn with a different class in "Project2" - where the problem manifests itself. This is the Sprite class of Project1: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace WindowsGame2 { class Sprite { Vector2 pos = new Vector2(0, 0); Texture2D image; Rectangle size; float scale = 1.0f; // --- public float X { get { return pos.X; } set { pos.X = value; } } public float Y { get { return pos.Y; } set { pos.Y = value; } } public float Width { get { return size.Width; } } public float Height { get { return size.Height; } } public float Scale { get { return scale; } set { if (value < 0) value = 0; scale = value; if (image != null) { size.Width = (int)(image.Width * scale); size.Height = (int)(image.Height * scale); } } } // --- public void Load(ContentManager Man, string filename) { image = Man.Load<Texture2D>(filename); size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Become(Texture2D frame) { image = frame; size = new Rectangle( 0, 0, (int)(image.Width * scale), (int)(image.Height * scale) ); } public void Draw(SpriteBatch Desenhista) { // Desenhista.Draw(image, pos, Color.White); Desenhista.Draw( image, pos, new Rectangle( 0, 0, image.Width, image.Height ), Color.White, 0.0f, Vector2.Zero, scale, SpriteEffects.None, 0 ); } } } And this is the code in Project2, a rewritten, pretty much, version of the previous class. In this one I added sprite sheet managing and, in particular, removed Load and Become, to allow for static resources and only actual Sprites to be instantiated. using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { // Actually, I might desconsider this, and instead use static AnimationLocation[] and instanciated ID and Frame; // For determining the starting frame of an animation in a sheet and being able to iterate through // the Rectangles vector of the Sheet; class AnimationLocation { public int Location; public int FrameCount; // --- public AnimationLocation(int StartingRow, int StartingColumn, int SheetWidth, int NumberOfFrames) { Location = (StartingRow * SheetWidth) + StartingColumn; FrameCount = NumberOfFrames; } public AnimationLocation(int PositionInSheet, int NumberOfFrames) { Location = PositionInSheet; FrameCount = NumberOfFrames; } public static int CalculatePosition(int StartingRow, int StartingColumn, SheetManager Sheet) { return ((StartingRow * Sheet.Width) + StartingColumn); } } class Sprite { // The general stuff; protected SheetManager Sheet; protected Vector2 Position; public Vector2 Axis; protected Color _Tint; public float Angle; public float Scale; protected SpriteEffects _Effect; // --- // protected AnimationManager Animation; // For managing the animations; protected AnimationLocation[] Animation; public int AnimationID; protected int Frame; // --- // Properties for easy accessing of the position of the sprite; public float X { get { return Position.X; } set { Position.X = Axis.X + value; } } public float Y { get { return Position.Y; } set { Position.Y = Axis.Y + value; } } // --- // Properties for knowing the size of the sprite's frames public float Width { get { return Sheet.FrameWidth * Scale; } } public float Height { get { return Sheet.FrameHeight * Scale; } } // --- // Properties for more stuff; public Color Tint { set { _Tint = value; } } public SpriteEffects Effect { set { _Effect = value; } } public int FrameID { get { return Frame; } set { if (value >= (Animation[AnimationID].FrameCount)) value = 0; Frame = value; } } // --- // The only things that will be constantly modified will be AnimationID and FrameID, anything else only // occasionally; public Sprite(SheetManager SpriteSheet, AnimationLocation[] Animations, Vector2 Location, Nullable<Vector2> Origin = null) { // Assign the sprite's sprite sheet; // (Passed by reference! To allow STATIC sheets!) Sheet = SpriteSheet; // Define the animations that the sprite has available; // (Passed by reference! To allow STATIC animation boundaries!) Animation = Animations; // Defaulting some numerical values; Angle = 0.0f; Scale = 1.0f; _Tint = Color.White; _Effect = SpriteEffects.None; // If the user wants a default Axis, it is set in the middle of the frame; if (Origin != null) Axis = Origin.Value; else Axis = new Vector2( Sheet.FrameWidth / 2, Sheet.FrameHeight / 2 ); // Now that we have the axis, we can set the position with no worries; X = Location.X; Y = Location.Y; } // Simply put, draw the sprite with all its characteristics; public void Draw(SpriteBatch Drafter) { Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f ); } } } And, in any case, this is the SheetManager class found in the previous code: using System; using System.Collections.Generic; using System.Linq; using System.Text; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.Graphics; namespace Mobby_s_Adventure { class SheetManager { protected Texture2D SpriteSheet; // For storing the sprite sheet; // Number of rows and frames in each row in the SpriteSheet; protected int NumberOfRows; protected int NumberOfColumns; // Size of a single frame; protected int _FrameWidth; protected int _FrameHeight; public Rectangle[] Rectangles; // For storing each frame; // --- public int Width { get { return NumberOfColumns; } } public int Height { get { return NumberOfRows; } } // --- public int FrameWidth { get { return _FrameWidth; } } public int FrameHeight { get { return _FrameHeight; } } // --- public Texture2D Texture { get { return SpriteSheet; } } // --- public SheetManager (Texture2D Texture, int Rows, int FramesInEachRow) { // Normal assigning SpriteSheet = Texture; NumberOfRows = Rows; NumberOfColumns = FramesInEachRow; _FrameHeight = Texture.Height / NumberOfRows; _FrameWidth = Texture.Width / NumberOfColumns; // Framing everything Rectangles = new Rectangle[NumberOfRows * NumberOfColumns]; int ID = 0; for (int i = 0; i < NumberOfRows; i++) { for (int j = 0; j < NumberOfColumns; j++) { Rectangles[ID] = new Rectangle ( _FrameWidth * j, _FrameHeight * i, _FrameWidth, _FrameHeight ); ID++; } } } public SheetManager (Texture2D Texture, int NumberOfFrames): this(Texture, 1, NumberOfFrames) { } } } For even more comprehending, if needed, here is how the main code looks like (it's just messing with the class' capacities, nothing actually; the result is a disembodied feet walking in place animation on the top-left of the screen and a static axe nearby): using System; using System.Collections.Generic; using System.Linq; using Microsoft.Xna.Framework; using Microsoft.Xna.Framework.Audio; using Microsoft.Xna.Framework.Content; using Microsoft.Xna.Framework.GamerServices; using Microsoft.Xna.Framework.Graphics; using Microsoft.Xna.Framework.Input; using Microsoft.Xna.Framework.Media; using System.Threading; namespace Mobby_s_Adventure { /// <summary> /// This is the main type for your game /// </summary> public class Game1 : Microsoft.Xna.Framework.Game { GraphicsDeviceManager graphics; SpriteBatch spriteBatch; static List<Sprite> ToDraw; static Texture2D AxeSheet; static Texture2D FeetSheet; static SheetManager Axe; static Sprite Jojora; static AnimationLocation[] Hack = new AnimationLocation[1]; static SheetManager Feet; static Sprite Mutoh; static AnimationLocation[] FeetAnimations = new AnimationLocation[2]; public Game1() { graphics = new GraphicsDeviceManager(this); Content.RootDirectory = "Content"; this.TargetElapsedTime = TimeSpan.FromMilliseconds(100); this.IsFixedTimeStep = true; } /// <summary> /// Allows the game to perform any initialization it needs to before starting to run. /// This is where it can query for any required services and load any non-graphic /// related content. Calling base.Initialize will enumerate through any components /// and initialize them as well. /// </summary> protected override void Initialize() { // TODO: Add your initialization logic here base.Initialize(); } /// <summary> /// LoadContent will be called once per game and is the place to load /// all of your content. /// </summary> protected override void LoadContent() { // Create a new SpriteBatch, which can be used to draw textures. spriteBatch = new SpriteBatch(GraphicsDevice); // Loading logic ToDraw = new List<Sprite>(); AxeSheet = Content.Load<Texture2D>("Sheet"); FeetSheet = Content.Load<Texture2D>("Feet Sheet"); Axe = new SheetManager(AxeSheet, 1); Hack[0] = new AnimationLocation(0, 1); Jojora = new Sprite(Axe, Hack, new Vector2(100, 100), new Vector2(5, 55)); Jojora.AnimationID = 0; Jojora.FrameID = 0; Feet = new SheetManager(FeetSheet, 8); FeetAnimations[0] = new AnimationLocation(1, 7); FeetAnimations[1] = new AnimationLocation(0, 1); Mutoh = new Sprite(Feet, FeetAnimations, new Vector2(0, 0)); Mutoh.AnimationID = 0; Mutoh.FrameID = 0; } /// <summary> /// UnloadContent will be called once per game and is the place to unload /// all content. /// </summary> protected override void UnloadContent() { // TODO: Unload any non ContentManager content here } /// <summary> /// Allows the game to run logic such as updating the world, /// checking for collisions, gathering input, and playing audio. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Update(GameTime gameTime) { // Allows the game to exit if (GamePad.GetState(PlayerIndex.One).Buttons.Back == ButtonState.Pressed) this.Exit(); // Update logic Mutoh.FrameID++; ToDraw.Add(Mutoh); ToDraw.Add(Jojora); base.Update(gameTime); } /// <summary> /// This is called when the game should draw itself. /// </summary> /// <param name="gameTime">Provides a snapshot of timing values.</param> protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } spriteBatch.Draw(Content.Load<Texture2D>("Sheet"), new Rectangle(50, 50, 55, 60), Color.White); spriteBatch.End(); base.Draw(gameTime); } } } Please help me find out what I'm overlooking! One thing that I have noticed and could aid is that, if inserted the equivalent of this code spriteBatch.Draw( Content.Load<Texture2D>("Image Location"), new Rectangle(X, Y, images width, height), Color.White ); in Project2's Draw(GameTime) of the main loop, it works. EDIT Ok, even if the matter remains unsolved, I have made some more progress! As you see, I managed to get the two kinds of rendering in the same project (the aforementioned Project2, with the more complex Sprite class). This was achieved by adding the following code to Draw(GameTime): protected override void Draw(GameTime gameTime) { GraphicsDevice.Clear(Color.Purple); // Drawing logic spriteBatch.Begin(); foreach (Sprite Element in ToDraw) { Element.Draw(spriteBatch); } // Starting here spriteBatch.Draw( Axe.Texture, new Vector2(65, 100), new Rectangle ( 0, 0, Axe.FrameWidth, Axe.FrameHeight ), Color.White, 0.0f, new Vector2(0, 0), 1.0f, SpriteEffects.None, 0.0f ); // Ending here spriteBatch.End(); base.Draw(gameTime); } (Supposing that Axe is the SheetManager containing the texture, sorry if the "jargons" of my code confuse you :s) Thus, I have noticed that the problem is within the Sprite class. But I only get more clueless, because even after modifying its Draw function to this: public void Draw(SpriteBatch Drafter) { /*Drafter.Draw( Sheet.Texture, Position, Sheet.Rectangles[Animation[AnimationID].Location + FrameID], // Find the rectangle which frames the wanted image; _Tint, Angle, Axis, Scale, _Effect, 0.0f );*/ Drafter.Draw( Sheet.Texture, Position, new Rectangle( 0, 0, Sheet.FrameWidth, Sheet.FrameHeight ), Color.White, 0.0f, Vector2.Zero, Scale, SpriteEffects.None, 0 ); } to make it as simple as the patch of code that works, it still draws the sprite jaggedly!

  Read the article

• Windows store apps: ScrollViewer with dinamic content

  - by Alexandru Circus

  I have a scrollViewer with an ItemsControl (which holds rows with data) as content. The data from these rows is grabbed from the server so I want to display a ProgressRing with a text until the data arrives. Basically I want the content of the ScrollViewer to be a grid with progress ring and a text and after the data arrives the content to be changed with my ItemsControl. The problem is that the ScrollViewer does not accept more than 1 element as content. Please tell me how can I solve this problem. (I'm a C# beginner) <FlipView x:Name="OptionPagesFlipView" Grid.Row="1" TabNavigation="Cycle" SelectionChanged="OptionPagesFlipView_SelectionChanged" ItemsSource="{Binding OptionsPageItems}"> <FlipView.ItemTemplate> <DataTemplate x:Name="OptionMonthPageTemplate"> <ScrollViewer x:Name="OptionsScrollViewer" HorizontalScrollMode="Disabled" HorizontalAlignment="Stretch" VerticalScrollBarVisibility="Auto"> <ItemsControl x:Name="OptionItemsControl" ItemsSource="{Binding OptionItems, Mode=OneWay}" Visibility="Collapsed"> <ItemsControl.ItemTemplate> <DataTemplate x:Name="OptionsChainItemTemplate"> <Grid x:Name="OptionItemGrid" Background="#FF9DBDF7" HorizontalAlignment="Stretch"> <Grid.RowDefinitions> <RowDefinition Height="Auto"/> <RowDefinition Height="Auto"/> <RowDefinition Height="Auto"/> <RowDefinition Height="Auto"/> </Grid.RowDefinitions> <Grid.ColumnDefinitions> <ColumnDefinition Width="*" /> <ColumnDefinition Width="*" /> <ColumnDefinition Width="*" /> <ColumnDefinition Width="*" /> <ColumnDefinition Width="*" /> </Grid.ColumnDefinitions> <!-- CALL BID --> <TextBlock Text="Bid" Foreground="Gray" HorizontalAlignment="Left" Grid.Row="0" Grid.Column="0" FontSize="18" Margin="5,0,5,0"/> <TextBlock x:Name="CallBidTextBlock" Text="{Binding CallBid}" Foreground="Blue" HorizontalAlignment="Left" Grid.Row="1" Grid.Column="0" Margin="5,0,5,5" FontSize="18"/> <!-- CALL ASK --> <TextBlock Text="Ask" Foreground="Gray" HorizontalAlignment="Left" Grid.Row="2" Grid.Column="0" FontSize="18" Margin="5,0,5,0"/> <TextBlock x:Name="CallAskTextBlock" Text="{Binding CallAsk}" Foreground="Blue" HorizontalAlignment="Left" Grid.Row="3" Grid.Column="0" Margin="5,0,5,0" FontSize="18"/> <!-- CALL LAST --> <TextBlock Text="Last" Foreground="Gray" HorizontalAlignment="Left" Grid.Row="0" Grid.Column="1" FontSize="18" Margin="5,0,5,0"/> <TextBlock x:Name="CallLastTextBlock" Text="{Binding CallLast}" Foreground="Blue" HorizontalAlignment="Left" Grid.Row="1" Grid.Column="1" Margin="5,0,5,5" FontSize="18"/> <!-- CALL NET CHANGE --> <TextBlock Text="Net Ch" Foreground="Gray" HorizontalAlignment="Left" Grid.Row="2" Grid.Column="1" FontSize="18" Margin="5,0,5,0"/> <TextBlock x:Name="CallNetChTextBlock" Text="{Binding CallNetChange}" Foreground="{Binding CallNetChangeForeground}" HorizontalAlignment="Left" Grid.Row="3" Grid.Column="1" Margin="5,0,5,5" FontSize="18"/> <!-- STRIKE --> <TextBlock Text="Strike" Foreground="Gray" HorizontalAlignment="Center" Grid.Row="1" Grid.Column="2" FontSize="18" Margin="5,0,5,0"/> <Border Background="{Binding StrikeBackground}" HorizontalAlignment="Center" Grid.Row="2" Grid.Column="2" Margin="5,0,5,5"> <TextBlock x:Name="StrikeTextBlock" Text="{Binding Strike}" Foreground="Blue" FontSize="18"/> </Border> <!-- PUT LAST --> <TextBlock Text="Last" Foreground="Gray" HorizontalAlignment="Right" Grid.Row="0" Grid.Column="3" FontSize="18" Margin="5,0,5,0"/> <TextBlock x:Name="PutLastTextBlock" Text="{Binding PutLast}" Foreground="Blue" HorizontalAlignment="Right" Grid.Row="1" Grid.Column="3" Margin="5,0,5,5" FontSize="18"/> <!-- PUT NET CHANGE --> <TextBlock Text="Net Ch" Foreground="Gray" HorizontalAlignment="Right" Grid.Row="2" Grid.Column="3" FontSize="18" Margin="5,0,5,0"/> <TextBlock x:Name="PutNetChangeTextBlock" Text="{Binding PutNetChange}" Foreground="{Binding PutNetChangeForeground}" HorizontalAlignment="Right" Grid.Row="3" Grid.Column="3" Margin="5,0,5,5" FontSize="18"/> <!-- PUT BID --> <TextBlock Text="Bid" Foreground="Gray" HorizontalAlignment="Right" Grid.Row="0" Grid.Column="4" FontSize="18" Margin="5,0,15,0"/> <TextBlock x:Name="PutBidTextBlock" Text="{Binding PutBid}" Foreground="Blue" HorizontalAlignment="Right" Grid.Row="1" Grid.Column="4" Margin="5,0,15,5" FontSize="18"/> <!-- PUT ASK --> <TextBlock Text="Ask" Foreground="Gray" HorizontalAlignment="Right" Grid.Row="2" Grid.Column="4" FontSize="18" Margin="5,0,15,0"/> <TextBlock x:Name="PutAskTextBlock" Text="{Binding PutAsk}" Foreground="Blue" HorizontalAlignment="Right" Grid.Row="3" Grid.Column="4" Margin="5,0,15,5" FontSize="18"/> <!-- BOTTOM LINE SEPARATOR--> <Rectangle Fill="Black" Height="1" Grid.ColumnSpan="5" VerticalAlignment="Bottom" Grid.Row="3"/> </Grid> </DataTemplate> </ItemsControl.ItemTemplate> </ItemsControl> <!--<Grid> <Grid.RowDefinitions> <RowDefinition/> </Grid.RowDefinitions> <Grid.ColumnDefinitions> <ColumnDefinition/> <ColumnDefinition/> </Grid.ColumnDefinitions> <ProgressRing x:Name="CustomProgressRing" Height="40" Width="40" IsActive="true" Grid.Column="0" Margin="20" Foreground="White"/> <TextBlock x:Name="CustomTextBlock" Height="auto" Width="auto" FontSize="25" Grid.Column="1" Margin="20"/> <Border BorderBrush="#FFFFFF" BorderThickness="1" Grid.ColumnSpan="2"/> </Grid>--> </ScrollViewer> </DataTemplate> </FlipView.ItemTemplate>

  Read the article

• winForms Booking Class Help

  - by cameron

  Hi, I am using C# Windows Forms in visual studio with different classes performing different functions in my program. I have a "Program" main class with the following information: static class Program { /// <summary> /// The main entry point for the application. /// </summary> [STAThread] static void Main() { Application.EnableVisualStyles(); Application.SetCompatibleTextRenderingDefault(false); Application.Run(new Form1()); } } and a Screen class with the following information class Screen { public List<Show> shows { get; private set; } public int ScreenNumber { get; private set; } public Screen(int screenNumber, params Show[] schedule) { this.ScreenNumber = screenNumber; this.shows = schedule.ToList<Show>(); } } and a Seat class with the following information public class Seat { private string name; public bool IsAvailable { get; set; } public decimal Price { get; private set; } public int Number { get; private set; } public Seat(bool isAvailable, int number) { this.IsAvailable = isAvailable; this.name = String.Format("Seat {0}",number); this.Price = 7.50m; this.Number = number; } public override string ToString() { return this.name; } } and finally a Show class with the following information public class Show { private List<Seat> seats = new List<Seat>(); public string Title { get; private set; } public string Time { get; private set; } public int ScreenNumber { get; private set; } public List<Seat> Seats { get { return this.seats; } } public Show(string title, DateTime time, int screenNumber, int numberOfSeats) { this.Title = title; this.Time = time.ToShortTimeString(); this.ScreenNumber = screenNumber; this.initSeats(numberOfSeats); } private void initSeats(int numberOfSeats) { for (int i = 0; i < numberOfSeats; i++) this.seats.Add(new Seat(true, i + 1)); } }` these all feed into two different winForms to create a booking system for shows. therefore i need to collate the data given in program and output it into a txt file. any help will be much appreciated NOTE: the code for FORM1 which allows the user to select which show they want is: namespace CindysSeats { public partial class Form1 : Form { private Cinema cinema = new Cinema(); //booked show could be added to booking object when you create it so that it is easily writable to the external file private Show selectedShow; public Form1() { InitializeComponent(); this.showList_dg.DataSource = this.cinema.GetShowList(); } private void showList_dg_RowHeaderMouseClick(object sender, DataGridViewCellMouseEventArgs e) { Show selectedShow = this.selectedShow = this.cinema.GetShowList()[e.RowIndex]; this.showTitle_lbl.Text = selectedShow.Title; this.showTime_lbl.Text = selectedShow.Time; this.showScreen_lbl.Text = selectedShow.ScreenNumber.ToString(); } private void confirmShow_btn_Click(object sender, EventArgs e) { if (this.selectedShow == null) return; Form2 seats = new Form2(this.selectedShow); seats.Show(); } And the code for FORM2 which is where the user selects their seats they want is: namespace CindysSeats { public partial class Form2 : Form { //booked seats could be added to booking object when you create it so that it is easily writable to the external file private List<Seat> bookedSeats = new List<Seat>(); private Show selectedShow; public Form2(Show selectedShow) { InitializeComponent(); this.selectedShow = selectedShow; this.showSeats_dg.DataSource = this.selectedShow.Seats; } private void showSeats_dg_RowHeaderMouseClick(object sender, DataGridViewCellMouseEventArgs e) { Seat selectedSeat = this.selectedShow.Seats[e.RowIndex]; if(this.bookedSeats.Contains(selectedSeat)) return; if(!selectedSeat.IsAvailable) return; this.bookedSeats.Add(selectedSeat); this.bookedSeats_lv.Items.Add(selectedSeat.ToString() + " " + selectedSeat.Price.ToString()+"\n"); this.bookedSeats_lv.Invalidate(); } private void bookSeats_btn_Click(object sender, EventArgs e) { } } thank you for helping

  Read the article

• LevelToVisibilityConverter in silverligt 4

  - by prince23

  <UserControl x:Class="SLGridImage.MainPage" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" mc:Ignorable="d" d:DesignHeight="300" d:DesignWidth="400" xmlns:sdk="http://schemas.microsoft.com/winfx/2006/xaml/presentation/sdk"> <UserControl.Resources> <local:LevelToVisibilityConverter x:Key="LevelToVisibility" /> </UserControl.Resources> <Grid x:Name="LayoutRoot" Background="White"> <sdk:DataGrid x:Name="dgMarks" CanUserResizeColumns="False" SelectionMode="Single" AutoGenerateColumns="False" VerticalAlignment="Top" ItemsSource="{Binding MarkCollection}" IsReadOnly="True" Margin="13,44,0,0" RowDetailsVisibilityMode="Collapsed" Height="391" HorizontalAlignment="Left" Width="965" VerticalScrollBarVisibility="Visible" > <sdk:DataGrid.Columns> <sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate> <Button x:Name="myButton" Click="myButton_Click"> <StackPanel Orientation="Horizontal"> <Image Margin="2, 2, 2, 2" x:Name="imgMarks" Stretch="Fill" Width="12" Height="12" Source="Images/test.png" VerticalAlignment="Center" HorizontalAlignment="Center" Visibility="{Binding Level, Converter={StaticResource LevelToVisibility}}" /> <TextBlock Text="{Binding Level}" TextWrapping="NoWrap" ></TextBlock> </StackPanel> </Button> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="Name" > <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate > <Border> <TextBlock Text="{Binding Name}" /> </Border> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> <sdk:DataGridTemplateColumn Header="Marks" Width="80"> <sdk:DataGridTemplateColumn.CellTemplate> <DataTemplate> <Border> <TextBlock Text="{Binding Marks}" /> </Border> </DataTemplate> </sdk:DataGridTemplateColumn.CellTemplate> </sdk:DataGridTemplateColumn> </sdk:DataGrid.Columns> </sdk:DataGrid> </Grid> </UserControl> in .cs using System; using System.Collections.Generic; using System.Linq; using System.Net; using System.Windows; using System.Windows.Controls; using System.Windows.Documents; using System.Windows.Input; using System.Windows.Media; using System.Windows.Media.Animation; using System.Windows.Shapes; using System.Collections.ObjectModel; using System.ComponentModel; namespace SLGridImage { public partial class MainPage : UserControl { private MarksViewModel model = new MarksViewModel(); public MainPage() { InitializeComponent(); this.DataContext = model; } private void myButton_Click(object sender, RoutedEventArgs e) { } } public class MarksViewModel : INotifyPropertyChanged { public MarksViewModel() { markCollection.Add(new Mark() { Name = "ABC", Marks = 23, Level = 0 }); markCollection.Add(new Mark() { Name = "XYZ", Marks = 67, Level = 1 }); markCollection.Add(new Mark() { Name = "YU", Marks = 56, Level = 0 }); markCollection.Add(new Mark() { Name = "AAA", Marks = 89, Level = 1 }); } private ObservableCollection<Mark> markCollection = new ObservableCollection<Mark>(); public ObservableCollection<Mark> MarkCollection { get { return this.markCollection; } set { this.markCollection = value; OnPropertyChanged("MarkCollection"); } } public event PropertyChangedEventHandler PropertyChanged; public void OnPropertyChanged(string propName) { if (PropertyChanged != null) this.PropertyChanged(this, new PropertyChangedEventArgs(propName)); } } public class Mark { public string Name { get; set; } public int Marks { get; set; } public int Level { get; set; } } public class LevelToVisibilityConverter : System.Windows.Data.IValueConverter { #region IValueConverter Members public object Convert(object value, Type targetType, object parameter, System.Globalization.CultureInfo culture) { Visibility isVisible = Visibility.Collapsed; if ((value == null)) return isVisible; int condition = (int)value; isVisible = condition == 1 ? Visibility.Visible : Visibility.Collapsed; return isVisible; } public object ConvertBack(object value, Type targetType, object parameter, System.Globalization.CultureInfo culture) { throw new NotImplementedException(); } #endregion } } when i run getting error The type 'local:LevelToVisibilityConverter' was not found. Verify that you are not missing an assembly reference and that all referenced assemblies have been built. what i am i missing here looking forward for an solution thank you

  Read the article

• Arraylist is null; I cannot access books in the arraylist

  - by user3701380

  I am a beginner-intermediate java programmer and I am getting a null pointer exception from my arraylist. I am writing a bookstore program for APCS and when i add the book, it is supposed to add to the arraylist in the inventory class. But when i call a method to search for a book (e.g. by title), it shows that there isn't anything in the arraylist. //Here is my inventory class -- it has all methods for adding the book or searching for one The searching methods are in getBookByTitle, getBookByAuthor, and getBookByISBN and the method for adding a book is addBook package webbazonab; //Inventory Class //Bharath Senthil //Ansh Sikka import java.util.ArrayList; public class Inventory{ private ArrayList<Book> allBooks = new ArrayList<Book>(); private String bookTitles; private String bookAuthors; private String bookPrices; private String bookCopies; private String ISBNs; public Inventory() { } //@param double price, int copies, String bookTitle, String Author, String isbnNumber public void addBooks(Book addedBook){ allBooks.add(addedBook); } public boolean isAvailable(){ for(Book myBook : allBooks){ if(myBook.copiesLeft() == 0) return false; } return true; } public String populateTitle(){ for (Book titleBooks : allBooks){ bookTitles = titleBooks.getTitle() + "\n"; return bookTitles; } return bookTitles; } public String populateAuthor(){ for(Book authorBooks : allBooks){ bookAuthors = authorBooks.getAuthor() + "\n"; return bookAuthors; } return bookAuthors; } public String populatePrice(){ for (Book pricedBooks : allBooks){ bookPrices = String.valueOf(pricedBooks.getPrice()) + "\n"; } return "$" + bookPrices; } /** * * @return */ public String populateCopies(){ for (Book amtBooks : allBooks){ bookCopies = String.valueOf(amtBooks.copiesLeft()) + "\n"; return bookCopies; } return bookCopies; } public String populateISBN(){ for (Book isbnNums : allBooks){ ISBNs = isbnNums.getIsbn() + "\n"; return ISBNs; } return ISBNs; } @SuppressWarnings("empty-statement") public Book getBookByTitle(String titleSearch) { for(Book titleBook : allBooks) { if (titleBook.getTitle().equals(titleSearch)) { return titleBook; } } return null; } public Book getBookByISBN(String isbnSearch){ for(Book isbnBookSearches : allBooks){ if(isbnBookSearches.getIsbn().equals(isbnSearch)){ return isbnBookSearches; } } return null; } public Book getBookByAuthor(String authorSearch){ for(Book authorBookSearches : allBooks){ if(authorBookSearches.getAuthor().equals(authorSearch)){ return authorBookSearches; } } return null; } public void sort(){ for(int i = 0; i < allBooks.size(); i++) { for(int k = 0; k < allBooks.size(); k++) { if(((Book) allBooks.get(i)).getIsbn().compareTo(((Book) allBooks.get(k)).getIsbn()) < 1) { Book temp = (Book) allBooks.get(k); allBooks.set(k, allBooks.get(i)); allBooks.set(i, temp); } else if(((Book) allBooks.get(i)).getIsbn().compareTo(((Book) allBooks.get(k)).getIsbn()) > 1) { Book temp = (Book) allBooks.get(i); allBooks.set(i, allBooks.get(k)); allBooks.set(k, temp); } } } } public ArrayList<Book> getBooks(){ return allBooks; } } //The exception occurs when i call the method here (in another class): Inventory lib = new Inventory(); jTextField12.setText(lib.getBookByAuthor(authorSearch).getTitle()); Here is my book class if you need it package webbazonab; //Webbazon AB //Project By: Ansh Sikka and Bharath Senthil public class Book { private double myPrice; private String myTitle; private String bookAuthor; private String isbn; private int myCopies; public Book(double price, int copies, String bookTitle, String Author, String isbnNumber) { myPrice = price; myCopies = copies; myTitle = bookTitle; bookAuthor = Author; isbn = isbnNumber; } public double getPrice() { return myPrice; } public String getIsbn() { return isbn; } public String getTitle() { return myTitle; } public String getAuthor() { return bookAuthor; } public int copiesLeft(){ return myCopies; } public String notFound(){ return "The book you searched for could not be found!"; } public String toString() { return "Title: " + getTitle() + "\nAuthor: " + getAuthor() + "\nNumber of Available Books: " + copiesLeft() + "\nPrice: $" + getPrice(); } } Thanks!

  Read the article

• Can't print elements in a DIV tag

  - by Mckenzi

  I am using a Drag-able and re-sizeable DIV's in this HTML file. Where the user will place the DIV tag to his desired place in a main parent DIV tag. Now I want to print this main DIV tag, but the problem is that the code which I'm using to PRINT this main DIV is printing in a sequence, like not the way user has arranged the DIV's. Also it doesn't take up the main DIV background IMAGE. here is the code. JAVASCRIPT & CSS <link rel="stylesheet" type="text/css" href="byrei-dyndiv_0.5.css"> <script type="text/javascript" src="http://jqueryjs.googlecode.com/files/jquery-1.3.1.min.js" > </script> <script type="text/javascript" src="byrei-dyndiv_1.0rc1.js"></script> <script language="javascript" type="text/javascript"> function change(boxid,divtoaffect) { content = document.getElementById("" + boxid + "").value.replace(/\n/g, '<br>'); document.getElementById(divtoaffect).innerHTML = content; } function select1() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Sunset.jpg')"; } function select2() { test=document.getElementById("changeMe"); test.style.backgroundImage="url('Blue hills.jpg')"; } function PrintElem(elem) { Popup($(elem).text()); } function Popup(data) { var mywindow = window.open('', 'my div', 'height=400,width=600'); mywindow.document.write('<html><head><title>my div</title>'); /*optional stylesheet*/ //mywindow.document.write('<link rel="stylesheet" href="main.css" type="text/css" />'); mywindow.document.write('</head><body >'); mywindow.document.write(data); mywindow.document.write('</body></html>'); mywindow.document.close(); mywindow.print(); return true; } // Print DIV function printContent(id){ str=document.getElementById(id).innerHTML newwin=window.open('','printwin','left=100,top=100,width=400,height=400') newwin.document.write('<HTML>\n<HEAD>\n') newwin.document.write('<TITLE>Print Page</TITLE>\n') newwin.document.write('<script>\n') newwin.document.write('function chkstate(){\n') newwin.document.write('if(document.readyState=="complete"){\n') newwin.document.write('window.close()\n') newwin.document.write('}\n') newwin.document.write('else{\n') newwin.document.write('setTimeout("chkstate()",2000)\n') newwin.document.write('}\n') newwin.document.write('}\n') newwin.document.write('function print_win(){\n') newwin.document.write('window.print();\n') newwin.document.write('chkstate();\n') newwin.document.write('}\n') newwin.document.write('<\/script>\n') newwin.document.write('</HEAD>\n') newwin.document.write('<BODY onload="print_win()">\n') newwin.document.write(str) newwin.document.write('</BODY>\n') newwin.document.write('</HTML>\n') newwin.document.close() } </script> </head> <body> <style type="text/css"> #output1,#output2 ,#output3 { width: 300px; word-wrap: break-word; border: solid 1px black; } </style> HTML <div style="width:650px;height:300px;" id="changeMe" > <table cellpadding="5" cellspacing="0" width="100%" style="margin:auto;"> <tr> <td><div class="dynDiv_moveDiv" id="output1" style="font-weight:bold;height:20px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div> </td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output2" style="height:40px;margin-top:30px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> <tr> <td><div class="dynDiv_moveDiv" id="output3" style="height:50px;margin-top:40px;"> <div class="dynDiv_resizeDiv_tl"></div> <div class="dynDiv_resizeDiv_tr"></div> <div class="dynDiv_resizeDiv_bl"></div> <div class="dynDiv_resizeDiv_br"></div> </div></td> </tr> </table> </div> <tr> <td align="center"><input type="button" value="Print Div" onClick="printContent('changeMe')" /> </td> </tr>

  Read the article

• Why cant i draw an elipse in with code?

  - by bvivek88

  package test; import java.awt.*; import java.awt.event.*; import java.awt.geom.Ellipse2D; import java.awt.image.BufferedImage; import javax.swing.*; public class test_bmp extends JPanel implements MouseListener,MouseMotionListener,ActionListener { static BufferedImage image; Color color; Point start=new Point(); Point end =new Point(); JButton elipse=new JButton("Elipse"); JButton rectangle=new JButton("Rectangle"); JButton line=new JButton("Line"); String selected; public test_bmp() { color = Color.black; setBorder(BorderFactory.createLineBorder(Color.black)); addMouseListener(this); addMouseMotionListener(this); } public void paintComponent(Graphics g) { //super.paintComponent(g); g.drawImage(image, 0, 0, this); Graphics2D g2 = (Graphics2D)g; g2.setPaint(Color.black); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } if(selected=="line") g2.drawLine(start.x,start.y,end.x,end.y); } //Draw on Buffered image public void draw() { Graphics2D g2 = image.createGraphics(); g2.setPaint(color); System.out.println("draw"); if(selected=="line") g2.drawLine(start.x, start.y, end.x, end.y); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } repaint(); g2.dispose(); } public JPanel addButtons() { JPanel buttonpanel=new JPanel(); buttonpanel.setBackground(color.lightGray); buttonpanel.setLayout(new BoxLayout(buttonpanel,BoxLayout.Y_AXIS)); elipse.addActionListener(this); rectangle.addActionListener(this); line.addActionListener(this); buttonpanel.add(elipse); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(rectangle); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(line); return buttonpanel; } public static void main(String args[]) { test_bmp application=new test_bmp(); //Main window JFrame frame=new JFrame("Whiteboard"); frame.setLayout(new BorderLayout()); frame.add(application.addButtons(),BorderLayout.WEST); frame.add(application); //size of the window frame.setSize(600,400); frame.setLocation(0,0); frame.setVisible(true); int w = frame.getWidth(); int h = frame.getHeight(); image = new BufferedImage(w, h, BufferedImage.TYPE_INT_RGB); Graphics2D g2 = image.createGraphics(); g2.setPaint(Color.white); g2.fillRect(0,0,w,h); g2.dispose(); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); } @Override public void mouseClicked(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseEntered(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseExited(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mousePressed(MouseEvent event) { start = event.getPoint(); } @Override public void mouseReleased(MouseEvent event) { end = event.getPoint(); draw(); } @Override public void mouseDragged(MouseEvent e) { end=e.getPoint(); repaint(); } @Override public void mouseMoved(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void actionPerformed(ActionEvent e) { if(e.getSource()==elipse) selected="elipse"; if(e.getSource()==line) selected="line"; draw(); } } I need to create a paint application, when i draw elipse by dragging mouse from left to right it displays nothing, why?? should i use any other function here?

  Read the article

• Servlet dispatcher is currently unavailable

  - by theJava

  <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:p="http://www.springframework.org/schema/p" xsi:schemaLocation="http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans.xsd"> <bean id="viewResolver" class="org.springframework.web.servlet.view.InternalResourceViewResolver" p:prefix="/WEB-INF/jsp/" p:suffix=".jsp" /> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName" value="com.mysql.jdbc.Driver"/> <property name="url" value="jdbc:mysql://127.0.0.1:3306/spring"/> <property name="username" value="monty"/> <property name="password" value="indian"/> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.annotation.AnnotationSessionFactoryBean"> <property name="dataSource" ref="myDataSource" /> <property name="annotatedClasses"> <list> <value>uk.co.vinoth.spring.domain.User</value> </list> </property> <property name="hibernateProperties"> <props> <prop key="hibernate.dialect">org.hibernate.dialect.MySQLDialect</prop> <prop key="hibernate.show_sql">true</prop> <prop key="hibernate.hbm2ddl.auto">create</prop> </props> </property> </bean> <bean id="myUserDAO" class="uk.co.vinoth.spring.dao.UserDAOImpl"> <property name="sessionFactory" ref="mySessionFactory"/> </bean> <bean name="/user/*.htm" class="uk.co.vinoth.spring.web.UserController" > <property name="userDAO" ref="myUserDAO" /> </bean> </beans> The above is my bean configuration, why do i get error when i run my application. My logs folder is empty... org.apache.catalina.loader.StandardClassLoader@122c9df org.springframework.web.servlet.DispatcherServlet java.lang.ClassNotFoundException: org.springframework.web.servlet.DispatcherServlet at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1436) at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1282) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1068) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:966) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:3996) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4266) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardHost.start(StandardHost.java:736) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:448) at org.apache.catalina.core.StandardServer.start(StandardServer.java:700) at org.apache.catalina.startup.Catalina.start(Catalina.java:552) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:295) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:433) Dec 22, 2010 3:44:48 PM org.apache.catalina.core.StandardContext loadOnStartup SEVERE: Servlet /interMedix threw load() exception java.lang.ClassNotFoundException: org.springframework.web.servlet.DispatcherServlet at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1436) at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1282) at org.apache.catalina.core.StandardWrapper.loadServlet(StandardWrapper.java:1068) at org.apache.catalina.core.StandardWrapper.load(StandardWrapper.java:966) at org.apache.catalina.core.StandardContext.loadOnStartup(StandardContext.java:3996) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4266) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardHost.start(StandardHost.java:736) at org.apache.catalina.core.ContainerBase.start(ContainerBase.java:1014) at org.apache.catalina.core.StandardEngine.start(StandardEngine.java:443) at org.apache.catalina.core.StandardService.start(StandardService.java:448) at org.apache.catalina.core.StandardServer.start(StandardServer.java:700) at org.apache.catalina.startup.Catalina.start(Catalina.java:552) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at org.apache.catalina.startup.Bootstrap.start(Bootstrap.java:295) at org.apache.catalina.startup.Bootstrap.main(Bootstrap.java:433) Dec 22, 2010 3:44:48 PM org.apache.coyote.http11.Http11BaseProtocol start INFO: Starting Coyote HTTP/1.1 on http-8181 Dec 22, 2010 3:44:48 PM org.apache.jk.common.ChannelSocket init INFO: JK: ajp13 listening on /0.0.0.0:8009 Dec 22, 2010 3:44:48 PM org.apache.jk.server.JkMain start INFO: Jk running ID=0 time=0/27 config=null Dec 22, 2010 3:44:48 PM org.apache.catalina.storeconfig.StoreLoader load INFO: Find registry server-registry.xml at classpath resource Dec 22, 2010 3:44:49 PM org.apache.catalina.startup.Catalina start INFO: Server startup in 558 ms Dec 22, 2010 3:44:50 PM org.apache.catalina.core.StandardWrapperValve invoke INFO: Servlet dispatcher is currently unavailable Dec 22, 2010 3:50:18 PM org.apache.catalina.core.StandardWrapperValve invoke INFO: Servlet dispatcher is currently unavailable But i have added spring-web-mvc to my class path which does contain this class file.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• mvc3 datatabels and ajax-beginform

  - by MIkCode

  im trying to send and ajax request and returning the result into a new table i debugged the req and i can confirm that evry thing is good except the VIEW the end result is an empty table instead of one row one more weird thing is if i page source i can see all the table result(more than the one that suppose to) this is the view: @model Fnx.Esb.ServiceMonitor.ViewModel.MainModels @{ ViewBag.Title = "MainSearch"; } @Html.EditorForModel() @{ AjaxOptions ajaxOpts = new AjaxOptions { UpdateTargetId = "MainTable", InsertionMode = InsertionMode.Replace, Url = Url.Action("queryData", "MainSearch"), }; } @using (Ajax.BeginForm(ajaxOpts)) { <div class="container"> <form action="#" method="post"> <div id="mainSearch"> @Html.EditorFor(x => x.MainSearchModel) </div> <br /> <br /> <br /> <br /> <div id="advancedSearch"> <div class="accordion" id="accordion2"> <div class="accordion-group"> <div class="accordion-heading"> <a class="accordion-toggle" data-toggle="collapse" data-parent="#accordion2" href="#collapseOne"> Advanced Search </a> </div> <div id="collapseOne" class="accordion-body collapse in"> <div class="accordion-inner"> @Html.EditorFor(x => x.AdvanceSearchContainerModel) </div> </div> </div> </div> </div> <br /> <br /> <button type="submit" class="btn"> <i class="icon-search"></i> Search </button> <button type="reset" class="btn"> <i class="icon-trash"></i> clear </button> </form> <br /> <br /> <br /> <br /> <br /> <br /> <table id="MainTable" cellpadding="0" cellspacing="0" border="0" class="table table-striped table-bordered"> <thead> <tr> <th> serviceDuration </th> <th> status </th> <th> ESBLatency </th> <th> serviceName </th> <th> serviceId </th> <th> startTime </th> <th> endTime </th> <th> instanceID </th> </tr> </thead> <tbody> @foreach (var item in Model.MainTableModel) { <tr> <td> @Html.DisplayFor(modelItem => item.serviceDuration) </td> <td> @Html.DisplayFor(modelItem => item.status) </td> <td> @Html.DisplayFor(modelItem => item.ESBLatency) </td> <td> @Html.DisplayFor(modelItem => item.serviceName) </td> <td> @Html.DisplayFor(modelItem => item.serviceId) </td> <td> @Html.DisplayFor(modelItem => item.startTime) </td> <td> @Html.DisplayFor(modelItem => item.endTime) </td> <td> @Html.DisplayFor(modelItem => item.instanceID) </td> </tr> } </tbody> </table> </div> } the datatables: javascript options $('#MainTable').dataTable({ "sDom": "<'row'<'span6'l><'span6'f>r>t<'row'<'span6'i><'span6'p>>", "bDestroy": true }); thanks miki

  Read the article

• The Tab1.java from API Demo has exception.

  - by Kooper

  I don't know why.All my Tab programs have exception.Even from API Demo. Here is the code: package com.example.android.apis.view; import android.app.TabActivity; import android.os.Bundle; import android.widget.TabHost; import android.widget.TabHost.TabSpec; import android.view.LayoutInflater; import android.view.View; public class Tab1 extends TabActivity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); TabHost tabHost = getTabHost(); LayoutInflater.from(this).inflate(R.layout.main,tabHost.getTabContentView(), true); tabHost.addTab(tabHost.newTabSpec("tab1") .setIndicator("tab1") .setContent(R.id.view1)); tabHost.addTab(tabHost.newTabSpec("tab2") .setIndicator("tab2") .setContent(R.id.view2)); tabHost.addTab(tabHost.newTabSpec("tab3") .setIndicator("tab3") .setContent(R.id.view3)); } } Here is the log: 06-13 17:24:38.336: WARN/jdwp(262): Debugger is telling the VM to exit with code=1 06-13 17:24:38.336: INFO/dalvikvm(262): GC lifetime allocation: 2511 bytes 06-13 17:24:38.416: DEBUG/Zygote(30): Process 262 exited cleanly (1) 06-13 17:24:38.456: INFO/ActivityManager(54): Process com.example.android.apis.view (pid 262) has died. 06-13 17:24:38.696: INFO/UsageStats(54): Unexpected resume of com.android.launcher while already resumed in com.example.android.apis.view 06-13 17:24:38.736: WARN/InputManagerService(54): Window already focused, ignoring focus gain of: com.android.internal.view.IInputMethodClient$Stub$Proxy@44dc4b38 06-13 17:24:48.337: DEBUG/AndroidRuntime(269): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:48.346: DEBUG/AndroidRuntime(269): CheckJNI is ON 06-13 17:24:48.856: DEBUG/AndroidRuntime(269): --- registering native functions --- 06-13 17:24:49.596: DEBUG/ddm-heap(269): Got feature list request 06-13 17:24:50.576: DEBUG/AndroidRuntime(269): Shutting down VM 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:50.576: DEBUG/dalvikvm(269): DestroyJavaVM shutting VM down 06-13 17:24:50.576: DEBUG/dalvikvm(269): HeapWorker thread shutting down 06-13 17:24:50.586: DEBUG/dalvikvm(269): HeapWorker thread has shut down 06-13 17:24:50.586: DEBUG/jdwp(269): JDWP shutting down net... 06-13 17:24:50.586: INFO/dalvikvm(269): Debugger has detached; object registry had 1 entries 06-13 17:24:50.596: ERROR/AndroidRuntime(269): ERROR: thread attach failed 06-13 17:24:50.606: DEBUG/dalvikvm(269): VM cleaning up 06-13 17:24:50.676: DEBUG/dalvikvm(269): LinearAlloc 0x0 used 628628 of 5242880 (11%) 06-13 17:24:51.476: DEBUG/AndroidRuntime(278): AndroidRuntime START <<<<<<<<<<<<<< 06-13 17:24:51.486: DEBUG/AndroidRuntime(278): CheckJNI is ON 06-13 17:24:51.986: DEBUG/AndroidRuntime(278): --- registering native functions --- 06-13 17:24:52.746: DEBUG/ddm-heap(278): Got feature list request 06-13 17:24:53.716: DEBUG/ActivityManager(54): Uninstalling process com.example.android.apis.view 06-13 17:24:53.726: INFO/ActivityManager(54): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10000000 cmp=com.example.android.apis.view/.Tab1 } 06-13 17:24:53.876: DEBUG/AndroidRuntime(278): Shutting down VM 06-13 17:24:53.886: DEBUG/dalvikvm(278): DestroyJavaVM waiting for non-daemon threads to exit 06-13 17:24:53.916: DEBUG/dalvikvm(278): DestroyJavaVM shutting VM down 06-13 17:24:53.926: DEBUG/dalvikvm(278): HeapWorker thread shutting down 06-13 17:24:53.936: DEBUG/dalvikvm(278): HeapWorker thread has shut down 06-13 17:24:53.936: DEBUG/jdwp(278): JDWP shutting down net... 06-13 17:24:53.936: INFO/dalvikvm(278): Debugger has detached; object registry had 1 entries 06-13 17:24:53.957: DEBUG/dalvikvm(278): VM cleaning up 06-13 17:24:54.026: ERROR/AndroidRuntime(278): ERROR: thread attach failed 06-13 17:24:54.146: DEBUG/dalvikvm(278): LinearAlloc 0x0 used 638596 of 5242880 (12%) 06-13 17:24:54.286: INFO/ActivityManager(54): Start proc com.example.android.apis.view for activity com.example.android.apis.view/.Tab1: pid=285 uid=10054 gids={1015} 06-13 17:24:54.676: DEBUG/ddm-heap(285): Got feature list request 06-13 17:24:55.006: WARN/ActivityThread(285): Application com.example.android.apis.view is waiting for the debugger on port 8100... 06-13 17:24:55.126: INFO/System.out(285): Sending WAIT chunk 06-13 17:24:55.186: INFO/dalvikvm(285): Debugger is active 06-13 17:24:55.378: INFO/System.out(285): Debugger has connected 06-13 17:24:55.386: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.586: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.796: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:55.996: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.196: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.406: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.606: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:56.806: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.016: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.216: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.416: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.626: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:57.836: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.039: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.246: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.451: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.656: INFO/System.out(285): waiting for debugger to settle... 06-13 17:24:58.866: INFO/System.out(285): debugger has settled (1367) 06-13 17:24:59.126: ERROR/gralloc(54): [unregister] handle 0x129980 still locked (state=40000001) 06-13 17:25:03.816: WARN/ActivityManager(54): Launch timeout has expired, giving up wake lock! 06-13 17:25:04.906: WARN/ActivityManager(54): Activity idle timeout for HistoryRecord{44d60e10 com.example.android.apis.view/.Tab1}

  Read the article

• C Language: Why I cannot transfer file from server to client?

  - by user275753

  I want to ask, why I cannot transfer file from server to client? When I start to send the file from server, the client side program will have problem. So, I spend some times to check the code, But I still cannot find out the problem Can anyone point out the problem for me? thanks a lot! [client side code] include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 define true 1 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET sockfd; int number,message; char outbuff[MAXLEN],inbuff[MAXLEN]; char PWD_buffer[_MAX_PATH]; struct sockaddr_in servaddr; FILE *fp; int numbytes; char buf[2048]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); if (argc != 2) errexit("client IPaddress"); if ( (sockfd = socket(AF_INET, SOCK_STREAM, 0)) == INVALID_SOCKET ) errexit("socket error: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_port = htons(S_PORT); if ( (servaddr.sin_addr.s_addr = inet_addr(argv[1])) == INADDR_NONE) errexit("inet_addr error: error number %d\n", WSAGetLastError()); if (connect(sockfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("connect error: error number %d\n", WSAGetLastError()); if ( (fp = fopen("C:\\users\\pc\\desktop\\COPY.c", "wb")) == NULL){ perror("fopen"); exit(1); } printf("Still NO PROBLEM!\n"); //Receive file from server while(1){ numbytes = read(sockfd, buf, sizeof(buf)); printf("read %d bytes, ", numbytes); if(numbytes == 0){ printf("\n"); break; } numbytes = fwrite(buf, sizeof(char), numbytes, fp); printf("fwrite %d bytes\n", numbytes); } fclose(fp); close(sockfd); return 0; } server side code include include include include include include include include define SA struct sockaddr define S_PORT 5678 define MAXLEN 1000 void errexit(const char *format, ...) { va_list args; va_start(args, format); vfprintf(stderr, format, args); va_end(args); WSACleanup(); exit(1); } int main(int argc, char *argv []) { WSADATA wsadata; SOCKET listenfd, connfd; int number, message, numbytes; int h, i, j, alen; int nread; struct sockaddr_in servaddr, cliaddr; FILE *in_file, *out_file, *fp; char buf[4096]; if (WSAStartup(MAKEWORD(2,2), &wsadata) != 0) errexit("WSAStartup failed\n"); listenfd = socket(AF_INET, SOCK_STREAM, 0); if (listenfd == INVALID_SOCKET) errexit("cannot create socket: error number %d\n", WSAGetLastError()); memset(&servaddr, 0, sizeof(servaddr)); servaddr.sin_family = AF_INET; servaddr.sin_addr.s_addr = htonl(INADDR_ANY); servaddr.sin_port = htons(S_PORT); if (bind(listenfd, (SA *) &servaddr, sizeof(servaddr)) == SOCKET_ERROR) errexit("can't bind to port %d: error number %d\n", S_PORT, WSAGetLastError()); if (listen(listenfd, 5) == SOCKET_ERROR) errexit("can't listen on port %d: error number %d\n", S_PORT, WSAGetLastError()); alen = sizeof(SA); connfd = accept(listenfd, (SA *) &cliaddr, &alen); if (connfd == INVALID_SOCKET) errexit("accept failed: error number %d\n", WSAGetLastError()); printf("accept one client from %s!\n", inet_ntoa(cliaddr.sin_addr)); fp = fopen ("client.c", "rb"); // open file stored in server if (fp == NULL) { printf("\nfile NOT exist"); } //Sending file while(!feof(fp)){ numbytes = fread(buf, sizeof(char), sizeof(buf), fp); printf("fread %d bytes, ", numbytes); numbytes = write(connfd, buf, numbytes); printf("Sending %d bytes\n",numbytes); } fclose (fp); closesocket(listenfd); closesocket(connfd); return 0; }

  Read the article

• AIR:- Desktop Application related to Window Component (Need some work around)

  - by Mahesh Parate

  Create custom component which contains Combobox and Datagrid. Application conations two button 1) Same Window and 2) New Window. (Label of two button) When you click on “Same Window” button your custom component should get added dynamically in your application. And when you click on “New Window” button your custom component should get open in different window (it should get shifted from application and should appear in Window component). Issue faced:- Clicking on Combobox, list is not getting open as change event doesn’t get fired in Native Window as it looses reference from main application. Issue with DataGrid in Native window (AIR). • DataGridEvent.COLUMN_STRETCH event get affected if try to open datagrid in Native Window. • DataGridEvent get fired but takes long time or even stuck while column stretch Note: Application is an Desktop Application. Only one instance is created in Application for your custom component to preserve current state on your custom component it can be Style, data, or other subcomponent state of your custom component (as above mentioned 2 component are just sample). Please find sample code below:- DataGridStretchIssue.mxml:- < ?xml version="1.0" encoding="utf-8"? < mx:WindowedApplication xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" xmlns:local="*" width="800" height="500" < mx:Script < ![CDATA[ import mx.events.FlexEvent; import mx.core.Window; private var dgComp:DataGridComp = new DataGridComp(); private var win:Window; private function clickHandler(event:Event):void{ dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; if(win){ win.close(); } this.addChild(dgComp); } private function openClickHandler(event:MouseEvent):void{ dgComp.x = 50; dgComp.y = 100; win = new Window();; win.width = 800; win.height = 500; win.addChild(dgComp); dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; win.open(true) } ]]> < /mx:Script < mx:HBox <mx:Button id="btnID" click="clickHandler(event)" label="Same Window"/> <mx:Button id="btnIDOpen" click="openClickHandler(event)" label="New Window"/> < /mx:HBox < /mx:WindowedApplication DataGridComp.mxml < ?xml version="1.0" encoding="utf-8"? < mx:Canvas xmlns:mx="http://www.adobe.com/2006/mxml" width="100%" height="100%" <mx:Script> <![CDATA[ import mx.events.DataGridEvent; import mx.collections.ArrayCollection; [Bindable] public var cards:ArrayCollection = new ArrayCollection( [ {label:"Visa", data:1}, {label:"MasterCard", data:2}, {label:"American Express", data:3} ]); private function stretchFn(event:DataGridEvent):void{ trace("--- Stretched---") } ]]> </mx:Script> <mx:HBox> <mx:ComboBox dataProvider="{cards}" width="150"/> <mx:DataGrid columnStretch="stretchFn(event)" > <mx:ArrayCollection> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Price>11.99</mx:Price> <mx:Album>Slanted and Enchanted</mx:Album> </mx:Object> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Album>Brighten the Corners</mx:Album> <mx:Price>11.99</mx:Price> </mx:Object> </mx:ArrayCollection> </mx:DataGrid> </mx:HBox> < /mx:Canvas Can any one suggest me some work around to make my code workable... :)

  Read the article

• How do you get XML::Pastor to set xsi:type for programmatically generated elements?

  - by Derrick

  I'm learning how to use Perl as an automation test framework tool for a Java web service and running into trouble generating xml requests from the Pastor generated modules. The problem is that when including a type that extends from the required type for an element, the xsi:type is not included in the generated xml string. Say, for example, I want to generate the following xml request from the modules that XML::Pastor generated from my xsd: <?xml version="1.0" encoding="UTF-8" standalone="yes"?> <PromptAnswersRequest xmlns="http://mycompany.com/api"> <Uri>/some/url</Uri> <User ref="1"/> <PromptAnswers> <PromptAnswer xsi:type="textPromptAnswer" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"> <Prompt ref="2"/> <Children> <PromptAnswer xsi:type="choicePromptAnswer"> <Prompt ref="1"/> <Choice ref="2"/> </PromptAnswer> </Children> <Value>totally</Value> </PromptAnswer> </PromptAnswers> </PromptAnswersRequest> What I'm getting currently is this: <?xml version="1.0" encoding="UTF-8" standalone="yes"?> <PromptAnswersRequest xmlns="http://mycompany.com/api"> <Uri>/some/url</Uri> <User ref="1"/> <PromptAnswers> <PromptAnswer> <Prompt ref="2"/> <Children> <PromptAnswer> <Prompt ref="1"/> <Choice ref="2"/> </PromptAnswer> </Children> <Value>totally</Value> </PromptAnswer> </PromptAnswers> </PromptAnswersRequest> Here are some relavent snippets from the xsd: <xs:complexType name="request"> <xs:sequence> <xs:element name="Uri" type="xs:anyURI"/> </xs:sequence> </xs:complexType> <xs:complexType name="promptAnswersRequest"> <xs:complexContent> <xs:extension base="api:request"> <xs:sequence> <xs:element name="User" type="api:ref"/> <xs:element name="PromptAnswers" type="api:promptAnswerList"/> </xs:sequence> </xs:extension> </xs:complexContent> </xs:complexType> <xs:complexType name="promptAnswerList"> <xs:sequence> <xs:element name="PromptAnswer" type="api:promptAnswer" minOccurs="0" maxOccurs="unbounded"/> </xs:sequence> </xs:complexType> <xs:complexType name="promptAnswer" abstract="true"> <xs:sequence> <xs:element name="Prompt" type="api:ref"/> <xs:element name="Children" type="api:promptAnswerList" minOccurs="0"/> </xs:sequence> </xs:complexType> <xs:complexType name="textPromptAnswer"> <xs:complexContent> <xs:extension base="promptAnswer"> <xs:sequence> <xs:element name="Value" type="api:nonEmptyString" minOccurs="0"/> </xs:sequence> </xs:extension> </xs:complexContent> </xs:complexType> And here are relavent parts of the script: my $promptAnswerList = new My::API::Type::promptAnswerList; my @promptAnswers; my $promptAnswerList2 = new My::API::Type::promptAnswerList; my @textPromptAnswerChildren; my $textPromptAnswer = new My::API::Type::textPromptAnswer; my $textPromptAnswerRef = new My::API::Type::ref; $textPromptAnswerRef->ref('2'); $textPromptAnswer->Prompt($textPromptAnswerRef); my $choicePromptAnswer = new My::API::Type::choicePromptAnswer; my $choicePromptAnswerPromptRef = new My::API::Type::ref; my $choicePromptAnswerChoiceRef = new My::API::Type::ref; $choicePromptAnswerPromptRef->ref('1'); $choicePromptAnswerChoiceRef->ref('2'); $choicePromptAnswer->Prompt($choicePromptAnswerPromptRef); $choicePromptAnswer->Choice($choicePromptAnswerChoiceRef); push(@textPromptAnswerChildren, $choicePromptAnswer); $promptAnswerList2->PromptAnswer(@textPromptAnswerChildren); $textPromptAnswer->Children($promptAnswerList2); $textPromptAnswer->Value('totally'); push(@promptAnswers, $pulseTextPromptAnswer); push(@promptAnswers, $textPromptAnswer); I haven't seen this addressed anywhere in the documentation for the XML::Pastor modules, so if anyone can point me at a good reference for its use it would be greatly appreciated. Also, I'm only using XML::Pastor because I don't know of any other modules that can do this, so if any of you know of something either easier to use, or more well maintained, please let me know about that too!

  Read the article

< Previous Page | 946 947 948 949 950 951 952 953 954 955 956 957  | Next Page >