Search Results

Search found 36762 results on 1471 pages for 'common table expression'.

Page 97/1471 | < Previous Page | 93 94 95 96 97 98 99 100 101 102 103 104  | Next Page >

  • One Common event for all controls in Silverlight

    - by Veejay
    I have a couple of textblock controls and all of them are calling a single event. But i have to wire all of them invidividually using TextBlock1.MouseMove += new MouseEventHandler(TextBlock_MouseMove); TextBlock2.MouseMove += new MouseEventHandler(TextBlock_MouseMove); TextBlock3.MouseMove += new MouseEventHandler(TextBlock_MouseMove); Is there a way that I can apply the mouse move to all TextBlock without wiring them one by one

    Read the article

  • Maintaining a common set of Eclipse preferences

    - by Robert Munteanu
    Whenever I switch workspaces/Eclipse installs I need to copy/redo the preferences: compiler settings; font sizes/families; code formatter; java code templates; editor templates; code clean-ups; I would like to maintain these settings in an unitary way, preferrably under source control. How can I do that? I know about 'copy settings' when creating a new workspace, but it does not keep updated copies.

    Read the article

  • Dealing with &rest-parameters in common lisp

    - by Patrick
    I want define a functions that accepts &rest - parameters and delegates them to another function. (html "blah" "foo" baz) = "blahfoobaz" I did not find a better way than this one: (defun html (&rest values) (concatenate 'string "" (reduce #'(lambda(a b) (concatenate 'string a b)) values :initial-value "") "")) But this looks somewhat glumbsy to me, since line 4 does no more than concatenating the &rest parameter "values". I tried (concatenate 'string "" (values-list values) "") but this does not seem to work (SBCL). Could someone give me an advice? Kind regards

    Read the article

  • Creating a function that will handle objects with common properties

    - by geocine
    Take this as an example I have trimmed this example for readability and you may not find the use of this concept here. class Teacher() { public Name {get; set;} public Salt {get; set;} public Department{get; set;} } class Student() { public Name {get; set;} public Salt {get; set;} public Section{get; set;} } public string GetEncryptedName(object Person) { //return encrypted name based on Name and Salt property return encrypt(object.Salt,object.Name) } callig the function GetEncryptedName(Teacher) GetEncryptedName(Student) How do you implement this kind of stuff?

    Read the article

  • Refactoring common method header and footer

    - by David Wong
    I have the following chunk of header and footer code appearing in alot of methods. Is there a cleaner way of implementing this? Session sess = factory.openSession(); Transaction tx; try { tx = sess.beginTransaction(); //do some work ... tx.commit(); } catch (Exception e) { if (tx!=null) tx.rollback(); throw e; } finally { sess.close(); } The class in question is actually an EJB 2.0 SessionBean which looks like: public class PersonManagerBean implements SessionBean { public void addPerson(String name) { // boilerplate // dostuff // boilerplate } public void deletePerson(Long id) { // boilerplate // dostuff // boilerplate } }

    Read the article

  • How to join 2 tables & display them correctly?

    - by steven
    http://img293.imageshack.us/img293/857/tablez.jpg Here is a picture of the 2 tables. The mybb_users table is the table that has the users that signed up for the forum. The mybb_userfields is the table that contain custom profile field data that they are able to customize & change in their profile. Now, all I want to do is display all users in rows with the custom profile field data that they provided in their profile(which is in the mybb_userfields table) How can I display these fields correctly together? For instance, p0gz is a male,lives in AZ,he owns a 360,does not know his bandwidth & Flip Side Phoenix is his team. How can it just be like "p0gz-male-az-360-dont know-flipside phoenix" in a row~???

    Read the article

  • Selectively search and replace certain lines using a regular expression

    - by eneveu
    I have a file containing a lot of SQL statements, such as: CREATE TABLE "USER" ( "ID" INTEGER PRIMARY KEY, "NAME" CHARACTER VARYING(50) NOT NULL, "AGE" INTEGER NOT NULL ); COPY "USER" (id, name, age) FROM stdin; 1 Skywalker 19 2 Kenobi 57 I want the column names in the COPY statements to be uppercased and quoted: COPY "USER" ("ID", "NAME", "AGE") FROM stdin; Using sed, I found the following regexp: sed -r 's/([( ])(\w+)([,)])/\1"\U\2\E"\3/g' It does replace the column names, but it is not selective enough, and replaces other words in the file: ~/test]$sed -r 's/([( ])(\w+)([,)])/\1"\U\2\E"\3/g' star_wars_example CREATE TABLE "USER" ( "ID" INTEGER PRIMARY "KEY", "NAME" CHARACTER VARYING("50")NOT "NULL", "AGE" INTEGER NOT NULL ); COPY "USER" ("ID", "NAME", "AGE") FROM stdin; 1 Skywalker 19 2 Kenobi 57 To avoid this problem, I want sed to only apply my regexp to the lines starting with COPY and ending with FROM stdin;. I have looked into lookahead / lookbehind, but they are not supported in sed. They seem to be supported in super-sed, but I am currently using Cygwin (Windows is mandatory here...) and it does not seem available in the package list. Is there a way to force sed to only consider specific line? I've considered piping my file through grep before applying sed, but other lines will then disappear from the output. Am I missing something obvious? It would be great if the answer was easily applicable on a default Cygwin install. I guess I could try installing super-sed on cygwin, but I'd like to know if there are more obvious ideas

    Read the article

  • How to have table span the entire height?

    - by Yogendra
    Hi All, I have a html table and I am trying to have it span the entire page height. For some reason I am not able to get this to work. I have set the html, body and table height to be 100%, but the table still does not occupy the entire 100%. Heres the code. It is very basic because I am just trying to have the table occupy the entire height. <%@ Page Language="C#" AutoEventWireup="true" CodeBehind="WebForm1.aspx.cs" Inherits="WebApplication1.WebForm1" %> <style type="text/css"> body,html { margin:0; padding:0; height:100%; } </style> <table border="2" cellpadding="0" cellspacing="0" style="height:100%; width:100%" > <tr> <td>ABCD</td> </tr> </table> </form> I tried for couple of hours and I could not get it to work. Any help is really appreciated.

    Read the article

  • Find most common string in an array

    - by j.
    I have this array, for example (the size is variable): x = ["1.111", "1.122", "1.250", "1.111"] and I need to find the most commom value ("1.111" in this case). Is there an easy way to do that? Tks in advance!

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Programming Entity Framework, 2nd Edition (EF4) Table of Contents

    We are closing in on finalizing the 2nd edition of Programming Entity Framework! Although the rough draft chapters are already available through Safari’s Rough Cuts program (here: http://oreilly.com/catalog/9780596807252) I have been editing and reshaping the content since those chapters were published. You can get the final print edition (August 15th or perhaps a bit earlier) at O’Reilly or pre-order it here on Amazon.com (here) (and elsewhere of course!) I believe that the book will...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • error_expected_primary expression before in. In functions

    - by user2975402
    Here is my code. I try to fix it and I always obtain the same error: expected primary expression before 'int'. in line 47, 55, 63, 80, 86. And I've already tried this program in small pieces before and it works. It doesn't marked that error. ` #include using namespace std; int add (int a, int b) { int r; r=a+b; return (r); } int ssub (int a, int b) { int r; r=a-b; return (r); } int mult(int a, int b) { int r; r=a*b; return (r); } int menu(int a, int b){ int r; char x; cout <<"What do you want to do: \na.Adding \n s. Substract \n m. Multiply. \n. e. Exit"<<endl; cin>>x; switch (x){ case 'a': cout << "Give a value for a"<<endl; cin>>a; cout <<"Give a value for b"<<endl; cin>>b; add (int a, int b); //aquí y en otras líneas me sale: expected primary expression before int. break; case 's': cout << "Give a value for a"<<endl; cin>>a; cout <<"Give a value for b"<<endl; cin>>b; ssub (int a, int b); break; case 'm': cout << "Give a value for a"<<endl; cin>>a; cout <<"Give a value for b"<<endl; cin>>b; mult (int a, int b); break; case 'e': x='e'; break; default: cout<<"Wrong choice. Run the program again and choose another letter"<<endl; break; } return r; } cout<<"The result is " << menu (int a, int b)<<endl; int main() { menu (int a, int b); return 0; } `

    Read the article

  • Why CSS Is Better Than Table Designs

    In the past, websites were made through the use of tables. Today, most websites are built through the use of style sheet languages. One of the most popular style sheet language used in the market tod... [Author: Margarette Mcbride - Web Design and Development - May 03, 2010]

    Read the article

  • Export images from a SQL Server Table to a Folder with SSIS

    Can I export images from SQL Server to a file in Windows? What SQL Server options are available to do so? Check out this tip to learn more. Keep your database and application development in syncSQL Connect is a Visual Studio add-in that brings your databases into your solution. It then makes it easy to keep your database in sync, and commit to your existing source control system. Find out more.

    Read the article

  • delete common dictionaries in list based on a value

    - by pythoonatic
    How would I delete all corresponding dictionaries in a list of dictionaries based on one of the dictionaries having a character in it. data = [ { 'x' : 'a', 'y' : '1' }, { 'x' : 'a', 'y' : '1/1' }, { 'x' : 'a', 'y' : '2' }, { 'x' : 'b', 'y' : '1' }, { 'x' : 'b', 'y' : '1' }, { 'x' : 'b', 'y' : '1' }, ] For example, how would I delete all of the x = a due to one of the y in the x=a having a / in it? Based on the example data above, here is where I would like to get to: cleaneddata = [ { 'x' : 'b', 'y' : '1' }, { 'x' : 'b', 'y' : '1' }, { 'x' : 'b', 'y' : '1' }, ]

    Read the article

  • Synchronizing Mysql Table Schema [on hold]

    - by user1122069
    I have some difficulty keeping track of my SQL changes in a text file in SVN. One solution that I am aware of is to put the SQL queries in files (1.sql, 2.sql...) and to manually load each file at the proper time. Besides missing commas, the process is too cumbersome when builds become more frequent. I have actually taken to asking a co-worker to send me his SQL changes on Skype and we just apply the changes immediately on our local, development, and production servers (using three PhpMyAdmin tabs). I have seen several GUI tools mentioned in similar questions on SO, but these are actually more work and less automated than the aforementioned methods. Is there any standardized process by which this is done in an automated way? I can only guess that large companies build their own mechanisms of keeping track of database schema changes (yet I can't find a word about it - maybe they use files?). This question was closed as off-topic on Stack Overflow, so I am re-posting it here.

    Read the article

  • Display two images side by side on an HTML Page

    - by user77735
    I am trying to place two images of the same size side-by-side. If I use a "table" then I am able to display both images side-by-side. But in my CSS Stylesheet I am using a custom format for the table and this shows on the page containing the images too. But I want to just display both images without any custom background or border etc. I tried using "div", "span", "ul" & "li" etc. but failed in each case. How can I place two images (of same size) in a single line, without using a "table"? If I have to use "table" for the same, then how can I use two (or more) different formatting for my tables using CSS? Thank you. Lalit Kumar Barik

    Read the article

  • what will EcmaScript 6 bring to the table for us

    - by user697296
    Our company ported moderate chunks of business logic to JavaScript. We compile the code with a minifier, which further improves performance. Since the language is dynamically typed, it lends itself well to obfuscation, which occurs as a byproduct of minification. We went to great efforts to ensure it positively screams, performance-wise. We can now do what we did before, faster, better, with less code, on more platforms. In summary, we are very satisfied with the current state of the language. I personally love the language especially for its cross-platform nature. So naturally, I read up a lot about the state of JavaScript compilers, performance and compatibility across as many browsers and platforms as I have time to research. The one theme which has been growing louder and louder these days, is the news about ECMAScript 6. So far, what I have been able to gather is that ES6 promises a better development experience; firstly by enabling new ways to do things, secondly by reporting errors early. This sounds great for those who are still waiting for the language to meet their needs before jumping on board. But we have already jumped on board in a big way. Sure, I expect that we will have to do ongoing maintenance and feature revisions on our code through the years, and that we would obviously make use of best practices at the time. But I don't see us refactoring major portions of it to take advantage of language features that are mostly intended to boost developer productivity. I keep wondering, what impact will the language advances ultimately have on our existing, well-written, well-performing code base? Is there something I am missing? Is there something we ought to look out for? Does anyone have tips or guidance on how we should approach the ecmascript.next finalization? Should we care?

    Read the article

  • Resolving "Error accessing a table..." Error

    Are you encountering an error message during DB2 database startup? Or during the execution of Alter Tablespace SQL command? If ';yes';, then the three possible reasons for the error message are, contai... [Author: Mark Willium - Computers and Internet - May 13, 2010]

    Read the article

  • Listing all objects that share a common variable in Javascript

    - by ntgCleaner
    I'm not exactly sure how to ask this because I am just learning OOP in Javascript, but here it goes: I am trying to be able to make a call (eventually be able to sort) for all objects with the same variable. Here's an example below: function animal(name, numLegs, option2, option3){ this.name = name; this.numLegs = numLegs; this.option2 = option2; this.option3 = option3; } var human = new animal(Human, 2, example1, example2); var horse = new animal(Horse, 4, example1, example2); var dog = new animal(Dog, 4, example1, example2); Using this example, I would like to be able to do a console.log() and show all animal NAMES that have 4 legs. (Should only show Horse and Dog, of course...) I eventually want to be able to make a drop-down list or a filtered search list with this information. I would do this with php and mySQL but I'm doing this for the sake of learning OOP in javascript. I only ask here because I don't exactly know what to ask. Thank you!

    Read the article

< Previous Page | 93 94 95 96 97 98 99 100 101 102 103 104  | Next Page >