Search Results

Search found 36762 results on 1471 pages for 'common table expression'.

Page 97/1471 | < Previous Page | 93 94 95 96 97 98 99 100 101 102 103 104  | Next Page >

  • Good or common naming conventions for xsd target namespaces

    - by Anne Schuessler
    I'm looking for some ideas for good naming conventions for xsd target namespaces. Basically I just need to make a definite decision on how to name the target namespace of my xsd so I try to get it right the first time. Changing it later would require changes to another system which is not in my control. Do you have any experience from past XML schema creations on what is a good and working solution? I've tried to find information online, but most examples just use very generic target namespaces like "http://exampleSchema" and similar. I'm actually trying to find some real life examples.

    Read the article

  • What is the most common way to use a middleware in node with express and connect

    - by Bernhard
    Thinking about the correct way, how to make use of middlewares in a node.js web project using express and connect which is growing up at the moment. Of course there are middlewares right now wich has to pass or extend requests globally but in a lot of cases there are special jobs like prepare incoming data and in this case the middleware would only work for a set of http-methods and routes. I've a component based architecture and each component brings it's own middleware layer which can implement those for requests this component can handle. On app startup any required component is loaded and prepared. Is it a good idea to bind the middleware code execution to URLs to keep cpu load lower or is it better to use middlewares only for global purposes? Here's some dummy how an url related middleware look like. app.use(function(req, res, next) { // Check if requested route is a part of the current component // or if the middleware should be passed on any request if (APP.controller.groups.Component.isExpectedRoute(req) || APP.controller.groups.Component.getConfig().MIDDLEWARE_PASS_ALL === true) { // Execute the midleware code here console.log('This is a route which should be afected by middleware'); ... next(); }else{ next(); } });

    Read the article

  • Creating a function that will handle objects with common properties

    - by geocine
    Take this as an example I have trimmed this example for readability and you may not find the use of this concept here. class Teacher() { public Name {get; set;} public Salt {get; set;} public Department{get; set;} } class Student() { public Name {get; set;} public Salt {get; set;} public Section{get; set;} } public string GetEncryptedName(object Person) { //return encrypted name based on Name and Salt property return encrypt(object.Salt,object.Name) } callig the function GetEncryptedName(Teacher) GetEncryptedName(Student) How do you implement this kind of stuff?

    Read the article

  • Selectively search and replace certain lines using a regular expression

    - by eneveu
    I have a file containing a lot of SQL statements, such as: CREATE TABLE "USER" ( "ID" INTEGER PRIMARY KEY, "NAME" CHARACTER VARYING(50) NOT NULL, "AGE" INTEGER NOT NULL ); COPY "USER" (id, name, age) FROM stdin; 1 Skywalker 19 2 Kenobi 57 I want the column names in the COPY statements to be uppercased and quoted: COPY "USER" ("ID", "NAME", "AGE") FROM stdin; Using sed, I found the following regexp: sed -r 's/([( ])(\w+)([,)])/\1"\U\2\E"\3/g' It does replace the column names, but it is not selective enough, and replaces other words in the file: ~/test]$sed -r 's/([( ])(\w+)([,)])/\1"\U\2\E"\3/g' star_wars_example CREATE TABLE "USER" ( "ID" INTEGER PRIMARY "KEY", "NAME" CHARACTER VARYING("50")NOT "NULL", "AGE" INTEGER NOT NULL ); COPY "USER" ("ID", "NAME", "AGE") FROM stdin; 1 Skywalker 19 2 Kenobi 57 To avoid this problem, I want sed to only apply my regexp to the lines starting with COPY and ending with FROM stdin;. I have looked into lookahead / lookbehind, but they are not supported in sed. They seem to be supported in super-sed, but I am currently using Cygwin (Windows is mandatory here...) and it does not seem available in the package list. Is there a way to force sed to only consider specific line? I've considered piping my file through grep before applying sed, but other lines will then disappear from the output. Am I missing something obvious? It would be great if the answer was easily applicable on a default Cygwin install. I guess I could try installing super-sed on cygwin, but I'd like to know if there are more obvious ideas

    Read the article

  • Dealing with &rest-parameters in common lisp

    - by Patrick
    I want define a functions that accepts &rest - parameters and delegates them to another function. (html "blah" "foo" baz) = "blahfoobaz" I did not find a better way than this one: (defun html (&rest values) (concatenate 'string "" (reduce #'(lambda(a b) (concatenate 'string a b)) values :initial-value "") "")) But this looks somewhat glumbsy to me, since line 4 does no more than concatenating the &rest parameter "values". I tried (concatenate 'string "" (values-list values) "") but this does not seem to work (SBCL). Could someone give me an advice? Kind regards

    Read the article

  • What are the common patterns in web programming?

    - by lankerisms
    I have been trying to write my first big web app (more than one cgi file) and as I kept moving forward with the rough prototype, paralelly trying to predict more tasks, this is the todo that got accumulated (In no particular order). * Validations and input sanitizations * Object versioning (to avoid edit conflicts. I dont want hard locks) * Exception handling * memcache * xss and injection protections * javascript * html * ACLs * phonetics in search, match and find duplicates (for form validation) * Ajaxify!!! (I have snipped off the project specific items.) I know that each todo will be quite tied up to its project and technologies used. What I am wondering though, is if there is a pattern in your todo items as well as the sequence in which you experienced guys have come across them.

    Read the article

  • Why CSS Is Better Than Table Designs

    In the past, websites were made through the use of tables. Today, most websites are built through the use of style sheet languages. One of the most popular style sheet language used in the market tod... [Author: Margarette Mcbride - Web Design and Development - May 03, 2010]

    Read the article

  • Adding Apache common dependency to Play Framework 2.0

    - by Mooh
    i want to import org.apache.commons.io but i'm getting this error: [info] Compiling 1 Java source to /home/ghost/Bureau/app/play-2.0.1/waf/target/scala-2.9.1/classes... [error] /home/ghost/Bureau/app/play-2.0.1/waf/app/controllers/Application.java:9: error: package org.apache.commons.io does not exist [error] import org.apache.commons.io.*; [error] ^ [error] /home/ghost/Bureau/app/play-2.0.1/waf/app/controllers/Application.java:41: error: cannot find symbol [error] FileUtils.copyFile(file, destinationFile); [error] ^ [error] symbol: variable FileUtils [error] location: class Application [error] 2 errors [error] {file:/home/ghost/Bureau/app/play-2.0.1/waf/}waf/compile:compile: javac returned nonzero exit code [error] application - Play can't find package org.apache.commons.io . How i can i add it as a dependency ?

    Read the article

  • How to "demote" all titles and headings in Word 2010?

    - by dangowans
    I built a large help document for an application I wrote. I used all the default styles in Word 2010, including "Title", "Heading 1", "Heading 2", etc. Sadly, when I generated the Table of Contents, Titles were not included. I'm also now using chmProcessor to automatically generate a website from the document, and it's not including Titles in its Table of Contents either. I'd like to make all Titles into Heading 1s, all Heading 1s into Heading 2s, and Heading 2s into Heading 3s, etc. Is this possible without a huge manual effort? (I'm sure there's a better word than "demote" for this.)

    Read the article

  • Refactoring common method header and footer

    - by David Wong
    I have the following chunk of header and footer code appearing in alot of methods. Is there a cleaner way of implementing this? Session sess = factory.openSession(); Transaction tx; try { tx = sess.beginTransaction(); //do some work ... tx.commit(); } catch (Exception e) { if (tx!=null) tx.rollback(); throw e; } finally { sess.close(); } The class in question is actually an EJB 2.0 SessionBean which looks like: public class PersonManagerBean implements SessionBean { public void addPerson(String name) { // boilerplate // dostuff // boilerplate } public void deletePerson(Long id) { // boilerplate // dostuff // boilerplate } }

    Read the article

  • Painless management of a logging table in SQL Server

    Tables that log a record of what happens in an application can get very large, easpecially if they're growing by half a billion rows a day. You'll very soon need to devise a scheduled routine to remove old records, but the DELETE statement just isn't a realistic option with that volume of data. Hugo Kornelis explains a pain-free technique for SQL Server. Top 5 hard-earned Lessons of a DBA New! Part 4, ‘Disturbing Development’ by Grant Fritchey, features the return of Joe Deebeeay and a server-threatening encounter with ORMs - read it here

    Read the article

  • Display two images side by side on an HTML Page

    - by user77735
    I am trying to place two images of the same size side-by-side. If I use a "table" then I am able to display both images side-by-side. But in my CSS Stylesheet I am using a custom format for the table and this shows on the page containing the images too. But I want to just display both images without any custom background or border etc. I tried using "div", "span", "ul" & "li" etc. but failed in each case. How can I place two images (of same size) in a single line, without using a "table"? If I have to use "table" for the same, then how can I use two (or more) different formatting for my tables using CSS? Thank you. Lalit Kumar Barik

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to join 2 tables & display them correctly?

    - by steven
    http://img293.imageshack.us/img293/857/tablez.jpg Here is a picture of the 2 tables. The mybb_users table is the table that has the users that signed up for the forum. The mybb_userfields is the table that contain custom profile field data that they are able to customize & change in their profile. Now, all I want to do is display all users in rows with the custom profile field data that they provided in their profile(which is in the mybb_userfields table) How can I display these fields correctly together? For instance, p0gz is a male,lives in AZ,he owns a 360,does not know his bandwidth & Flip Side Phoenix is his team. How can it just be like "p0gz-male-az-360-dont know-flipside phoenix" in a row~???

    Read the article

  • How to have table span the entire height?

    - by Yogendra
    Hi All, I have a html table and I am trying to have it span the entire page height. For some reason I am not able to get this to work. I have set the html, body and table height to be 100%, but the table still does not occupy the entire 100%. Heres the code. It is very basic because I am just trying to have the table occupy the entire height. <%@ Page Language="C#" AutoEventWireup="true" CodeBehind="WebForm1.aspx.cs" Inherits="WebApplication1.WebForm1" %> <style type="text/css"> body,html { margin:0; padding:0; height:100%; } </style> <table border="2" cellpadding="0" cellspacing="0" style="height:100%; width:100%" > <tr> <td>ABCD</td> </tr> </table> </form> I tried for couple of hours and I could not get it to work. Any help is really appreciated.

    Read the article

  • Resolving "Error accessing a table..." Error

    Are you encountering an error message during DB2 database startup? Or during the execution of Alter Tablespace SQL command? If ';yes';, then the three possible reasons for the error message are, contai... [Author: Mark Willium - Computers and Internet - May 13, 2010]

    Read the article

  • what will EcmaScript 6 bring to the table for us

    - by user697296
    Our company ported moderate chunks of business logic to JavaScript. We compile the code with a minifier, which further improves performance. Since the language is dynamically typed, it lends itself well to obfuscation, which occurs as a byproduct of minification. We went to great efforts to ensure it positively screams, performance-wise. We can now do what we did before, faster, better, with less code, on more platforms. In summary, we are very satisfied with the current state of the language. I personally love the language especially for its cross-platform nature. So naturally, I read up a lot about the state of JavaScript compilers, performance and compatibility across as many browsers and platforms as I have time to research. The one theme which has been growing louder and louder these days, is the news about ECMAScript 6. So far, what I have been able to gather is that ES6 promises a better development experience; firstly by enabling new ways to do things, secondly by reporting errors early. This sounds great for those who are still waiting for the language to meet their needs before jumping on board. But we have already jumped on board in a big way. Sure, I expect that we will have to do ongoing maintenance and feature revisions on our code through the years, and that we would obviously make use of best practices at the time. But I don't see us refactoring major portions of it to take advantage of language features that are mostly intended to boost developer productivity. I keep wondering, what impact will the language advances ultimately have on our existing, well-written, well-performing code base? Is there something I am missing? Is there something we ought to look out for? Does anyone have tips or guidance on how we should approach the ecmascript.next finalization? Should we care?

    Read the article

  • SQL most executed query?

    - by Esabe
    Hi everyone, I have a database in SQL Server 2008, and there are a lot of machines making queries against it. I know there is a SQL Server profiler, but I don't know very well how to use it. Is there any way to know what are the most common queries executed in the database? Through the profiler or not, it doesn't matter. Thank you very much in advance!

    Read the article

  • intrusive_ptr: Why isn't a common base class provided?

    - by Jon
    intrusive_ptr requires intrusive_ptr_add_ref and intrusive_ptr_release to be defined. Why isn't a base class provided which will do this? There is an example here: http://lists.boost.org/Archives/boost/2004/06/66957.php, but the poster says "I don't necessarily think this is a good idea". Why not?

    Read the article

  • What is the difference between 1 and '1 in Lisp?

    - by Jason Baker
    I had never really thought about whether a symbol could be a number in Lisp, so I played around with it today: > '1 1 > (+ '1 '1) 2 > (+ '1 1) 2 > (define a '1) > (+ a 1) 2 The above code is scheme, but it seems to be roughly the same in Common Lisp and Clojure as well. Is there any difference between 1 and quoted 1?

    Read the article

< Previous Page | 93 94 95 96 97 98 99 100 101 102 103 104  | Next Page >