Search Results

Search found 39682 results on 1588 pages for 'text pattern'.

Page 99/1588 | < Previous Page | 95 96 97 98 99 100 101 102 103 104 105 106  | Next Page >

  • Filter rule for SMS / text messages in exchange active sync (SMS sync)

    - by kynan
    Exchange server 2010 introduces SMS Sync (via exchange active sync), which works fine with my android device and the Samsung email app. However, all text messages are synced to my exchange inbox, which is a pain. I'd like to have them filtered to a specific folder. So far, I haven't figured out a useful filter rule for achieving that, since there seems to be no header indicating it's a text message. Has anyone managed to do that? Note that I'm not using Outlook as an email client, so I'm specifically looking for a server-side rule.

    Read the article

  • Mac OSX: Adobe Flash player 10.1.85.3 text issue

    - by sparkey
    Running Flash Player 10.1.85.3. on OS-X 10.6.4 I've run into a very strange issue with Adobe/Macromedia Flash. Text in dialogs sometimes is not displayed, and the containing boxes are distorted. It occurs in all browsers. This is best demonstrated on YouTube in some of their ads, as well as in Google Analytics overlays on graphs. You can see the issue here: As you can see, where I have moused over the high point, there should be a dialog with some text, but instead it is quite broken. I've tried uninstalling and reinstalling the Flash plugin several times, reinstalling Google Chrome, validating my fonts with FontBook (removed all dupes/ fonts with warnings). Also as a last resort I checked/ repaired perms on my disk. What should I do?

    Read the article

  • Windows apps keep switching to accented text

    - by Josh Kelley
    Somehow I keep hitting a shortcut key (or something similar) that enables the input of accented text. Whenever this accented text mode is enabled, pressing ' doesn't respond immediately; instead, the ' key is remembered, so if I press a vowel after that, I get the vowel with an acute accent mark, and if I press any other key, I immediately get an apostrophe followed by the other key. I don't want this to happen. It's very annoying. How do I disable this mode? I only remember seeing this in Firefox 3.6.3 and Pidgin 2.6.6, so maybe it's a GTK feature. It apparently happens on a per-application basis, and restarting the application fixes it. I checked Windows 7's "Region and Language" control panel and didn't see anything relevant (although I'm not intimately familiar with all of those settings, so I may have overlooked something).

    Read the article

  • How to color highlight text in a black/white document easily

    - by Lateron
    I am editing a 96 chapter book. The text is in normal black letters on a white background. What I want to be able to do is: I want to have any changes or additions automatically shown in another (per-selected) color. Without having to a)high lite a word or phrase to be changed or added and then b)going to the toolbar and clicking on the font color In other words I want the original color of the text to remain as it is and any additions or changes to be visible in another color without having to use the toolbar. Can this be done? I use OpenOffice or Word 2007 in Windows 7.

    Read the article

  • Text template or tool for documentation of computer configurations

    - by mjustin
    I regularly write and update technical documentation which will be used to set up a new virtual machine, or to have a lookup for system dependencies in networks with around 20-50 (server-side) computers. At the moment I use OpenOffice Writer with text tables, and create one document per intranet domain. To improve this documentation, I would like to collect some examples to identify areas where my documents can be improved, regarding general structure and content, to make it easy to read and use not only for me but also for technical staff, helpdesk etc. Are there simple text templates (for example for OpenOffice Writer) or tools (maybe database-driven) for structured documentation of a computer configuration? Such a template / tool should provide required and optional configuration sections, like 'operating system', 'installed services', 'mapped network drives', 'scheduled tasks', 'remote servers', 'logon user account', 'firewall settings', 'hard disk size' ... It is not so much low-level hardware docs but more infrastructure / integration information in these documents (no BIOS settings, MAC addresses).

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • Format text to 5 chars from a number

    - by Wheelersg
    In Access, I used a query to sum some numbers and appended the answer to another table(table2). Now I need to export the number as a text with 5 positions but can't seem to get it to hard code all 5 positions. I have it formatted as text, field length 5, custom foramt "00000" (also tried @@@@@). Example: 3 + 3 + 1 = 7. THen append the 7 to table2. It always shows as 7. I need it to shows as 00007.

    Read the article

  • Using Repository and Unit of Work patterns with Entity Framework 4.0 and MVC 2

    - by Mr. D
    Hi, I'm following this article Using Repository and Unit of Work patterns with Entity Framework 4.0. I'm tying to implement the Repository and Unit of work pattern, using Asp.Net MVC 2 and Entity Framework 4. Please let me know if I'm doing it right... In the Models folder: Northwind.edmx Products.cs (POCO class) ProductRepository.cs (Did my product query) IProductRepository.cs NorthwindContext.cs IUnitOfWork.cs In the Controller folder: ProductController.cs (Retrieve from ProductRepository.cs and Pass it to the view) When I run the application, I'm getting error message: Mapping and metadata information could not be found for EntityType 'NorthwindMvcPoco.Models.Category'. I don't know what I'm doing wrong. I search through whole web and I couldn't resolve this issue. Please help me.

    Read the article

  • Generate POCO classes in different project to the project with Entity Framework model

    - by Max
    I'm trying to use the Repository Pattern with EF4 using VS2010. To this end I am using POCO code generation by right clicking on the entity model designer and clicking Add code generation item. I then select the POCO template and get my classes. What I would like to be able to do is have my solution structured into separate projects for Entity (POCO) classes and another project for the entity model and repository code. This means that my MVC project could use the POCO classes for strongly typed views etc and not have to know about the repository or have to have a reference to it. To plug it all together I will have another separate project with interfaces and use IoC. Sounds good in my head I just don't know how to generate the classes into their own project! I can copy them and then change the namespaces on them but I wanted to avoid manual work whenever I change the schema in the db and want to update my model. Thanks

    Read the article

  • Passing an instantiated class to concrete class derived by Castle Windsor

    - by Tr1stan
    I have a system that I'm using to test some new architecture. I have the following setup (In MVC2 .Net - C Sharp): View < Controller < Service < Repository < DB I'm using Castle Windsor as my DI (IoC) controller, and this is working just fine in both the Service and Repo layers. However, I'm now at a point where I would like to pass an Entity Framework (DatabaseNameEntity) to the constructor to the Service, and then to the Repo, so that I have something similar to a Unit of Work pattern per request (This feels like what I'm trying to achieve anyway) - and I'm having trouble working out how this can be done using Castle Windsor. Am I going off on a silly tangent? Any pointers appreciated.

    Read the article

  • C# UserControl factory

    - by user1112111
    Let's say you have two classes that extend UserControl. Each of the controls provides a custom event (this could be done by using an interface). You want to display one of the controls in the odd days and the other in the even days. You also want to be able to drag&drop (Visual Studio) the UserControl on your form without knowing what the Control type will finally be. How do you do that ? Is the factory pattern useful here ?

    Read the article

  • How to use DoG Pyramid in SIFT

    - by Ahmet Keskin
    Hi all, I am very new in image processing and pattern recognition. I am trying to implement SIFT algorithm where I am able to create the DoG pyramid and identify the local maximum or minimum in each octave. What I don't understand is that how to use these local max/min in each octave. How do I combine these points? My question may sound very trivial. I have read Lowe's paper, but could not really understand what he did after he built the DoG pyramid. Any help is appreciated. Thank you

    Read the article

  • NHibernate with or without Repository

    - by Groo
    There are several similar questions on this matter, by I still haven't found enough reasons to decide which way to go. The real question is, is it reasonable to abstract the NHibernate using a Repository pattern, or not? It seems that the only reason behind abstracting it is to leave yourself an option to replace NHibernate with a different ORM if needed. But creating repositories and abstracting queries seems like adding yet another layer, and doing much of the plumbing by hand. One option is to use expose IQueryable<T> to the business layer and use LINQ, but from my experience LINQ support is still not fully implemented in NHibernate (queries simply don't always work as expected, and I hate spending time on debugging a framework). Although referencing NHibernate in my business layer hurts my eyes, it is supposed to be an abstraction of data access by itself, right? What are you opinions on this?

    Read the article

  • SubSonic 3.0 - Save method with all columns as parameters?

    - by Todd Menier
    Hi, Just getting started with SubSonic. I'm using the Repository pattern, so my domain objects are totally seperate, and SubSonic-generated classes are used only in my data access layer. I'm wondering if a template exists that will give me a Save method (Insert/Update) that requires all table column values as parameters. My thinking is that since I need to do the mapping work manually, at least if my database schema changes (ie, a new column is added), I won't forget to add a corresponding mapping, since the auto-generated method signature would change and the compiler would catch it. I've considered messing with the T4 templates to add this feature, but thought I'd check if this already exists somewhere before I head down that path. Thanks in advance.

    Read the article

  • Matching of tuples

    - by Jack
    From what I understood I can use pattern-matching in a match ... with expression with tuples of values, so something like match b with ("<", val) -> if v < val then true else false | ("<=", val) -> if v <= val then true else false should be correct but it gives me a syntax error as if the parenthesis couldn't be used: File "ocaml.ml", line 41, characters 14-17: Error: Syntax error: ')' expected File "ocaml.ml", line 41, characters 8-9: Error: This '(' might be unmatched referring on first match clause.. Apart from that, can I avoid matching strings and applying comparisons using a sort of eval of the string? Or using directly the comparison operator as the first element of the tuple?

    Read the article

  • How to match the last url in a line containing multiple urls, using regular expressions?

    - by Mert Nuhoglu
    I want to write a regex that matches a url that ends with ".mp4" given that there are multiple urls in a line. For example, for the following line: "http://www.link.org/1610.jpg","Debt","http://www.archive.org/610_.mp4","66196517" Using the following pattern matches from the first http until mp4. (http:\/\/[^"].*?\.mp4)[",].*? How can I make it match only the last url only? Note that, the lines may contain any number of urls and anything in between. But only the last url contains .mp4 ending.

    Read the article

< Previous Page | 95 96 97 98 99 100 101 102 103 104 105 106  | Next Page >