Daily Archives

Articles indexed Wednesday October 10 2012

Page 10/18 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • Not able to output to file in the Windows command line

    - by Sachin
    In the following code, I need to take the path and size of folder and subfolders into a file. But when the loop runs for the second time, path and size are not getting printed to the file. size.txt only contains the path and size of the 1st folder. Please somebody help me. @echo off SETLOCAL EnableDelayedExpansion SET xsummary= SET xsize= for /f "tokens=1,2 delims=C" %%i IN ('"dir /s /-c /a | find "Directory""') do (echo C%%j >> abcd.txt) for /f "tokens=*" %%q IN (abcd.txt) do ( cd "%%q" For /F "tokens=*" %%h IN ('"dir /s /-c /a | find "bytes" | find /v "free""') do Set xsummary=%%h For /f "tokens=1,2 delims=)" %%a in ("!xsummary!") do set xsize=%%b Set xsize=!xsize:bytes=! Set xsize=!xsize: =! echo.%%q >> size.txt echo.!xsize! >> size.txt )

    Read the article

  • vim coloring for git

    - by kelloti
    I'm on Windows and my vim loads with a terrible colorscheme with vim. The message is blue on black (so I can't see what I'm typing). I need to change the colorscheme, but :colorscheme slate doesn't do anything. :version vim - vi improved 7.3 (2010 aug 15, compiled oct 27 2010 17:51:38) ms-windows 32-bit console version included patches: 1-46 compiled by bram@kibaale big version without gui. features included (+) or not (-): +arabic +autocmd -balloon_eval -browse ++builtin_terms +byte_offset +cindent +clientserver +clipboard +cmdline_compl +cmdline_hist +cmdline_info +comments +conceal +cryptv +cscope +cursorbind +cursorshape +dialog_con +diff +digraphs -dnd -ebcdic +emacs_tags +eval +ex_extra +extra_search +farsi +file_in_path +find_in_path +float +folding -footer +gettext/dyn -hangul_input +iconv/dyn +insert_expand +jumplist +keymap +langmap +libcall +linebreak +lispindent +listcmds +localmap -lua +menu +mksession +modify_fname +mouse -mouseshape +multi_byte +multi_lang -mzscheme -netbeans_intg -osfiletype +path_extra -perl +persistent_undo -postscript +printer -profile -python -python3 +quickfix +reltime +rightleft -ruby +scrollbind +signs +smartindent -sniff +startuptime +statusline -sun_workshop +syntax +tag_binary +tag_old_static -tag_any_white -tcl -tgetent -termresponse +textobjects +title -toolbar +user_commands +vertsplit +virtualedit +visual +visualextra +viminfo +vreplace +wildignore +wildmenu +windows +writebackup -xfontset -xim -xterm_save -xpm_w32 system vimrc file: "$vim\vimrc" user vimrc file: "$home\_vimrc" 2nd user vimrc file: "$vim\_vimrc" user exrc file: "$home\_exrc" 2nd user exrc file: "$vim\_exrc" compilation: cl -c /w3 /nologo -i. -iproto -dhave_pathdef -dwin32 -dfeat_cscope -dwinver=0x0400 -d_win32_winnt=0x0400 /fo.\objc/ /ox /gl -dndebug /zl /mt -ddynamic_iconv -ddynamic_gettext -dfeat_big /fd.\objc/ /zi linking: link /release /nologo /subsystem:console /ltcg:status oldnames.lib kernel32.lib advapi32.lib shell32.lib gdi32.lib comdlg32.lib ole32.lib uuid.lib /machine:i386 /nodefaultlib libcmt.lib user32.lib /pdb:vim.pdb -debug My $HOME\_vimrc looks like colorscheme slate syn on set shiftwidth=2 set tabstop=2 and my $VIM\vimrc is the stock vimrc that comes with the Windows Vim distribution. How do I change my console Vim colorscheme? Especially for Git commits.

    Read the article

  • How can I tell if my UPS is functioning properly or not for my PC?

    - by prabha
    For the last two days, my Uninterruptable Power Supply (UPS) has failed to produce the actual back up. So, I charged it for 24hrs and again checked that when the power failed my PC was automatically shut down. But in the time of power no supply from ups bt .......is my ups is working properly or not else there is direct power. It will cause any harm to my pc. my questions are..... Is the UPS functioning properly or not? If not, then will it harm my pc? If it is functioning, will it regulate direct power to pc without any cause? Is my UPS battery not working? What should I do to make my UPS batteries last for at least a year? I am using FRONTECH UPS 600va (Warranty for both ups and battery is expired) I already changed the battery 8 months previously. Note from editor: Tried to make as much sense of this question as I could. I hope I didn't alter the meaning in any way.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Script to unstick VNC keys?

    - by MidnightLightning
    I've run into dropped key events when connecting via VNC clients, leading to a "stuck key" (usually a meta key like CTRL or ALT) and searching around the common answer on how to solve it is often "press and release each meta key individually until the problem resolves". However, I've found this to be annoying and time consuming to try and solve it this way. Plus on a bad connection, it sometimes will miss the "key up" event for the meta key again, and still keep the key stuck. So I'm looking for an automated way to do this: From a script on the client side or the server side, is there a way to trigger "key up" events for all the meta keys (CTRL, ALT, SHIFT, and WIN/CMD, both Left and Right versions)? Or just a command to release all keys the server thinks are down at the moment? Or some scripted way to at least list which keys the server end thinks are down so I know which key to keep pressing and releasing to try and release it? I've got a Mac on the server end, so a Mac/Linux solution would be needed for my situation.

    Read the article

  • Can a process be frozen temporarily in linux?

    - by Pal Szasz
    I was wondering if there is a way to freeze any process for a certain amount of time? What I mean is that: is it possible for one application (probably running as root) to pause the execution of another already running process (any process, both GUI and command line) and then resume it later? In other words I don't want certain processes to be scheduled by the linux scheduler for a certain amount of time.

    Read the article

  • How to create dynamic Scatter Plot/Matrix with labels and categories on both axis in Excel 2010?

    - by user1581900
    Let us consider a following data set: Name | Age | Hair Color ----------------------------- John | Young | Brown Sophie | Old | Blond Adam | Mature| Blond Mark | Teen | Dark Jeremy | Old | Grey Alex | Young | Brown etc... Both Age and Hair Color, can take only defined values(Young/teen/mature/old and Blond/brown/Dark/Grey). Name is the only real variable here. I want to create a Scatter Plot / Matrix that will look something like that: I know that I schould use this tool to add labels to the scatter plot. I also found this youtube video that explains how to display categories on Y-axis Moreover I need the chart to be dynamic as explained in another youtube video. How do I combine all these approaches to get a Scatter Plot with categories as values on both axis?

    Read the article

  • Wake on Lan/Wan won't work after some time has passsed

    - by Vian Esterhuizen
    I have the following set up: Gigabyte Z77X-UD5H Wake On Lan Enabled Asus N66U Port Forwarding Static IP assigned to my computer Windows 7 Advanced Power Management - PCI Express - Off Intel 82579V - All options under Power Management checked I'm trying to set this up for Wake on Wan capabilities. If I shut down my computer and immediately try to Wake on Wan (and Lan) it works and starts up. While the computer is on, I've used a few WOL specific packet sniffers and the packet comes through on the correct port. After any period of time over a few minutes, waking on Wan or Lan won't work. The back "activity" light is blinking on my ethernet port on my computer, as well as on the router, so I would assume the network card is on and able to receive a signal. Any ideas? Suggestions? What can I do to troubleshoot the problem?

    Read the article

  • Applications on my laptop crashees every 10-20 minutes [closed]

    - by user1731110
    In my windows 7 home premium, several of my application crashes after some minutes even wehn I am not touching system. For example I have outlook 2007, that works fine, but suddenly crashes. The same about visual studio 2012. It is also crashes after some minute no matter if I am working on a project or I am not touching it. the same behaviour is there, for other applications (skype, oovoo and ...). I use Microsoft security essential and there is no virus on my system. I also checked my system with Sophos anti root kit and there is no root kit there. What would be the problem?

    Read the article

  • How to lookup a value in a table with multiple criteria

    - by php-b-grader
    I have a data sheet with multiple values in multiple columns. I have a qty and a current price which when multiplied out gives me the current revenue (CurRev). I want to use this lookup table to give me the new revenue (NewRev) from the new price but can't figure out how to do multiple ifs in a lookup. What I want is to build a new column that checks the "Product", "Tier" and "Location/State" and gives me the new price from the lookup table (above) and then multiply that by the qty. e.g. Data > Product, Tier, Location, Qty, CurRev, NewRev > Product1, Tier1, VIC, 2, $1000.00, $6000 (2 x $3000) > Product2, Tier3, NSW, 1, $100.00, $200 (1 x $200) > Product1, Tier3, SA, 5, $250.00, $750 (5 x $150) > Product3, Tier1, ACT, 5, $100.00, $500(5 x $100) > Product2, Tier3, QLD, 2, $150.00, $240 (2 x $240) Worst case, if I just get the new rate I can create another column

    Read the article

  • Microsoft Office 2003 document (Excel and Word) intermitently, takes 30 seconds to load

    - by Julio Nobre
    I am trying to figure out why a simple .XLS EXCEL workbook is taking, randomly, 30 seconds to open. Before answering: Please, bear mind the following: Problem symptoms Hanging is intermitent and it takes exactly 30 seconds; During hanging there is no cpu or disk activity; It only happens during document load. Every runs smooth after that; Windows Explorer.exe hangs on folder, but all other folders, system and applications are still responsive; There are no consecutive hangings. I have to wait for while to reproduce this behaviour; All samples documents are located on a local drive (C:\BPI); The no document has has macros and have any addins usage; The problem does occurs on others files extensions like .PDF, for example; Office 2003 is being used for several years; The computer is running Windows XP; Computer has several network mapped drives, all addressed to main file server; Recently, main fileserver was replaced by Windows 2011 SBS Standard Edition What I have done so far I have traced machine Explorer.exe, using Process Monitor, added Duration column, and filtered by Duration 1. That's is how I found that hanging was taking exactly 30 seconds. For further information, please refer to Oliver Salzburg tutorial. Using Process Monitor, I have also figured out than five operations were taking most of sample collecting duration. Looking at sample image below, column Operation below you will notice that one single operation was taking 29 seconds; I have tried different documents (.xls and .doc), all of them smaller than 30 KB; I have, temporarily, removed all shortcuts on User Document's folder that were pointing to network drives or shares; I have runned CCleaner to fix registry issues; I made sure that there were no external links on tested workbook or word documents; I have reproduced this behaviour for hours; I have extensivelly researched for hours on the web; Process Monitor's collected and filtered data

    Read the article

  • Use Alladin eToken with ThunderBird and other tool

    - by Yurij73
    I'm looking for an example on how to setup the eToken PRO Java device to work with Mozilla Thunderbird and with other Linux tool such as PAM logon. I installed distributed pkiclient-5.00.28-0.i386.RPM from the official product page eToken Pro but that tool only handles importing/exporting certificates on the device. I read a glance an old HOWTO from eToken on Linux, but I couldn't install pkcs11-lib for this device as recommended for Thunderbird use this crypto device. It seems my usb token isn't listed in system, unless lsusb show it, so that is the matter modutil -list -dbdir /etc/pki/nssdb Listing of PKCS #11 Modules NSS Internal PKCS #11 Module Blockquote slots: 2 slots attached Blockquote status: loaded Blockquote slot: NSS User Private Key and Certificate Services Blockquote token: NSS Certificate DB Blockquote CoolKey PKCS #11 Module Blockquote library name: libcoolkeypk11.so Blockquote slots: 1 slot attached Blockquote status: loaded Blockquote slot: AKS ifdh [Main Interface] 00 00 token: is my token absent? on other hand i don't know which module is convenient to Java Pro, does CoolKey does all the job well? It seems Java token is too new hardware for Linux? there is excerpt from /etc/pam_pkcs11.conf #filename of the PKCS #11 module. The default value is "default" use_pkcs11_module = coolkey; screen_savers = gnome-screensaver,xscreensaver,kscreensaver pkcs11_module coolkey { module = libcoolkeypk11.so; description = "Cool Key"`

    Read the article

  • SNMP Traps: Telling the difference between sources

    - by MHibbin
    I am logging all incoming SNMP traps to file, for further processing, via: snmptrapd -Lf /path/to/my/file.log So this will log all traps coming in on port 162. Is there a way I can tell the differences between different sources, i.e vendors. I believe this would be the "OID" field but i'm unsure. Any thoughts would be welcomed, if not I will just have to use a lookup with IP addresses, but I'm sure I saw that there is a unique part to each vendor. Cheers

    Read the article

  • How can I keep persistent cookies from certain domains only?

    - by Mike L.
    This question is similar this one which covers Firefox, but I want to know how to do it in Chrome: I want Chrome to clear cookies from all sites accept those from certain domains. In the Cookies section of the *Content Settings I've made following selections: (*) Allow local data to be set (recommended) ( ) Allow local data to be set for the current session only ( ) Block sites from setting any data [ ] Block third-party cookies and site data [x] Clear cookies and other sites and plug-in data when I close my browser After logged in to my preferred website(s), I find the required domains listed when I click at All cookies and site data. Let's say, I find some cookies for mysite.comand www.mysite.com. Now I click at Manage exceptions and enter these items: Hostname Pattern Behavior ------------------------------------------- mysite.com Allow www.mysite.com Allow Unfortunately, this does not seem to work, because when I close Chrome and reopen it, all cookies are gone, even those from the configured mysite.com hosts.

    Read the article

  • Why does compressing and decompressing my SSD hard drive free up space?

    - by Paperflyer
    I bought an SSD (SandForce 2), created a tiny 25GB partition on it for Windows and installed Windows 7 64-bit. In order to free disk space, I enabled compression on the drive using the Properties entry in the context menu for the drive in Explorer. Prior to compressing I had around 5GB of free space. After compression I had 4GB, so compression was not working for me. I figured this might have happened because of the built-in data compression of the SSD. I decompressed the files again - after decompression, it left me with 7GB of free space! Better yet, after restarting, I had 10GB. What is happening here?

    Read the article

  • Hard Drive problem: is it the SATA controller or the HDD itself?

    - by Drooling_Sheep
    I have a Samsung 1.5TB hard drive hooked up to an ECS H55H-I mini-ITX motherboard. I have XBMC 10 (modified Ubuntu 10.04) installed for use as an HTPC. The hard drive encounters occasional errors during normal use which cause it to be remounted read-only. I have updated the BIOS on the motherboard, changed the SATA cable and moved it to different ports on the motherboard, installed and re-installed the OS (including different versions of XBMC and generic ubuntu), all to no avail. I recently ran tests both with badblocks -sv and smartctl -t long. Both reported no errors. This makes me think the motherboard or SATA controller is probably the issue. Does anyone know of any further tests I can do to help narrow this down? The processor is a Core i3. I forget the model number but it's one of the 32nm ones with on-package graphics. There's no discrete video card or optical drive. The power supply is a 150W Rosewill (pretty sure) that came with the case.

    Read the article

  • Matched or unmatched drives for RAID arrays?

    - by Will
    Looking around there is conflciting information on this, with some strongly suggesting one or the other. From my understanding the issue with matched drives is that the wear on both drives is more or less the same, so the potential for the second drive failing with or very soon after the first is pretty high. People also claim matched drives give substianatally higher performance however assuming the unmatched drives are more or less the same (eg 2, 1 TB STATA II 7200rpm drives with 32MB cache), would the minor differences between say a Seagate and a Western Digital one (say one has a 128MB/s read rate, and the other a 150MB/s read rate, as well as I guess various other minor differences) actually cause any notable performance loss, ie potentialy worse than two matched 128MB/s drives, or does RAID not really care and give you essentially an optimal solution (eg upto 278MB/s total read speed for RAID 0 and 1) and similar for other RAID with more "unmatched" drives (5 and 1+0 come to mind as possibilities)? Also I couldnt find much info on how this is different on different RAID setups, eg RAID 0 or RAID 1, software or hardware RAID, etc. I'm assuming such things have an effect, and thats it's not all the same for RAID in general?

    Read the article

  • 50 Years of LEDs: An Interview with Inventor Nick Holonyak [Video]

    - by Jason Fitzpatrick
    The man who powered on the first LED half a century ago is still around to talk about it; read on to watch an interview with LED inventor Nick Holonyak. The most fascinating thing about Holonyak’s journey to the invention of the LED was that he started off trying to build a laser and ended up inventing a super efficient light source: Holonyak got his PhD in 1954. In 1957, after a year at Bell Labs and a two year stint in the Army, he joined GE’s research lab in Syracuse, New York. GE was already exploring semiconductor applications and building the forerunners of modern diodes called thyristors and rectifiers. At a GE lab in Schenectady, the scientist Robert Hall was trying to build the first diode laser. Hall, Holonyak and others noticed that semiconductors emit radiation, including visible light, when electricity flows through them. Holonyak and Hall were trying to “turn them on,” and channel, focus and multiply the light. Hall was the first to succeed. He built the world’s first semiconductor laser. Without it, there would be no CD and DVD players today. “Nobody knew how to turn the semiconductor into the laser,” Holonyak says. “We arrived at the answer before anyone else.” But Hall’s laser emitted only invisible, infrared light. Holonyak spent more time in his lab, testing, cutting and polishing his hand-made semiconducting alloys. In the fall of 1962, he got first light. “People thought that alloys were rough and turgid and lumpy,” he says. “We knew damn well what happened and that we had a very powerful way of converting electrical current directly into light. We had the ultimate lamp.” How To Get a Better Wireless Signal and Reduce Wireless Network Interference How To Troubleshoot Internet Connection Problems 7 Ways To Free Up Hard Disk Space On Windows

    Read the article

  • Hurricanes Since 1851 [Visualization]

    - by Jason Fitzpatrick
    Much like you can map out volcanic eruptions to create a neat pattern around the Pacific Ring of Fire, you can also map out hurricanes and tropical storms. Check out this high-resolution visualization to see the pattern formed by a century and a half of storms. Courtesy of UXBlog and data from the National Oceanic and Atmospheric Administration, the above projection shows the path of tropical storms around the equator (the perspective, if the map looks unfamiliar to you, is bottom up with Antarctica and the lower portion of South America in the center). For a full resolution copy of the image and more information about how it was rendered, hit up the link below. Hurricanes Since 1851 [via Cool Infographics] How To Get a Better Wireless Signal and Reduce Wireless Network Interference How To Troubleshoot Internet Connection Problems 7 Ways To Free Up Hard Disk Space On Windows

    Read the article

  • How To Get a Better Wireless Signal and Reduce Wireless Network Interference

    - by Chris Hoffman
    Like all sufficiently advanced technologies, Wi-Fi can feel like magic. But Wi-Fi isn’t magic – it’s radio waves. A variety of things can interfere with these radio waves, making your wireless connection weaker and more unreliable. The main keys to improving your wireless network’s signal are positioning your router properly — taking obstructions into account — and reducing interference from other wireless networks and household appliances. Image Credit: John Taylor on Flickr How To Get a Better Wireless Signal and Reduce Wireless Network Interference How To Troubleshoot Internet Connection Problems 7 Ways To Free Up Hard Disk Space On Windows

    Read the article

  • Viewing the Future Through the ‘Eyes of the Past’ [Humorous Image]

    - by Asian Angel
    Really makes you feel nostalgic, eh? You can access the full-size version to get a better view of the upper right corner here. O_O This is a close approximation of the original title of the post. [via Reddit - Tech Support Gore] How To Get a Better Wireless Signal and Reduce Wireless Network Interference How To Troubleshoot Internet Connection Problems 7 Ways To Free Up Hard Disk Space On Windows

    Read the article

  • jQuery UI 1.9.0 est disponible, accompagné d'un nouveau site web, un nouveau serveur de code et une nouvelle documentation

    jQuery UI 1.9.0 est disponible Un nouveau site web, un nouveau serveur de code et une nouvelle documentation accompagnent cette sortie. jQuery UI 1.9.0 est compatible avec jQuery 1.8.2 et le plugin jQuery Color. Annoncée en novembre 2010 et plus officiellement en mars 2011, la refonte complète de jQuery UI est enfin disponible. La version 1.9.0 a nécessité 30 mois de travail et la construction de nombreuses versions intermédiaires...

    Read the article

  • La mise à jour cumulative pour Windows 8 disponible, les utilisateurs n'auront pas besoin d'attendre un SP1 pour améliorer l'OS

    Windows 8 sera disponible en octobre la version RTM sera publiée début août MAJ du 10/07/2012 Microsoft met fin aux spéculations sur la date de sortie de la version finale de Windows 8. L'événement Worldwide Partner Conference (WPC), réservé aux partenaires de l'éditeur, qui se déroule actuellement à Toronto au Canada, a été l'occasion pour celui-ci de dévoiler officiellement la date de disponibilité de Windows 8. Le futur système d'exploitation de la firme de Redmond sera disponible en version finale fin octobre prochain. L'OS sera mis à la disposition des fabricants dès début août, afin que ceux-ci puissent décide...

    Read the article

  • Firefox 16 disponible : ajout du Developer Toolbar et d'un ramasse-miettes incrémental pour JavaScript

    Firefox s'offre une ligne de commande le Developer Toolbar permet d'interagir avec une page, la bêta de la version 16 sort Ce sont les vacances pour certains, mais pas pour la fondation Mozilla qui reste fidèle à son cycle de développement rapide de Firefox. À peine la version 15 du navigateur disponible, son successeur pointe déjà le bout de son nez. Mozilla vient de faire passer Firefox 16 du Canal Aurora au Canal bêta, et vante déjà la nouveauté phare qui sera disponible au sein du navigateur. Firefox 16 dispose d'une nouvelle ligne de commande, permettant aux développeurs d'interagir de façon ...

    Read the article

  • Webcast Replay : SANS Institute Product Review of Oracle Identity Manager

    - by B Shashikumar
    Thanks to everyone who attended the SANS Institute webinar covering the product review of Oracle Identity Manager. And a special thanks to our guest speakers from SuperValu - Phillip Black and Patrick Abreo. If you missed the webcast, you can catch a replay here  And here are the slides that were used in the webcast.  There were many questions that we could not answer as we ran out of time. We have captured some of the questions with responses below. Is Oracle Identity Analytics still offered as a separate product or is it part of Oracle Identity Manager? Oracle Identity Manager and Oracle Identity Analytics are now offered as part of Oracle Identity Governance Suite. OIA and OIM share a common UI architecture, common data model and common support for connected and disconnected resources.  When requesting new access/entitlements is there an approval process? Yes. We leverage SOA BPEL-based workflows for approvals  Are the identity self service capabilities based on Oracle ADF? Yes they are completely based on Oracle ADF  Can you give some examples of personalization and customization with Oracle Identity Manager 11gR2? With the new UI config framework we can enable different levels of UI customization. Customers now have the ability to Point & click to customize; or drag and drop customization without any need for coding. So users can easily personalize the interface of their application within the browser. For example, they can change the logo, Rearrange, hide Home Page regions; regularly searched items can be saved and re-used; Searchable & search results columns can be configured; Sorting preferences are remembered and so on. For more sophisticated customization, Customers can also edit the standard JSF within the page to alter business rules, modify page flows, page layouts and other items. Can you explain the role of sandboxes in customization? Customers can make their custom changes within a sandbox so that it doesn’t impact their production environment. They can make their changes, validate those changes, stage and then commit those changes without affecting production users. This is similar to how source code control systems like perforce work To watch a replay of the webcast, click here

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >