Monthly Archives

Articles indexed in July 2012

Page 151/169 | < Previous Page | 147 148 149 150 151 152 153 154 155 156 157 158  | Next Page >

  • Efficient visualization of a large voxelized volume

    - by Alejandro Piad
    Lets consider a large voxelized volume stored in an oct-tree or any other convenient structure. This volume represents, for instance, a landscape, where each block is either empty (air), or it has an specific material that will be later used to apply a texture. Voxels that are next to each other represent connected sections of the surface. What I need is an algorithm to generate a mesh from this voxels that represents the volume, with the following caracteristics: All the "holes" in the voxelized volume are correct. All the connections are correct, i.e. seamless. The surface appears smooth. In a broad sense, I want to somehow preserve the surface topology, meaning that connected sections remain connected in the resulting mesh and that the surface has a curvature that responds to the voxels topology. Imagine trying to render the Minecraft world but getting the mountain ladders to be smooth instead of blocky.

    Read the article

  • How can I improve this collision detection logic?

    - by Dan
    I’m trying to make an android game and I’m having a bit of trouble getting the collision detection to work. It works sometimes but my conditions aren’t specific enough and my program gets it wrong. How could I improve the following if conditions? public boolean checkColisionWithPlayer( Player player ) { // Top Left // Top Right // Bottom Right // Bottom Left // int[][] PP = { { player.x, player.y }, { player.x + player.width, player.y }, {player.x + player.height, player.y + player.width }, { player.x, player.y + player.height } }; // TOP LEFT - PLAYER // if( ( PP[0][0] > x && PP[0][0] < x + width ) && ( PP[0][1] > y && PP[0][1] < y + height ) && ( (x - player.x) < 0 ) ) { player.isColided = true; //player.isSpinning = false; // Collision On Right if( PP[0][0] > ( x + width/2 ) && ( PP[0][1] - y < ( x + width ) - PP[0][0] ) ) { Log.i("Colision", "Top Left - Right Side"); player.x = ( x + width ) + 1; player.Vh = player.phy.getVelsoityWallColision(player.Vh, player.Cr); } // Collision On Bottom else if( PP[0][1] > ( y + height/2 ) ) { Log.i("Colision", "Top Left - Bottom Side"); player.y = ( y + height ) + 1; if( player.Vv > 0 ) player.Vv = 0; } return true; } // TOP RIGHT - PLAYER // else if( ( PP[1][0] > x && PP[1][0] < x + width ) && ( PP[1][1] > y && PP[1][1] < y + height ) && ( (x - player.x) > 0 ) ) { player.isColided = true; //player.isSpinning = false; // Collision On Left if( PP[1][0] < ( x + width/2 ) && ( PP[1][0] - x < PP[1][1] - y ) ) { Log.i("Colision", "Top Right - Left Side"); player.x = ( x ) + 1; player.Vh = player.phy.getVelsoityWallColision(player.Vh, player.Cr); } // Collision On Bottom else if( PP[1][1] > ( y + height/2 ) ) { Log.i("Colision", "Top Right - Bottom Side"); player.y = ( y + height ) + 1; if( player.Vv > 0 ) player.Vv = 0; } return true; } // BOTTOM RIGHT - PLAYER // else if( ( PP[2][0] > x && PP[2][0] < x + width ) && ( PP[2][1] > y && PP[2][1] < y + height ) ) { player.isColided = true; //player.isSpinning = false; // Collision On Left if( PP[2][0] < ( x + width/2 ) && ( PP[2][0] - x < PP[2][1] - y ) ) { Log.i("Colision", "Bottom Right - Left Side"); player.x = ( x ) + 1; player.Vh = player.phy.getVelsoityWallColision(player.Vh, player.Cr); } // Collision On Top else if( PP[2][1] < ( y + height/2 ) ) { Log.i("Colision", "Bottom Right - Top Side"); player.y = y - player.height; player.Vv = player.phy.getVelsoityWallColision(player.Vv, player.Cr); //player.Vh = -1 * ( player.phy.getVelsoityWallColision(player.Vv, player.Cr) ); int rs = x - player.x; Log.i("RS", String.format("%d", rs)); if( rs > 0 ) { player.direction = -1; player.isSpinning = true; player.Vh = -0.5 * ( player.phy.getVelsoityWallColision(player.Vv, player.Cr) ); } if( rs < 0 ) { player.direction = 1; player.isSpinning = true; player.Vh = 0.5 * ( player.phy.getVelsoityWallColision(player.Vv, player.Cr) ); } player.rotateSpeed = 1 * rs; } return true; } // BOTTOM LEFT - PLAYER // else if( ( PP[3][0] > x && PP[3][0] < x + width ) && ( PP[3][1] > y && PP[3][1] < y + height ) )//&& ( (x - player.x) > 0 ) ) { player.isColided = true; //player.isSpinning = false; // Collision On Right if( PP[3][0] > ( x + width/2 ) && ( PP[3][1] - y < ( x + width ) - PP[3][0] ) ) { Log.i("Colision", "Bottom Left - Right Side"); player.x = ( x + width ) + 1; player.Vh = player.phy.getVelsoityWallColision(player.Vh, player.Cr); } // Collision On Top else if( PP[3][1] < ( y + height/2 ) ) { Log.i("Colision", "Bottom Left - Top Side"); player.y = y - player.height; player.Vv = player.phy.getVelsoityWallColision(player.Vv, player.Cr); //player.Vh = -1 * ( player.phy.getVelsoityWallColision(player.Vv, player.Cr) ); int rs = x - player.x; //Log.i("RS", String.format("%d", rs)); //player.direction = -1; //player.isSpinning = true; if( rs > 0 ) { player.direction = -1; player.isSpinning = true; player.Vh = -1 * ( player.phy.getVelsoityWallColision(player.Vv, player.Cr) ); } if( rs < 0 ) { player.direction = 1; player.isSpinning = true; player.Vh = 1 * ( player.phy.getVelsoityWallColision(player.Vv, player.Cr) ); } player.rotateSpeed = 1 * rs; } //try { Thread.sleep(1000, 0); } //catch (InterruptedException e) {} return true; } else { player.isColided = false; player.isSpinning = true; } return false; }

    Read the article

  • XNA content.load Dependancy

    - by Richard
    Quick question, My project i'm building for test purposes is working fine but i have dependencies flying around everywhere due to the XNA framework. In Update i have gametime passed everywhere... this is okay. In Draw i have gametime & spritebatch passed everywhere... this is okay. My issue is in the content.load textures/sounds/fonts. I have them as public variables ie Texture1 = Content.load(of texture2d)("Texture1") I'm passing a 'Game1' pointer into the constructor of every new class being instantiated to gain access to these variables. Am i missing an OOP trick to prevent me having to pass a pointer to 'game1' to every New class?

    Read the article

  • Game getting progressively laggier?

    - by Valentin Krummenacher
    I have a small game in HTML5 that uses socket.io to communicate with a node.js server. Now my problem is that, eversince I did my last update on it it seems to have something "chunk up" in the background making it laggier and laggier the longer it runs. In the update were a few temporary local variables being defined with var(you know, variables that are only used during one function and then not needed anymore) alongside with alot of other changes, and I am not even sure if this update or something else is causing this. Might the "var" have caused it? Or what other reasons might this strange complication have?

    Read the article

  • Updating scene graph in multithreaded game

    - by user782220
    In a game with a render thread and a game logic thread the game logic thread needs to update the scene graph used by the render thread. I've read about ideas such as a queue of updates. Can someone describe to a newbie at scene graphs what kind of interface the scene graph exports. Presumably it would be rather complicated. So then how does a queue of updates get implemented in C++ in a way that can handle the complexity of the interface of the scene graph while also being type safe and efficient. Again I'm a newbie at scene graphs and C++.

    Read the article

  • Adding VFACE semantic causes overlapping output semantics error

    - by user1423893
    My pixel shader input is a follows struct VertexShaderOut { float4 Position : POSITION0; float2 TextureCoordinates : TEXCOORD0; float4 PositionClone : TEXCOORD1; // Final position values must be cloned to be used in PS calculations float3 Normal : TEXCOORD2; //float3x3 TBN : TEXCOORD3; float CullFace : VFACE; // A negative value faces backwards (-1), while a positive value (+1) faces the camera (requires ps_3_0) }; I'm using ps_3_0 and I wish to utilise the VFACE semantic for correct lighting of normals depending on the cull mode. If I add the VFACE semantic then I get the following errors: error X5639: dcl usage+index: position,0 has already been specified for an output register error X4504: overlapping output semantics Why would this occur? I can't see why there would be too much data.

    Read the article

  • Why isn't my lighting working properly? Are my normals messed up?

    - by Radek Slupik
    I'm relatively new to OpenGL and I am trying to draw a 3D model (loaded from a 3ds file using lib3ds) using OpenGL with lighting, but about half of it is drawn in black. I set up the light as such: glEnable(GL_LIGHTING); glShadeModel(GL_SMOOTH); GLfloat ambientColor[] = {0.2f, 0.2f, 0.2f, 1.0f}; glLightModelfv(GL_LIGHT_MODEL_AMBIENT, ambientColor); glEnable(GL_LIGHT0); GLfloat lightColor0[] = {1.0f, 1.0f, 1.0f, 1.0f}; GLfloat lightPos0[] = {4.0f, 0.0f, 8.0f, 0.0f}; glLightfv(GL_LIGHT0, GL_DIFFUSE, lightColor0); glLightfv(GL_LIGHT0, GL_POSITION, lightPos0); The model is in a VBO and drawn using glDrawArrays. The normals are in a separate VBO, and the normals are calculated using lib3ds_mesh_calculate_vertex_normals: std::vector<std::array<float, 3>> normals; for (std::size_t i = 0; i < model->nmeshes; ++i) { auto& mesh = *model->meshes[i]; std::vector<float[3]> vertex_normals(mesh.nfaces * 3); lib3ds_mesh_calculate_vertex_normals(&mesh, vertex_normals.data()); for (std::size_t j = 0; j < mesh.nfaces; ++j) { auto& face = mesh.faces[j]; normals.push_back(make_array(vertex_normals[j])); } } glBindBuffer(GL_ARRAY_BUFFER, normal_vbo_); glBufferData(GL_ARRAY_BUFFER, normals.size() * sizeof(decltype(normals)::value_type), normals.data(), GL_STATIC_DRAW); The problem isn't the vertices; the model is drawn correctly when drawing it as a wireframe. I also fixed the normals in Blender using controlN. What could be the problem? Should I store the normals in a different order?

    Read the article

  • Opengl-es picking object

    - by lacas
    I saw a lot of picking code opengl-es, but nothing worked. Can someone give me what am I missing? My code is (from tutorials/forums) Vec3 far = Camera.getPosition(); Vec3 near = Shared.opengl().getPickingRay(ev.getX(), ev.getY(), 0); Vec3 direction = far.sub(near); direction.normalize(); Log.e("direction", direction.x+" "+direction.y+" "+direction.z); Ray mouseRay = new Ray(near, direction); for (int n=0; n<ObjectFactory.objects.size(); n++) { if (ObjectFactory.objects.get(n)!=null) { IObject obj = ObjectFactory.objects.get(n); float discriminant, b; float radius=0.1f; b = -mouseRay.getOrigin().dot(mouseRay.getDirection()); discriminant = b * b - mouseRay.getOrigin().dot(mouseRay.getOrigin()) + radius*radius; discriminant = FloatMath.sqrt(discriminant); double x1 = b - discriminant; double x2 = b + discriminant; Log.e("asd", obj.getName() + " "+discriminant+" "+x1+" "+x2); } } my camera vectors: //cam Vec3 position =new Vec3(-obj.getPosX()+x, obj.getPosZ()-0.3f, obj.getPosY()+z); Vec3 direction =new Vec3(-obj.getPosX(), obj.getPosZ(), obj.getPosY()); Vec3 up =new Vec3(0.0f, -1.0f, 0.0f); Camera.set(position, direction, up); and my picking code: public Vec3 getPickingRay(float mouseX, float mouseY, float mouseZ) { int[] viewport = getViewport(); float[] modelview = getModelView(); float[] projection = getProjection(); float winX, winY; float[] position = new float[4]; winX = (float)mouseX; winY = (float)Shared.screen.width - (float)mouseY; GLU.gluUnProject(winX, winY, mouseZ, modelview, 0, projection, 0, viewport, 0, position, 0); return new Vec3(position[0], position[1], position[2]); } My camera moving all the time in 3d space. and my actors/modells moving too. my camera is following one actor/modell and the user can move the camera on a circle on this model. How can I change the above code to working?

    Read the article

  • OpenGL ES 2.0: Mixing 2D with 3D

    - by Bunkai.Satori
    Is it possible to mix 2D and 3D graphics in a single OpenGL ES 2.0 game, please? I have plenty of 2D graphics in my game. The 2D graphics is represented by two triangular polygons (making up a rectangle) with texture on them. I use orthographic matrix to render the whole scene. However, I need to add some 3D effects into my game. Threfore, I wish to use perspective camera to render the meshes. Is it possible to mix orthographic and perspective camera in one scene? If yes, is there going to be a large performance cost for this? Is there any recommended approach to do this effectively? I wil have 90% of 2D graphics and only 10% of 3D. Target platform is OpenGL ES 2.0 (iOS, Android). I use C++ to develop. Thank you.

    Read the article

  • General advice from people in the industry - new graduate

    - by confusified
    I'm 20 years old and have just finished a 4 year Information Technology degree in Ireland, The main focus of the course was programming (mainly java) and software engineering. My question (posted in the wrong place as it may be) is : What technologies that I may not have studied should I attempt to teach myself that will be of the most benefit to me in searching for employment? All input appreciated.

    Read the article

  • Using ggplot in R

    - by g256
    I have a time series cvs file like this (in var there are the values): Hour,Date,Type,val1,val2,val3,val4,val5,val6..... 0100,0153,aaa, 0100,0153,bbb, 0100,0153,ccc, 0100,0153,ddd, 0200,0153,aaa, 0200,0153,bbb, 0200,0153,ccc, 0200,0153,ddd, . . 0100,0154,aaa, 0100,0154,bbb, 0100,0154,ccc, 0100,0154,ddd, . . I would like to use ggplot to plot the barplot mean of the time series of val1,val2,... for each type. One plot for each type except for ccc and ddd that should be considered as one type, so for this I should first sum up the value, then take the mean, then plot). So three plot at the end. Thanks for advice.

    Read the article

  • Add method to Array in Javascript

    - by user1167650
    Is it possible to add a method to an array() in javascript? (I know about prototypes, but I don't want to add a method to every array, just one in particular). The reason I want to do this is because I have the following code function drawChart() { //... return [list of important vars] } function updateChart(importantVars) { //... } var importantVars = drawChart(); updateChart(importantVars); And I want to be able to do something like this instead: var chart = drawChart();<br> chart.redraw(); I was hoping there was a way I could just attach a method to what i'm returning in drawChart(). Any way to do that?

    Read the article

  • Avoid Jquery Plugin Conflict

    - by user1511579
    on the same page i'm using this plugin: $g=jQuery.noConflict(); $g(function() { /* number of fieldsets */ var fieldsetCount = $g('#formElem').children().length; /* current position of fieldset / navigation link */ var current = 1; /* sum and save the widths of each one of the fieldsets set the final sum as the total width of the steps element */ var stepsWidth = 0; var widths = new Array(); $g('#steps .step').each(function(i){ var $step = $g(this); widths[i]   = stepsWidth; stepsWidth += $step.width(); }); $g('#steps').width(stepsWidth); /* to avoid problems in IE, focus the first input of the form */ $g('#formElem').children(':first').find(':input:first').focus(); /* show the navigation bar */ $g('#navigation_form').show(); /* when clicking on a navigation link  the form slides to the corresponding fieldset */ $g('#navigation_form a').bind('click',function(e){ var $this = $g(this); var prev = current; $this.closest('ul').find('li').removeClass('selected'); $this.parent().addClass('selected'); /* we store the position of the link in the current variable */ current = $this.parent().index() + 1; /* animate / slide to the next or to the corresponding fieldset. The order of the links in the navigation is the order of the fieldsets. Also, after sliding, we trigger the focus on the first  input element of the new fieldset If we clicked on the last link (confirmation), then we validate all the fieldsets, otherwise we validate the previous one before the form slided */ $g('#steps').stop().animate({ marginLeft: '-' + widths[current-1] + 'px' },500,function(){ if(current == fieldsetCount) validateSteps(); else validateStep(prev); $g('#formElem').children(':nth-child('+ parseInt(current) +')').find(':input:first').focus(); }); e.preventDefault(); }); /* clicking on the tab (on the last input of each fieldset), makes the form slide to the next step */ $g('#formElem > fieldset').each(function(){ var $fieldset = $g(this); $fieldset.children(':last').find(':input').keydown(function(e){ if (e.which == 9){ $g('#navigation_form li:nth-child(' + (parseInt(current)+1) + ') a').click(); /* force the blur for validation */ $g(this).blur(); e.preventDefault(); } }); }); /* validates errors on all the fieldsets records if the Form has errors in $('#formElem').data() */ function validateSteps(){ var FormErrors = false; for(var i = 1; i < fieldsetCount; ++i){ var error = validateStep(i); if(error == -1) FormErrors = true; } $g('#formElem').data('errors',FormErrors); } /* validates one fieldset and returns -1 if errors found, or 1 if not */ function validateStep(step){ if(step == fieldsetCount) return; var error = 1; var hasError = false; $g('#formElem').children(':nth-child('+ parseInt(step) +')').find(':input:not(button)').each(function(){ var $this = $g(this); var valueLength = jQuery.trim($this.val()).length; if(valueLength == ''){ hasError = true; $this.css('background-color','#FFEDEF'); } else $this.css('background-color','#FFFFFF'); }); var $link = $g('#navigation_form li:nth-child(' + parseInt(step) + ') a'); $link.parent().find('.error,.checked').remove(); var valclass = 'checked'; if(hasError){ error = -1; valclass = 'error'; } $g('<span class="'+valclass+'"></span>').insertAfter($link); return error; } /* if there are errors don't allow the user to submit */ $g('#registerButton').bind('click',function(){ if($g('#formElem').data('errors')){ alert('Please correct the errors in the Form'); return false; } }); }); and this one: (function($){ $countCursos = 1; $countFormsA = 1; $countFormsB = 1; $.fn.addForms = function(idform){ var adicionar_curso = "<p>"+ " <label for='nome_curso'>Nome do Curso</label>"+ " <input id='nome_curso' name='nome_curso["+$countCursos+"]' type='text' />"+ " </p>"; var myform2 = "<table>"+ " <tr>"+ " <td>Field C</td>"+ " <td><input type='text' name='fieldc["+$countFormsA+"]'></td>"+ " <td>Field D ("+$countFormsA+"):</td>"+ " <td><textarea name='fieldd["+$countFormsA+"]'></textarea></td>"+ " <td><button>remove</button></td>"+ " </tr>"+ "</table>"; var myform3 = "<table>"+ " <tr>"+ " <td>Field C</td>"+ " <td><input type='text' name='fieldc["+$countFormsB+"]'></td>"+ " <td>Field D ("+$countFormsB+"):</td>"+ " <td><textarea name='fieldd["+$countFormsB+"]'></textarea></td>"+ " <td><button>remove</button></td>"+ " </tr>"+ "</table>"; if(idform=='novo_curso'){ alert(idform); adicionar_curso = $("<div>"+adicionar_curso+"</div>"); $("button", $(adicionar_curso)).click(function(){ $(this).parent().parent().remove(); }); $(this).append(adicionar_curso); $countCursos++; } if(idform=='mybutton1'){ alert(idform); myform2 = $("<div>"+myform2+"</div>"); $("button", $(myform2)).click(function(){ $(this).parent().parent().remove(); }); $(this).append(myform2); $countFormsA++; } if(idform=='mybutton2'){ alert(idform); myform3 = $("<div>"+myform3+"</div>"); $("button", $(myform3)).click(function(){ $(this).parent().parent().remove(); }); $(this).append(myform3); $countFormsB++; } }; })(jQuery); $(function(){ $("#mybutton1").bind("click", function(e){ e.preventDefault(); var idform=this.id; if($countFormsA<3){ $("#container1").addForms(idform); } }); }); $(function(){ $("#novo_curso").bind("click", function(e){ e.preventDefault(); var idform=this.id; alert(idform); if($countCursos<3){ $("#outro_curso").addForms(idform); } }); }); $(function(){ $("#mybutton2").bind("click", function(e){ e.preventDefault(); var idform=this.id; if($countFormsB<3){ $("#container2").addForms(idform); } }); }); My problem is the two are making conflict: I added previously the $g on the first to avoid conflict, but the truth is they don't work together, any hint how can i configure the second one to avoid this? Thanks in advance!

    Read the article

  • UISearchBar in UINavigationBar with ScopeBar

    - by ncipollina
    I am trying to put a UISearchBar inside of the UINavigationBar, which I am able to do without much problem. The problem is that I have logic when editing to show the Scope Bar. This all works fine, with one exception. The navigation bar tries to center the UISearchBar inside of the title view. This causes the search bar to move up above the navigation bar. I tried adding some logic to set the frame of the search bar so that it just draws overtop of my main view, which is fine. I can only set the height, which causes the search bar to draw over the view just fine, but it isn't wide enough to cover the whole screen. If I set the width on the frame, it goes back to the same behavior of trying to center the UISearchBar on the navigation bar. Anyone know how I can accomplish this? Thanks, Nick

    Read the article

  • Why isn't the inline element inheriting height from its children?

    - by jbarz
    I'm trying to make a rather complicated grid of images and information (almost like Pinterest). Specifically, I'm trying to inline position one set of <ul>s right after another. I have it working but one aspect is causing issues so I'm trying to ask about this small piece to avoid the complication of the whole problem. In order to horizontally align the images and their information we are using inline <li>s with other inline-block level elements inside of them. Everything works correctly for the most part except that the <li>s have almost no height. HTML and CSS is in JSFiddle here if you want to mess with it in addition to below: HTML: <div> <ul class="Container"> <li> <span class="Item"> <a href="#"><img src="http://jsfiddle.net/img/logo.png"/></a> <span class="Info"> <a href="#">Title One</a> <span class="Details">One Point One</span> </span> </span> </li> <li> <span class="Item"> <a href="#"><img src="http://jsfiddle.net/img/logo.png"/></a> <span class="Info"> <a href="#">Title Two</a> <span class="Details">Two Point One</span> </span> </span> </li> </ul> CSS: .Container { list-style-type:none; } .Container li { background-color:grey; display:inline; text-align:center; } .Container li .Item { border:solid 2px #ccc; display:inline-block; min-height:50px; vertical-align:top; width:170px; } .Container li .Item .Info { display:inline-block; } .Container li .Item .Info a { display:inline-block; width:160px; } If you check out the result in the jsfiddle link you can see that the grey background only encompasses a small strip of the whole <li>. I know that changing the <li> to display:inline-block solves this problem but that isn't feasible for other reasons. So first of all, I'm just looking to see if anyone understands why the inline <li> element doesn't have any height. I can't find anything in the spec that explains this. I know I can't add height to an inline element but any explanation as to why this is happening that might enable me to fix would be great. Secondly, if you inspect the elements using IE's Developer Mode you will see that although the background color is in the correct location, the actual location of the <li>'s bounding box is at the bottom of the container according to hovering over the element. I could deal with this problem if it was at the top in every browser but it apparently varies. NOTE: I don't really care about older browsers in this case but I don't use HTML5 or JavaScript positioning. Thanks.

    Read the article

  • With HTML and CSS, how to have an image that is vertically aligned with a horizontal line?

    - by sungod000
    I'd like the image on the left to be adjacent to the horizontal line on the right (bottoms lining up flush). It should be responsive so that the line can change widths as needed. Right now, the image is sitting on top of the line, not beside it. Here is the HTML <div> <img src="image.png"> <hr> </div> Here is the CSS img { float:left } hr { width:100% } How to make this happen?

    Read the article

  • How to check if numbers are in correct sequence?

    - by Nazariy
    I have a two dimensional array that contain range of numbers that have to be validated using following rules, range should start from 0 and follow in arithmetic progression. For example: $array = array(); $array[] = array(0);//VALID $array[] = array(0,1,2,3,4,5);//VALID $array[] = array("0","1");//VALID $array[] = array(0,1,3,4,5,6);//WRONG $array[] = array(1,2,3,4,5);//WRONG $array[] = array(0,0,1,2,3,4);//WRONG what is most efficient way to do that in php? UPDATE I forgot to add that numbers can be represented as string

    Read the article

  • Figure and figcaption figures shrink images

    - by Why Not
    I'm attempting to use the figure and figcaption tags to varying success. Someone suggested a great CSS method to get rid of the figure margin and also link up the caption with the image. The problem: all images shrink to an extremely small size. Not sure how to rectify this. These are user-submitted images using Django so they vary in size. But currently, using these fixes, all of these shrink with a caption that does fit the image but defeats the purpose as it results in a tiny image with a caption with an even width. {% if story.pic %} <h2>Image</h2> <figure> <img class="image"src="{{ story.pic.url }}" alt="some_image_alt_text"/> {% if story.caption %} <figcaption>{{story.caption}}</figcaption> {% endif %} </figure> {% endif %} figure {margin:0; display:table; width:1px;} figcaption {display:table-row;}

    Read the article

  • Getting invalid context errors

    - by Andrew
    I don't have much code thus far, only this to start: UIGraphicsBeginImageContextWithOptions(bounds.size, NO, 0); CGContextRef context = UIGraphicsGetCurrentContext(); CGMutablePathRef outerPath; CGMutablePathRef highlightPath; CGRect outerRect = rectForRectWithInset(bounds, 1); CGRect highlightRect = CGRectMake(outerRect.origin.x, outerRect.origin.y + 1, outerRect.size.width, outerRect.size.height); And then the problematic bit, which when commented out, the error goes away: CGContextSaveGState(context); CGContextAddPath(context, highlightPath); CGContextSetFillColorWithColor(context, [[UIColor colorWithWhite:1.0 alpha:0.05]CGColor]); CGContextFillPath(context); CGContextRestoreGState(context); Below that is simply: UIImage *image = UIGraphicsGetImageFromCurrentImageContext(); UIGraphicsEndImageContext();

    Read the article

  • Storing Object Types in Variable then Initializing

    - by Jon Mattingly
    Is there a way in Objective-C to store an object/class in a variable to be passed to alloc/init somewhere else? For example: UIViewController = foo foo *bar = [[foo alloc] init] I'm trying to create a system to dynamically create navigation buttons in a separate class based on the current view controller. I can pass 'self' to the method, but the variable that results does not allow me to alloc/init. I could always import the .h file directly, but ideally I would like to make reusing the code as simple as possible. Maybe I'm going about this the wrong way?

    Read the article

  • Passing variables, creating instances, self, The mechanics and usage of classes: need explenation

    - by Baf
    I've been sitting over this the whole day and Im a little tired already so please excuse me being brief. Im new to python. I just rewrrote a working program, into a bunch of functions in a class and everzthings messed up. I dont know if its me but Im very surprised i couldn t find a beginners tutorial on how to handle classes on the web so I have a few questions. First of all, in the init section of the class i have declared a bunch of variables with self.variable=something. Is it correct that i should be able to access/modify these variables in every function of the class by using self.variable in that function? In other words by declaring self.variable i have made these variables, global variables in the scope of the class right? If not how do i handle self. ? Secondly how do i correctly pass arguments to the class? some example code would be cool. thirdly how do i call a function of the class outside of the class scope? some example code would be cool. fouthly how do I create an Instance of the class INITIALCLASS in another class OTHERCLASS, passing variables from OTHERCLASS to INITIALCLASS? some example code would be cool. I Want to call a function from OTHERCLASS with arguments from INITIALCLASS. What Ive done so far is. class OTHERCLASS(): def __init__(self,variable1,variable2,variable3): self.variable1=variable1 self.variable2=variable2 self.variable3=variable3 def someotherfunction(self): something=somecode(using self.variable3) self.variable2.append(something) print self.variable2 def somemorefunctions(self): self.variable2.append(variable1) class INITIALCLASS(): def __init__(self): self.variable1=value1 self.variable2=[] self.variable3='' self.DoIt=OTHERCLASS(variable1,variable2,variable3) def somefunction(self): variable3=Somecode #tried this self.DoIt.someotherfunctions() #and this DoIt.someotherfunctions() I clearly havent understood how to pass variables to classes or how to handle self, when to use it and when not, I probably also havent understood how to properly create an isntance of a class. In general i havent udnerstood the mechanics of classes So please help me and explain it to me like i have no Idea( which i dont it seems). Or point me to a thorough video, or readable tutorial. All i find on the web is super simple examples, that didnt help me much. Or just very short definitions of classes and class methods instances etc. I can send you my original code if you guys want, but its quite long. Thanks for the Help Much appreciated!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Where to delete model image?

    - by WesDec
    I have a Model with an image field and I want to be able to change the image using a ModelForm. When changing the image, the old image should be deleted and replaced by the new image. I have tried to do this in the clean method of the ModelForm like this: def clean(self): cleaned_data = super(ModelForm, self).clean() old_profile_image = self.instance.image if old_profile_image: old_profile_image.delete(save=False) return cleaned_data This works fine unless the file indicated by the user is not correct (for example if its not an image), which result in the image being deleted without any new images being saved. I would like to know where is the best place to delete the old image? By this I mean where can I be sure that the new image is correct before deleting the old one?

    Read the article

  • Is it possible to read infinity or NaN values using input streams?

    - by Drise
    I have some input to be read by a input filestream (for example): -365.269511 -0.356123 -Inf 0.000000 When I use std::ifstream mystream; to read from the file to some double d1 = -1, d2 = -1, d3 = -1, d4 = -1; (assume mystream has already been opened and the file is valid), mystream >> d1 >> d2 >> d3 >> d4; mystream is in the fail state. I would expect std::cout << d1 << " " << d2 << " " << d3 << " " << d4 << std::endl; to output -365.269511 -0.356123 -1 -1. I would want it to output -365.269511 -0.356123 -Inf 0 instead. This set of data was output using C++ streams. Why can't I do the reverse process (read in my output)? How can I get the functionality I seek? From MooingDuck: #include <iostream> #include <limits> using namespace std; int main() { double myd = std::numeric_limits<double>::infinity(); cout << myd << '\n'; cin >> myd; cout << cin.good() << ":" << myd << endl; return 0; } Input: inf Output: inf 0:inf See also: http://ideone.com/jVvei Also related to this problem is NaN parsing, even though I do not give examples for it.

    Read the article

  • Getting a Specified Cast is not valid while importing data from Excel using Linq to SQL

    - by niceoneishere
    This is my second post. After learning from my first post how fantastic is to use Linq to SQL, I wanted to try to import data from a Excel sheet into my SQL database. First My Excel Sheet: it contains 4 columns namely ItemNo ItemSize ItemPrice UnitsSold I have a created a database table with the following fields table name ProductsSold Id int not null identity --with auto increment set to true ItemNo VarChar(10) not null ItemSize VarChar(4) not null ItemPrice Decimal(18,2) not null UnitsSold int not null Now I created a dal.dbml file based on my database and I am trying to import the data from excel sheet to db table using the code below. Everything is happening on click of a button. private const string forecast_query = "SELECT ItemNo, ItemSize, ItemPrice, UnitsSold FROM [Sheet1$]"; protected void btnUpload_Click(object sender, EventArgs e) { var importer = new LinqSqlModelImporter(); if (fileUpload.HasFile) { var uploadFile = new UploadFile(fileUpload.FileName); try { fileUpload.SaveAs(uploadFile.SavePath); if(File.Exists(uploadFile.SavePath)) { importer.SourceConnectionString = uploadFile.GetOleDbConnectionString(); importer.Import(forecast_query); gvDisplay.DataBind(); pnDisplay.Visible = true; } } catch (Exception ex) { Response.Write(ex.Source.ToString()); lblInfo.Text = ex.Message; } finally { uploadFile.DeleteFileNoException(); } } } // Now here is the code for LinqSqlModelImporter public class LinqSqlModelImporter : SqlImporter { public override void Import(string query) { // importing data using oledb command and inserting into db using LINQ to SQL using (var context = new WSDALDataContext()) { using (var myConnection = new OleDbConnection(base.SourceConnectionString)) using (var myCommand = new OleDbCommand(query, myConnection)) { myConnection.Open(); var myReader = myCommand.ExecuteReader(); while (myReader.Read()) { context.ProductsSolds.InsertOnSubmit(new ProductsSold() { ItemNo = myReader.GetString(0), ItemSize = myReader.GetString(1), ItemPrice = myReader.GetDecimal(2), UnitsSold = myReader.GetInt32(3) }); } } context.SubmitChanges(); } } } can someone please tell me where am I making the error or if I am missing something, but this is driving me nuts. When I debugged I am getting this error when casting from a number the value must be a number less than infinity I really appreciate it

    Read the article

< Previous Page | 147 148 149 150 151 152 153 154 155 156 157 158  | Next Page >