Search Results

Search found 55134 results on 2206 pages for 'argument error'.

Page 1191/2206 | < Previous Page | 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198  | Next Page >

  • insserv: Script <SCRIPT_NAME> is broken: missing end of LSB comment.

    - by udo
    I am getting this error when running: insserv -r udo-startup.sh insserv: Script udo-startup.sh is broken: missing end of LSB comment. insserv: exiting now! The content of udo-startup.sh is this: #!/bin/bash ### BEGIN INIT INFO # Provides: udo-startup.sh # Required-Start: $local_fs $remote_fs $network $syslog # Required-Stop: $local_fs $remote_fs $network $syslog # Default-Start: 2 3 4 5 # Default-Stop: 0 1 6 # Short-Description: - # Description: - ### END INIT INF ID=$(xinput list | grep -i touchpad | sed '/TouchPad/s/^.*id=\([0-9]*\).*$/\1/') xinput set-prop $ID "Device Enabled" 0 exit 0

    Read the article

  • SSL certificate only valid when viewed externally

    - by user23522
    We have a SSL certificate installed on our server. When viewed externally it validates correctly, however when the website is viewed from the server it gets an invalid certificate error. We are using the fully qualified domain name to access it for both? Is there any reason this should be happening? Cheers.

    Read the article

  • could not connect to server: Operation timed out

    - by JohnMerlino
    I am able to ssh into my ubuntu server with a user name and password from the terminal. However, when I try to connect to the server using the same name and password via pgadmin, I am getting the following error: could not connect to server: Operation timed out Is the server running on host "xx.xxx.xx.xxx" and accepting TCP/IP connections on port 5432? Why am I able to connect through terminal but not pgadmin?

    Read the article

  • configuration required for HIVE to be installed on a node

    - by ????? ????????
    I went through the process of manually installing ambari (not through SSH, because I couldnt get keyless to work) and everything installed OK, except for HIVE and GANGLIA. I got this message: stderr: None stdout: warning: Unrecognised escape sequence ‘\;’ in file /var/lib/ambari-agent/puppet/modules/hdp-hive/manifests/hive/service_check.pp at line 32 warning: Dynamic lookup of $configuration is deprecated. Support will be removed in Puppet 2.8. Use a fully-qualified variable name (e.g., $classname::variable) or parameterized classes. notice: /Stage[1]/Hdp::Snappy::Package/Hdp::Snappy::Package::Ln[32]/Hdp::Exec[hdp::snappy::package::ln 32]/Exec[hdp::snappy::package::ln 32]/returns: executed successfully notice: /Stage[2]/Hdp-hive::Hive::Service_check/File[/tmp/hiveserver2Smoke.sh]/ensure: defined content as ‘{md5}7f1d24221266a2330ec55ba620c015a9' notice: /Stage[2]/Hdp-hive::Hive::Service_check/File[/tmp/hiveserver2.sql]/ensure: defined content as ‘{md5}0c429dc9ae0867b5af74ef85b5530d84' notice: /Stage[2]/Hdp-hcat::Hcat::Service_check/File[/tmp/hcatSmoke.sh]/ensure: defined content as ‘{md5}bae7742f7083db968cb6b2bd208874cb’ notice: /Stage[2]/Hdp-hcat::Hcat::Service_check/Exec[hcatSmoke.sh prepare]/returns: 13/06/25 03:11:56 WARN conf.HiveConf: DEPRECATED: Configuration property hive.metastore.local no longer has any effect. Make sure to provide a valid value for hive.metastore.uris if you are connecting to a remote metastore. notice: /Stage[2]/Hdp-hcat::Hcat::Service_check/Exec[hcatSmoke.sh prepare]/returns: FAILED: SemanticException org.apache.hadoop.hive.ql.parse.SemanticException: org.apache.hadoop.hive.ql.metadata.HiveException: java.lang.RuntimeException: Unable to instantiate org.apache.hadoop.hive.metastore.HiveMetaStoreClient notice: /Stage[2]/Hdp-hcat::Hcat::Service_check/Exec[hcatSmoke.sh prepare]/returns: 13/06/25 03:12:06 WARN conf.HiveConf: DEPRECATED: Configuration property hive.metastore.local no longer has any effect. Make sure to provide a valid value for hive.metastore.uris if you are connecting to a remote metastore. notice: /Stage[2]/Hdp-hcat::Hcat::Service_check/Exec[hcatSmoke.sh prepare]/returns: FAILED: SemanticException [Error 10001]: Table not found hcatsmokeida8c07401_date102513 notice: /Stage[2]/Hdp-hcat::Hcat::Service_check/Exec[hcatSmoke.sh prepare]/returns: 13/06/25 03:12:15 WARN conf.HiveConf: DEPRECATED: Configuration property hive.metastore.local no longer has any effect. Make sure to provide a valid value for hive.metastore.uris if you are connecting to a remote metastore. notice: /Stage[2]/Hdp-hcat::Hcat::Service_check/Exec[hcatSmoke.sh prepare]/returns: FAILED: SemanticException o When i go to the alerts and health checks i’m getting this: ive Metastore status check CRIT for 42 minutes CRITICAL: Error accessing hive-metaserver status [13/06/25 03:44:06 WARN conf.HiveConf: DEPRECATED: Configuration property hive.metastore.local no longer has any effect. What am I doing wrong? I have already tried to do ambari-server reset on the the database without results.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • PHPMyAdmin works with https Only (not http)

    - by 01010011
    Hi I've been having a problem getting phpmyadmin to work consistently on my XP desktop and laptop computers for months now. When I type into Chrome's browser on both machines, localhost/phpmyadmin, I kept getting Error #1045 Access Denied for user at root@localhost (using password yes). Eventually, I realized that I had two (2) versions of mysql installed (XAMPP and MySQL Server 5.1) on both machines. So I uninstalled the MySQL Server 5.1I from the desktop and phpmyadmin worked. But when I uninstalled MySQL Server 5.1 from my laptop, it did not work. But I realized I could still get into MySQL Commandline Client using my password and that my databases were still intact. So I uninstalled and reinstalled XAMPP on the laptop and phpmyadmin worked after that. Now I have a new problem. On phpMyAdmin's home page has a message at the bottom: Your configuration file contains settings (root with no password) that correspond to the default MySQL privileged account. Your MySQL server is running with this default, is open to intrusion, and you really should fix this security hole by setting a password for user 'root'. So I located the following lines in config.inc.php file: /* Authentication type and info */ $cfg['Servers'][$i]['auth_type'] = 'config'; $cfg['Servers'][$i]['user'] = 'root'; $cfg['Servers'][$i]['password'] = ''; $cfg['Servers'][$i]['AllowNoPassword'] = true; and I just changed the last 2 lines as follows: $cfg['Servers'][$i]['password'] = 'mypassword'; $cfg['Servers'][$i]['AllowNoPassword'] = false; As soon as I did that and I tried to access phpmyadmin again, I got the Error #1045 message again, but when I tried https://localhost/phpmyadmin/ I got a red page saying this sites certificate is not trusted would you like to proceed anyway. And now it only works using https. I would really like to settle all my phpmyadmin problems once and for all so here are my questions: 1. Why does my laptop only access phpmyadmin via https? 2. How do I change my password in my configuration file? Also, if you have any other tips regarding phpMyAdmin, they are very welcome. Thanks in advance

    Read the article

  • Getting Wireless working on Dell Inspiron 1545 in Ubuntu 10.04?

    - by Dexter
    I'm trying to install my wireless drivers (which uses a broadcom card). I tried to install them using the restricted drivers offered on my Ubuntu CD. However when I clicked activate it got about halfway through the install process before it gave me this error message: SystemError: installArchives() failed How can I correct this?

    Read the article

  • Extract specific files in a tar archive using a wildcard

    - by AdrieanKhisbe
    I'm tring for a script to extract only jpeg pictures from an archive containing maky kind of files. To do so I tried first to use: tar -xf MyTar.tar *.jpg but it failed (*.jpg not found) and suggest me to use "--wildcard". So I tried tar -xf MyTar.tar --wildcard *.jpg I did that, but then the same error and a different warning saying yo me that the option "--wildcard" is ambigious. I've been over the manuel pages for tar, but didn't find a clue about the problem thanks

    Read the article

  • Windows 2003 registry corrupt - endless reboot

    - by Jack
    Windows 2003 will run the loading screen then it stop with "Stop c000218 registry file failure or corrupt. The registry can not load the hive \systemroot\system32\config\security" then it start a count down about dumping the physical memory to disk and reboot itself again. I found Error starting Windows SBS 2003 - STOP: c0000218 but the config is different directory than mine. Is it the same step to try for recovery console?

    Read the article

  • Core i7 c1e and speedstepping - BSOD on shutdown

    - by DeaconDesperado
    I'm having an interesting problem with my recent Core i7 Digital Audio workstation build that I am curious to see if others have encountered. First, here are the specs on the machine. ASUS P6TD Deluxe Intel X58 Socket LGA1366 MB Intel Core i7-950 3.06Ghz 8M LGA1366 CPU CORSAIR DOMINATOR 6GB (3 x 2GB) 240-Pin DDR3 SDRAM DDR3 1600 Western Digital Caviar Black WD5001AALS 500GB Plus a couple ASUS optical drives and a 750W Corsair PSU. Running Windows 7 x64. All this is connected to the nefarious Digi 002 firewire audio interface for use with Pro Tools. I following mostly the specs posted by many other I7 users in the digidesign community who pooled their collective knowledge in this thread. Now after completing my build, I fell victim to the "UD5 squeal" described at that forum thread. So taking the advice posted, I disabled c1e advanced halt state and Intel speed stepping (I would likely have done this anyway to maintain a stable clock, power consumption isn't really a relevant concern on this machine.) I enabled XMP to set the ram timings properly as well. What I am experiencing is a BSOD upon shutdown, but only immediately after windows fully exits and ends all processes. The error is a MACHINE_CHECK_EXCEPTION 0x000000. The funny thing is that it is extremely intermitent and only occurs if the shutdown immediately followed a period of relative idleness. It does not a generate a minidump, I suspect because windows monitoring has terminated by the time this error occurs. No damage is evident and one can simply turn off manually and the system will act as though a proper shutdown had occurred. If anything it is a annoyance, I just want to be certain it is not affecting my long term stability. I have read that the i7 950 does not like DRAM voltages past 1.65, but that they are acceptable if they are within .5 of the BLCK setting. I have tried disabling XMP and setting all timings to auto and the problem still manifests in an identical way. It is suspect that the cpu idleness preceding shutdown is the determining factor, as both c1e and speedstepping are both settings intended to modify handling of this state. Any suggestions or prior experiences would be greatly appreciated. EDIT: The behavior very closely resembles what's described in this thread: http://www.tomshardware.com/forum/12003-63-shut-problem-windows The benign nature of it of is identical. I can't seem to download the hotfix cited there however.

    Read the article

  • Password Won't Work after Crash

    - by Jack Cornell
    My Win 7 computer locked up, so I shut it down (holding down the power button till it shut off). Logging back on, I got an error message that it couldn't load my profile (like I'm entering the wrong password). I logged on the guest account, but can't change anything because it won't accept my password. Is this a serious problem or do I just need to reset the password with one of the options available on your site?

    Read the article

  • nginx proxypath https redirects to http

    - by Thermionix
    I'm trying to setup Nginx to forward requests to several backend services using proxy_pass however several pages load with 404s The links on the pages have https:// in front, but result in a http request - which ends in a 404 - I only want these services to be available through https. I've tried with varied trailing forward slashes appended to the proxypath and location in proxy.conf, I've also tried commenting out www.conf (just incase its location blocks could have caused any conflicts) to no effect. So if a link is too https://example.com/sickbeard/errorlogs in a browser when loaded https://example.com/sickbeard/errorlogs gives a 404 in a browser https://example.com/sickbeard/errorlogs/ loads nginx error log; 2011/11/23 14:21:58 [error] 28882#0: *6 "/var/www/sickbeard/errorlogs/recent.html" is not found (2: No such file or directory), client: 192.168.1.99, server: example.com, request: "GET /sickbeard/errorlogs/ HTTP/1.1", host: "example.com" Config files; proxy.conf location /sickbeard { proxy_pass http://localhost:8081/sickbeard; include proxy.inc; } .... more entries .... sites-enabled/main server { listen 80; include www.conf; } server { listen 443; include proxy.conf; include www.conf; ssl on; } www.conf root /var/www; server_name example.com; location / { autoindex off; allow all; rewrite ^/$ /mainsite last; location ~* \.(jpg|jpeg|gif|css|png|js|ico)$ { expires max; } location ~ \.php$ { fastcgi_index index.php; include fastcgi_params; if (-f $request_filename) { fastcgi_pass 127.0.0.1:9000; } } } proxy.inc proxy_connect_timeout 59s; proxy_send_timeout 600; proxy_read_timeout 600; proxy_buffer_size 64k; proxy_buffers 16 32k; proxy_pass_header Set-Cookie; proxy_redirect off; proxy_hide_header Vary; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; proxy_set_header Accept-Encoding ''; proxy_ignore_headers Cache-Control Expires; proxy_set_header Referer $http_referer; proxy_set_header Host $host; proxy_set_header Cookie $http_cookie; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-Host $host; proxy_set_header X-Forwarded-Server $host; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for;

    Read the article

  • How to start nginx via different port(other than 80)

    - by Zhao Peng
    Hi I am a newbie on nginx, I tried to set it up on my server(running Ubuntu 4), which already has apache running. So after I apt-get install it, I tried to start nginx. Then I get the message like this: Starting nginx: the configuration file /etc/nginx/nginx.conf syntax is ok configuration file /etc/nginx/nginx.conf test is successful [emerg]: bind() to 0.0.0.0:80 failed (98: Address already in use) [emerg]: bind() to 0.0.0.0:80 failed (98: Address already in use) [emerg]: bind() to 0.0.0.0:80 failed (98: Address already in use) [emerg]: bind() to 0.0.0.0:80 failed (98: Address already in use) [emerg]: bind() to 0.0.0.0:80 failed (98: Address already in use) That makes sense as Apache is using port 80. Then I tried to modify nginx.conf, I reference some articles, so I changed it like so: server { listen 8080; location / { proxy_pass http://94.143.9.34:9500; proxy_set_header Host $host:8080; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Via "nginx"; } After saving this and try to start nginx again, I still get the same error as previously. I cannot really find a related post about this, could any good people shred some light? Thanks in advance :) ========================================================================= I should post all the content in conf here: user www-data; worker_processes 1; error_log /var/log/nginx/error.log; pid /var/run/nginx.pid; events { worker_connections 1024; # multi_accept on; } http { include /etc/nginx/mime.types; access_log /var/log/nginx/access.log; sendfile on; #tcp_nopush on; #keepalive_timeout 0; keepalive_timeout 65; tcp_nodelay on; gzip on; gzip_disable "MSIE [1-6]\.(?!.*SV1)"; include /etc/nginx/conf.d/*.conf; include /etc/nginx/sites-enabled/*; server { listen 81; location / { proxy_pass http://94.143.9.34:9500; proxy_set_header Host $host:81; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for; proxy_set_header Via "nginx"; } } } mail { See sample authentication script at: http://wiki.nginx.org/NginxImapAuthenticateWithApachePhpScript auth_http localhost/auth.php; pop3_capabilities "TOP" "USER"; imap_capabilities "IMAP4rev1" "UIDPLUS"; server { listen localhost:110; protocol pop3; proxy on; } server { listen localhost:143; protocol imap; proxy on; } } Basically, I changed nothing except adding the server part.

    Read the article

  • Accessing MySQL server via VPN in python

    - by user210481
    Hi I have a MySQL server that I need access through a VPN. I use MySQLdb package to access MySQL server in Python. When I can access the server without VPN, it works fine, but when I'm at certain locations, I need to connect through VPN. My computer is connected to the VPN and I can access the database through PHPMyAdmin, but MySQLdb gives me an error message: OperationalError: (2003, "Can't connect to MySQL server on 'MY_IP' (10061)") Any ideas on why it's not working? Thanks

    Read the article

  • What is the best way to run emacs under Windows?

    - by Zubair
    I tried using the GNU Emacs download, unzipped it and then clicked on emacs.exe, but got some obscure error. Then I tried Cygwin emacs, but when I press ctrl x ctrl c to quit emacs it thinks I pressed ctrl x ctrl "g"!!! I checked all the key mapping and they work otherwise in Emacs. Is there another version of emacs for windows that just works!

    Read the article

  • QMail Problem: Can't send email to one specific domain

    - by Andrew Phillips
    I'm running qmail as part of a Plesk installation on a Debian server. Everything works fine apart from any emails sent to @nandos.co.uk. I get no error messages they just end up stuck in the queue for eternity. I have no idea what is going on, because as far as I can tell this is the ONLY domain the server won't send emails to. Any ideas? TIA

    Read the article

  • Broadcom 440x Ethernet NIC Drivers and Windows Home Server

    - by scottman666
    I have installed Windows Home Server on an older Dell computer, and it uses a Broadcom 440x Ethernet NIC driver. I have tried all of the drivers listed on their drivers page to no luck. The error message I get when trying to install is: "The parameter is incorrect" I know it is a long shot, but anybody have any suggestions? Thanks!

    Read the article

  • Ubuntu Equivalent of Unix Command cp -n

    - by Ted Karmel
    A software I need to install on my Ubuntu Hardy has a MAKE file which includes the command cp -n. However, I get an error stating the -n is an invalid option. The command will work on a Mac terminal but I need it to work on Ubuntu. Does anyone know the equivalent command for Ubuntu? Thanks.

    Read the article

  • Increase process memory cap.

    - by Janis Veinbergs
    Doing copy/paste in Visual Studio 2010 RTM on Windows 7, 3GB ram machine, I was unable to copy text because of an error: Task Manager shows that devenv.exe is using a little more than 500MB. However I still have almost 1GB of free RAM available. Is that somekind of memory cap? If so, is there a way to increase it? It may be a bug, but maybe there is a workaround?

    Read the article

  • Trying to setup a PHP daemon using System_Daemon and I'm having issues getting it to run.

    - by yummm
    I get the following error when trying to start a daemon using Ubuntu 10.04 and the PHP5: PHP Warning: PHP Startup: Unable to load dynamic library 'usr/lib/php5/20060613/pcntl.so' - /usr/lib/php5/20060613/pcntl.so: cannot open shared object file: No such file or directory in Unknown on line 0 Does System_Daemon try to call pcntl? If so, why is it looking for the file where it does not exist?

    Read the article

  • directory owner problem

    - by Elamurugan
    Hi, I have a uploader using applet and jsp,so after it is uploaded the owner is tomcat so it is not accessible by php i mean apache. its throughs error.i changed chown in php and directly in shell access. still i ant access that directory through php. please check my image.

    Read the article

  • I can't get the Samsung PC Studio to work on Vista or Windows 7

    - by Mike Farrington
    Has anyone got a solution to this problem have asked Samsung but no reply yet! The software installs OK and the drivers, it sees the Tocco Lite when connected but will not actually connect! error message can't change mode or can't connect as "no response from the device because it is in the initializing stage. Try again after the initialization has completed" but it never does. Please Help!!! Mike

    Read the article

  • linux is runing slow

    - by karan
    I am using open suse 11.3 .my laptop is running to slow and dmesg is showing following error: 733.162161] psmouse.c: TouchPad at isa0060/serio4/input0 lost synchronization, throwing 5 bytes away. [ 774.230841] psmouse.c: TouchPad at isa0060/serio4/input0 lost synchronization, throwing 2 bytes away. [ 856.344570] psmouse.c: TouchPad at isa0060/serio4/input0 lost synchronization, throwing 1 bytes away. [ 898.451626] psmouse.c: TouchPad at isa0060/serio4/input0 lost synchronization, throwing 1 bytes away. is there any way i could see the problem and solve it....

    Read the article

  • Unable to burn Windows ISO from Fedora

    - by user331947
    First of all, English is not my native tongue, so apologies for any mistakes. My computer recently started prompting that it can't launch Windows successfully. So I just choose start Windows normally. Then, I found that the startup freezes at the Windows screen (before the login prompt). I have tried rebooting several times and get the same results. So I just gave up. After few days, I tried to boot up my laptop again. This time it got to the desktop, but it's extremely slow and the icons on my Desktop don't show up. I decided to format the Windows partition and reinstall a new one. (It is usually faster that way since I kept my 400GB+ data on aother partition and programs and the rest in the same partition as Windows). The thing is I get the Windows disc at the moment (Traveling aboard). But I have a Windows 7 disc image on my hard disk. So, I downloaded Ubuntu 14.04 LTS, made a Live USB, and then try to burn the image from Ubuntu. But the program just freezes and I don't know why. I tried several times and it's still the same. So I tried using Fedora instead, just to see if it will work. The Disk Image Writer report something like this. Error unmounting /dev/dm-0: Command-line `umount "/dev/dm-0"' exited with non-zero exit status 32: umount: /: target is busy (In some cases useful info about processes that use the device is found by lsof(8) or fuser(1).) (udisks-error-quark, 14) Also, I tried installing linux on the windows partition. The installation program freezes (both Ubuntu and Fedora). So, I thought that maybe something are wrong with my hard disk. I seek the solution on the internet and found that gparted can be used to format a partition. And it also froze at "Searching /dev/sda/ partition ...". I'm using Lenovo Y570. Spec below. http://www.notebookreview.com/notebookreview/lenovo-ideapad-y570-review-a-lenovo-bestseller/3/ Can anyone suggest a next step in diagnosing and fixing this problem? Thanks in advance.

    Read the article

< Previous Page | 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197 1198  | Next Page >