Search Results

Search found 55134 results on 2206 pages for 'argument error'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 1190/2206 | < Previous Page | 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197  | Next Page >

  • How to restore a Windows Easy Transfer file from a 64bit machine to a 32bit machine?

    - by Kevin Davis
    Using a 32bit laptop, I saved my settings etc. using "Windows Easy Transfer" from the Win7 RC. I set the file destination to a Win2K R2 machine that happened to be 64bit. When I re-installed my laptop and tried to restore my settings from the file I'd saved I was surprised to get an error: "Windows Easy Transfer can't transfer files from a 64-bit computer to a 32-bit computer." Is there a known workaround? Ideas on how to unpack the file and get my stuff?

    Read the article

  • Core i7 c1e and speedstepping - BSOD on shutdown

    - by DeaconDesperado
    I'm having an interesting problem with my recent Core i7 Digital Audio workstation build that I am curious to see if others have encountered. First, here are the specs on the machine. ASUS P6TD Deluxe Intel X58 Socket LGA1366 MB Intel Core i7-950 3.06Ghz 8M LGA1366 CPU CORSAIR DOMINATOR 6GB (3 x 2GB) 240-Pin DDR3 SDRAM DDR3 1600 Western Digital Caviar Black WD5001AALS 500GB Plus a couple ASUS optical drives and a 750W Corsair PSU. Running Windows 7 x64. All this is connected to the nefarious Digi 002 firewire audio interface for use with Pro Tools. I following mostly the specs posted by many other I7 users in the digidesign community who pooled their collective knowledge in this thread. Now after completing my build, I fell victim to the "UD5 squeal" described at that forum thread. So taking the advice posted, I disabled c1e advanced halt state and Intel speed stepping (I would likely have done this anyway to maintain a stable clock, power consumption isn't really a relevant concern on this machine.) I enabled XMP to set the ram timings properly as well. What I am experiencing is a BSOD upon shutdown, but only immediately after windows fully exits and ends all processes. The error is a MACHINE_CHECK_EXCEPTION 0x000000. The funny thing is that it is extremely intermitent and only occurs if the shutdown immediately followed a period of relative idleness. It does not a generate a minidump, I suspect because windows monitoring has terminated by the time this error occurs. No damage is evident and one can simply turn off manually and the system will act as though a proper shutdown had occurred. If anything it is a annoyance, I just want to be certain it is not affecting my long term stability. I have read that the i7 950 does not like DRAM voltages past 1.65, but that they are acceptable if they are within .5 of the BLCK setting. I have tried disabling XMP and setting all timings to auto and the problem still manifests in an identical way. It is suspect that the cpu idleness preceding shutdown is the determining factor, as both c1e and speedstepping are both settings intended to modify handling of this state. Any suggestions or prior experiences would be greatly appreciated. EDIT: The behavior very closely resembles what's described in this thread: http://www.tomshardware.com/forum/12003-63-shut-problem-windows The benign nature of it of is identical. I can't seem to download the hotfix cited there however.

    Read the article

  • Looking for Fiddler2 help. connection to gateway refused? Just got rid of a virus

    - by John Mackey
    I use Fiddler2 for facebook game items, and it's been a great success. I accessed a website to download some dat files I needed. I think it was eshare, ziddu or megaupload, one of those. Anyway, even before the rar file had downloaded, I got this weird green shield in the bottom right hand corner of my computer. It said a Trojan was trying to access my computer, or something to that extent. It prompted me to click the shield to begin anti-virus scanning. It turns out this rogue program is called Antivirus System Pro and is pretty hard to get rid of. After discovering the rogue program, I tried using Fiddler and got the following error: [Fiddler] Connection to Gateway failed.Exception Text: No connection could be made because the target machine actively refused it 127.0.0.1:5555 I ended up purchasing SpyDoctor + Antivirus, which I'm told is designed specifically for getting rid of these types of programs. Anyway, I did a quick-scan last night with spydoctor and malware bytes. Malware picked up 2 files, and Spydoctor found 4. Most were insignificant, but it did find a worm called Worm.Alcra.F, which was labeled high-priority. I don’t know if that’s the Anti-Virus Pro or not, but SpyDoctor said it got rid of all of those successfully. I tried to run Fiddler again before leaving home, but was still getting the "gateway failed" error. Im using the newest version of firefox. When I initially set up the Fiddler 2.2.8.6, I couldn’t get it to run at first, so I found this faq on the internet that said I needed to go through ToolsOptionsSettings and set up an HTTP Proxy to 127.0.0.1 and my Port to 8888. Once I set that up and downloaded this fiddler helper as a firefox add-on, it worked fine. When I turn on fiddler, it automatically takes my proxy setting from no proxy (default) to the 127.0.0.1 with Port 8888 set up. It worked fine until my computer detected this virus. Anyway, hopefully I've given you sufficient information to offer me your best advice here. Like I said, Spydoctor says the bad stuff is gone, so maybe the rogue program made some type of change in my fiddler that I could just reset or uncheck or something like that? Or will I need to completely remove fiddler and those dat files and rar files I downloaded? Any help would be greatly appreciated. Thanks for your time.

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • insserv: Script <SCRIPT_NAME> is broken: missing end of LSB comment.

    - by udo
    I am getting this error when running: insserv -r udo-startup.sh insserv: Script udo-startup.sh is broken: missing end of LSB comment. insserv: exiting now! The content of udo-startup.sh is this: #!/bin/bash ### BEGIN INIT INFO # Provides: udo-startup.sh # Required-Start: $local_fs $remote_fs $network $syslog # Required-Stop: $local_fs $remote_fs $network $syslog # Default-Start: 2 3 4 5 # Default-Stop: 0 1 6 # Short-Description: - # Description: - ### END INIT INF ID=$(xinput list | grep -i touchpad | sed '/TouchPad/s/^.*id=\([0-9]*\).*$/\1/') xinput set-prop $ID "Device Enabled" 0 exit 0

    Read the article

  • Looking for a NTP Server Software for Windows

    - by Simon
    I'm looking for a, preferably free, NTP Server for Windows Server 2003/2008. We have already tried the built in Windows Time Server, but our tests did show that it is not very accurate, we see time differences up to 500ms. The max time difference we can allow for our application is ~100ms. Now we have already used the Meinberg NTPd for Windows. It works great except we have one big issue with it: If there is a network connection problem between the client and server, the ntp server is in a panic state It won't give the client a new time until we restart the ntp service. This is a big issue which has caused us some trouble. It was working fine for months until there was a network problem we didn't notice, we only noticed it after a week when the time difference was already 30 sec. on the clients. So please suggest some alternative NTP Server for windows. I did Google but I get a lot of unrelated search results. Edit: So far the ntpd windows version was very accurate and I'd like to stick with it. The only problem is the "panic state" after a network disconnect. Maybe some knows here what the cause of this is and how to fix it. Also, I forgot to mention that we have a server/client setup like this: Server1 -- Server2 -- Server3 -- Client1 -- Client2 -- Client3 So Server2 gets its time from Server1, Server3 gets its time from Server2, and the Clients get their time from Server3. Also, there are clients connected directly to Server2. It is important that all Servers and Clients have the exact same time (within ~100ms) Now there was a network problem with Server3 and its clients. The servers run the ntpd port for Windows, which acts as NTP server and client. The clients have Dimension4 as NTP client. After the network problem, the error message in D4 was something like this (out the top of my head, don't have the exact error message): Server response: The server is in a panic state (could not sync clock) I read through the ntpd docs, and the only mention of "panic" is when the time difference is 10000 seconds which will cause to exit the ntpd server but this was not the case. Also there is a "-g" command line switch to disable the panic exit, but it is already set by default. Any ideas what could cause the panic state and how to get rid of it next time?

    Read the article

  • Import mBox file from Horde to Gmail

    - by spoon16
    I just transfered my domain from a third party which hosted Horde as my mail client to Google Apps. I need to import all of my mail from the mbox files I exported from Horde into Gmail now. I tried GML but it chokes on the mbox file saying that it is not well formatted. I have tried exporting multiple times from Horde and from multiple accounts. I get the same error on all of the mbox files. Any ideas?

    Read the article

  • Sun Virtualbox: Cannot Install Windows 95 or 98

    - by c00lryguy
    I'm running XP and I've tried to install Windows 95 and 98 with the official CDs in Virtualbox. Both of them give the error: FATAL: no bootable medium found! System Halted I've mounted the CD drives within Virtualbox and also tried to change the boot order so that the CD drive is first but to no avail. I don't understand exactly what's going on here.

    Read the article

  • SSL certificate only valid when viewed externally

    - by user23522
    We have a SSL certificate installed on our server. When viewed externally it validates correctly, however when the website is viewed from the server it gets an invalid certificate error. We are using the fully qualified domain name to access it for both? Is there any reason this should be happening? Cheers.

    Read the article

  • Hebrew filenames in the URL

    - by Lea Cohen
    We have a CMS that enables users to upload images and flashes to their site. Sometimes the filenames are in Hebrew. In our development server there is no problem, but in our production server we get a 404 error when the filename ends with Hebrew characters. I tried comparing the sites in the IIS, but I'm not sure what to even look for, so I'd be very happy to get pointers as to what might be causing the problem.

    Read the article

  • How to add message that will be read with dmesg?

    - by calandoa
    I am trying to write some custom messages in my dmesg output. I tried: logger "Hello" but this does not work. It exits without error, but no "Hello" appears int the output of: dmesg I am using a Fedora 9, and it seems that there is no syslogd/klogd daemon running. However, all my kernel messages are succesfully written in the dmesg buffer. Any idea?

    Read the article

  • MailServer Email Account Setting for Outlook Express

    - by hitesh-4259
    Hi, I have developed mail server using postfix + amavisd + spamassassin. Mail sending and receiving works perfect using command prompt. When I am configuring with outlook express, then sending mail works perfact, but error is occured while receiving mail. "your emailserver rejected your login. Verify username and password in your account properties." But my account and password are correct. please help me. Thanks in advance.....

    Read the article

  • Getting Wireless working on Dell Inspiron 1545 in Ubuntu 10.04?

    - by Dexter
    I'm trying to install my wireless drivers (which uses a broadcom card). I tried to install them using the restricted drivers offered on my Ubuntu CD. However when I clicked activate it got about halfway through the install process before it gave me this error message: SystemError: installArchives() failed How can I correct this?

    Read the article

  • Possible capacitor plague - need help identifying

    - by cornjuliox
    I've been having some PC power issues lately, and I think I've tracked it down to a bad power supply. Lately, when I'm on my PC it will often restart without warning, displaying "Hypertransport sync flood error occurred last boot." once POST finishes. I've googled the error, but can't come to a definitive conclusion as to what's causing it. I've seen posts suggesting that it might be a power supply issue, but nothing conclusive. Here's what I've done so far: -I haven't installed anything suspect within the last 3 months. -I do overclock just a tiny bit, so I tried raising the voltages a little. That didn't work so I brought both CPU multiplier and voltages all back to their default settings, but that didn't solve the problem either. The problem still occurs. -AV scanned the whole system, nothing suspect. -I suspected that it might be a bad power supply so I cracked that open and found the following: I think it might be cap plague, but I'm not sure. It looks more like glue TBH. Could someone help me figure out what might be wrong with this PC? EDIT: Sometimes, after these restarts, I noticed that the GPU fan doesn't spin up, and the single rear case fan that just happens to be connected to the same molex Y-cable as the GFX card doesn't spin up either. Anything to that? EDIT 2: I do use the system quite heavily, but I don't know how that will factor into this. I often play Diablo 3 and EVE Online at the same time, frequently alt-tabbing between the two. I also have Firefox open in the background, sometimes with several tabs, and if I feel like it, I'll mute the in-game sound and open foobar2000 for better music. Could it be that I'm just pushing this thing too hard? EDIT 3: I also noticed something odd. Right before I experience these restarts, my monitor would suffer from very faint lines of static moving across the screen. The monitor is still very much useable, but it is very annoying. Following the restart it disappears, and then would gradually re-appear over the next few days, and then restarts again. I find it to be very odd. System specs for good measure: Orion 600 W PSU AMD Athlon II X3 440 (overclocked to 3.14 ghZ, raised the CPU multiplier to x13 from x10) MSI G40-775 motherboard 1 GB inno3D GTX 550 ti 4 GB DDR3 RAM 500 GB Samsung SATA HD

    Read the article

  • Website not reachable via mobile device

    - by sanders
    I have this very strange problem with a website. The site works normal when coming from a webbrowser which is non-mobile. But when trying to reach the site via a mobile device (tried different browsers) it doesn't get to the website. The only error I see is: This website is not available and the message is: DNS_PROBE_POSSIBLE Does anyone know where I should look for the problem. The website is based on Joomla. The Url of the site is: http://bit.ly/1bOToII

    Read the article

  • Unable to login to a domain computer using a Local Administrator account

    - by kishore
    I have a server running on windows server 2008. Recently we created a domain and added it to the domain. A domain user account was created with same username and password as my previous local administrator account. Now I unable to login using my local account. I tried loggin in using SERVERNAME\Username, but it is giving incorrect password error message. Is there any way I can retrieve or create a new local administrator account on a domain computer

    Read the article

  • nginx proxypath https redirects to http

    - by Thermionix
    I'm trying to setup Nginx to forward requests to several backend services using proxy_pass however several pages load with 404s The links on the pages have https:// in front, but result in a http request - which ends in a 404 - I only want these services to be available through https. I've tried with varied trailing forward slashes appended to the proxypath and location in proxy.conf, I've also tried commenting out www.conf (just incase its location blocks could have caused any conflicts) to no effect. So if a link is too https://example.com/sickbeard/errorlogs in a browser when loaded https://example.com/sickbeard/errorlogs gives a 404 in a browser https://example.com/sickbeard/errorlogs/ loads nginx error log; 2011/11/23 14:21:58 [error] 28882#0: *6 "/var/www/sickbeard/errorlogs/recent.html" is not found (2: No such file or directory), client: 192.168.1.99, server: example.com, request: "GET /sickbeard/errorlogs/ HTTP/1.1", host: "example.com" Config files; proxy.conf location /sickbeard { proxy_pass http://localhost:8081/sickbeard; include proxy.inc; } .... more entries .... sites-enabled/main server { listen 80; include www.conf; } server { listen 443; include proxy.conf; include www.conf; ssl on; } www.conf root /var/www; server_name example.com; location / { autoindex off; allow all; rewrite ^/$ /mainsite last; location ~* \.(jpg|jpeg|gif|css|png|js|ico)$ { expires max; } location ~ \.php$ { fastcgi_index index.php; include fastcgi_params; if (-f $request_filename) { fastcgi_pass 127.0.0.1:9000; } } } proxy.inc proxy_connect_timeout 59s; proxy_send_timeout 600; proxy_read_timeout 600; proxy_buffer_size 64k; proxy_buffers 16 32k; proxy_pass_header Set-Cookie; proxy_redirect off; proxy_hide_header Vary; proxy_busy_buffers_size 64k; proxy_temp_file_write_size 64k; proxy_set_header Accept-Encoding ''; proxy_ignore_headers Cache-Control Expires; proxy_set_header Referer $http_referer; proxy_set_header Host $host; proxy_set_header Cookie $http_cookie; proxy_set_header X-Real-IP $remote_addr; proxy_set_header X-Forwarded-Host $host; proxy_set_header X-Forwarded-Server $host; proxy_set_header X-Forwarded-For $proxy_add_x_forwarded_for;

    Read the article

  • What setting can cause a monitor to flicker under X11?

    - by BCS
    I've been dinking with the xorg.conf file on my system and now when I try to start X I get a flickering effect and no usable image. I think (and this is just a guess) that it's a settings out of bound error of some kind but I don't know what setting. I'm almost completely sure that the hardware is good given that everything is brand new.and works just fine in text mode. Any ideas?

    Read the article

  • directory owner problem

    - by Elamurugan
    Hi, I have a uploader using applet and jsp,so after it is uploaded the owner is tomcat so it is not accessible by php i mean apache. its throughs error.i changed chown in php and directly in shell access. still i ant access that directory through php. please check my image.

    Read the article

  • can not login to windows

    - by LoRdiE
    Dear, When i login to windows using domain user account, it take a min show welcome and then automatically logoff. I think user profile error, so login with the administrator account and create new local account. When i login using the local user account, it happened the same as domain user account. Only Administrator Level can login to windows. Any know how can i fix this case? Thanks

    Read the article

  • QMail Problem: Can't send email to one specific domain

    - by Andrew Phillips
    I'm running qmail as part of a Plesk installation on a Debian server. Everything works fine apart from any emails sent to @nandos.co.uk. I get no error messages they just end up stuck in the queue for eternity. I have no idea what is going on, because as far as I can tell this is the ONLY domain the server won't send emails to. Any ideas? TIA

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Password Won't Work after Crash

    - by Jack Cornell
    My Win 7 computer locked up, so I shut it down (holding down the power button till it shut off). Logging back on, I got an error message that it couldn't load my profile (like I'm entering the wrong password). I logged on the guest account, but can't change anything because it won't accept my password. Is this a serious problem or do I just need to reset the password with one of the options available on your site?

    Read the article

  • CentOS5 python wrong ELF class: ELFCLASS32

    - by user788171
    Has anybody ever encountered this wrong ELF class error? The failure is provided in more detail below: [root@nocloud ~]# system-config-users Traceback (most recent call last): File "/usr/share/system-config-users/system-config-users.py", line 25, in ? import libuser ImportError: /usr/lib/python2.4/site-packages/libusermodule.so: wrong ELF class: ELFCLASS32 Can anybody tell me how I might possibly be able to fix this? It looks like python broke on my server.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 1186 1187 1188 1189 1190 1191 1192 1193 1194 1195 1196 1197  | Next Page >