Search Results

Search found 8843 results on 354 pages for 'smart match'.

Page 13/354 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • Performance Testing a .NET Smart Client Application (.NET ClickOnce technology)

    - by jn29098
    Has anyone ever had to run performance tests on a ClickOnce application? I have engaged with a vendor who had trouble setting up their toolset with our software because it is Smart Client based. They are understandably more geared toward purely browser-based applications. I wonder if anyone has had to tackle this before and if so would you recommend any vendors who use industry standard tools such as Load Runner (which i assume can handle the smart client)? Thanks

    Read the article

  • sharepoint (moss 2010) and smart parts

    - by Ali
    having our moss 2007 all our developments and customizations were based on smartparts everything in our sharepoint are smartparts (some smartparts using jquery) but i couldn't find the smart part plugin for moss 2010, is it possible to use our existing smart parts in moss 2007 in a new installation of moss 2010

    Read the article

  • VS2008 Smart Device Class Library Project Template

    - by Nelson Reis
    I was trying to create a new Class Library project targeted for the .NET Compact Framework. However, when I select "New project - Smart Device" I only have the Smart Device Project template. I've checked the folder: C:\Program Files\Microsoft Visual Studio 9.0\Common7\IDE\ProjectTemplates\CSharp\SmartDevice\1033 It contains several project templates: SmartDeviceClassLibrary SmartDeviceConsoleApplication SmartDeviceEmptyProject SmartDeviceWindowsApplication SmartDeviceWindowsControlLibrary None of those are shown on my IDE. How can I use one of those project templates?

    Read the article

  • Samsung introduces smart watch. But without any smartness!

    - by Gopinath
    The era of mobile phone can be classified as before iPhone and after iPhone. When iPhone was introduced they were revolutionary, smart, awesome and technologically far advanced than any other phone available in the market. iPhone is the first true smartphone and a game changer. With the same goal in mind, Samsung tried revolutionizing watch industry by announcing Galaxy Gear watches. They branded them as a smart watch, hyped its release as if it’s going to revolutionize the way we use watches. But in reality there is nothing exciting about it. Instead it’s an expensive (300$) one, battery lasts less than a day, user interface is very very slow, has small memory capacity, not much of use if not connected to a Samsung phone!! With so many negative, how can it be a smart watch? Reviews on Galaxy Gear smart watch The Next Web Smartwatches are still too dumb The Verge Samsung’s Galaxy Gear isn’t really a smartwatch Gizmodo $300 is a lot for a souped up fitness tracker, and as far as the basic smartphone functions Galaxy Gear is capable of, those feel a little strange and counterintuitive ZD NET Samsung has left the door wide open with the Galaxy Gear, which looks both rushed and exorbitantly priced at the same time. Few Tweets on Galaxy Gear 1. Apple surprises with iPhone 2. Tablet rumors 3. Others rush crap to market 4. iPad 5. ‘iWatch’ Rumors 6. Others rush crap to market 7. ? — Matthew Panzarino (@panzer) September 4, 2013 Camera, phone, music… There’s one thing that the Gear doesn’t seem to have: a purpose | http://t.co/raK4Rgy6Fm by @SamGrobart — Businessweek (@BW) September 5, 2013   Galaxy Gear Video demo shows how slow it is Here is a Galaxy Gear hands on video from slashgear. You can see how slow the device performs   With the rumors of Apple building smart watch, Samsung rushed to the market with its own version of (smart) watch as a preemptive strike. But with a half baked product and without any innovation it back fired on it own reputation. This would’ve been great chance to Samsung to prove that the company is innovative and not a copy cat. But it failed to innovate and missed a chance.

    Read the article

  • E3 2012 : Du nouveau pour la XBox 360 : l'application Smart Glass, Internet Explorer et XBox Music débarqueront cette année

    E3 2012 : Des nouveautés pour la XBox 360 Smart Glass, Internet Explorer et Music Smart GlassIl faut dire que pour l'instant, peu de choses ont été dévoilées à propos de Smart Glass. Sous ce nom se cache une application pour Windows 8, Windows Phone mais aussi les périphériques sous iOS afin de les utiliser comme contrôleur pour la XBox. La technologie permettra d'utiliser son PC, sa tablette ou son smartphone, pour afficher l'image mais aussi pour contrôler la XBox, donnant ainsi une meilleure interface utilisateur pour des applications comme Internet Explorer. De plus, The Verge

    Read the article

  • Find multiple regex in each line and skip result if one of the regex doesn't match

    - by williamx
    I have a list of variables: variables = ['VariableA', 'VariableB','VariableC'] which I'm going to search for, line by line ifile = open("temp.txt",'r') d = {} match = zeros(len(variables)) for line in ifile: emptyCells=0 for i in range(len(variables)): regex = r'('+variables[i]+r')[:|=|\(](-?\d+(?:\.\d+)?)(?:\))?' pattern_variable = re.compile(regex) match[i] = re.findall(pattern_variable, line) if match[j] == []: emptyCells = emptyCells+1 if emptyCells == 0: for k, v in match[j]: d.setdefault(k, []).append(v) The requirement is that I will only keep the lines where all the regex'es matches! I want to collect all results for each variable in a dictionary where the variable name is the key, and the value becomes a list of all matches. The code provided is only what I've found out so far, and is not working perfectly yet...

    Read the article

  • Regex to match partial words (JavaScript)

    - by nw
    I would like to craft a case-insensitive regex (for JavaScript) that matches street names, even if each word has been abbreviated. For example: n univ av should match N University Ave king blv should match Martin Luther King Jr. Blvd ne 9th should match both NE 9th St and 9th St NE Bonus points (JK) for a "replace" regex that wraps the matched text with <b> tags.

    Read the article

  • Lucene Fuzzy Match on Phrase instead of Single Word

    - by Koobz
    I'm trying to do a fuzzy match on the Phrase "Grand Prarie" (deliberately misspelled) using Apache Lucene. Part of my issue is that the ~ operator only does fuzzy matches on single word terms and behaves as a proximity match for phrases. Is there a way to do a fuzzy match on a phrase with lucene?

    Read the article

  • Algorithm to match list of regular expressions

    - by DSII
    I have two algorithmic questions for a project I am working on. I have thought about these, and have some suspicions, but I would love to hear the community's input as well. Suppose I have a string, and a list of N regular expressions (actually they are wildcard patterns representing a subset of full regex functionality). I want to know whether the string matches at least one of the regular expressions in the list. Is there a data structure that can allow me to match the string against the list of regular expressions in sublinear (presumably logarithmic) time? This is an extension of the previous problem. Suppose I have the same situation: a string and a list of N regular expressions, only now each of the regular expressions is paired with an offset within the string at which the match must begin (or, if you prefer, each of the regular expressions must match a substring of the given string beginning at the given offset). To give an example, suppose I had the string: This is a test string and the regex patterns and offsets: (a) his.* at offset 0 (b) his.* at offset 1 The algorithm should return true. Although regex (a) does not match the string beginning at offset 0, regex (b) does match the substring beginning at offset 1 ("his is a test string"). Is there a data structure that can allow me to solve this problem in sublinear time? One possibly useful piece of information is that often, many of the offsets in the list of regular expressions are the same (i.e. often we are matching the substring at offset X many times). This may be useful to leverage the solution to problem #1 above. Thank you very much in advance for any suggestions you may have!

    Read the article

  • MySQL "OR MATCH" hangs (long pause with no answer) on multiple tables

    - by Kerry
    After learning how to do MySQL Full-Text search, the recommended solution for multiple tables was OR MATCH and then do the other database call. You can see that in my query below. When I do this, it just gets stuck in a "busy" state, and I can't access the MySQL database. SELECT a.`product_id`, a.`name`, a.`slug`, a.`description`, b.`list_price`, b.`price`, c.`image`, c.`swatch`, e.`name` AS industry, MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) AS relevance FROM `products` AS a LEFT JOIN `website_products` AS b ON (a.`product_id` = b.`product_id`) LEFT JOIN ( SELECT `product_id`, `image`, `swatch` FROM `product_images` WHERE `sequence` = 0) AS c ON (a.`product_id` = c.`product_id`) LEFT JOIN `brands` AS d ON (a.`brand_id` = d.`brand_id`) INNER JOIN `industries` AS e ON (a.`industry_id` = e.`industry_id`) WHERE b.`website_id` = %d AND b.`status` = %d AND b.`active` = %d AND MATCH( a.`name`, a.`sku`, a.`description` ) AGAINST ( '%s' IN BOOLEAN MODE ) OR MATCH ( d.`name` ) AGAINST ( '%s' IN BOOLEAN MODE ) GROUP BY a.`product_id` ORDER BY relevance DESC LIMIT 0, 9 Any help would be greatly appreciated.

    Read the article

  • How can I match a twitter username with angular ui router

    - by user3929999
    I need to be able to match a path like '/@someusername' with angular ui router but can't figure out the regex for it. What I have are routes like the following $stateProvider .state('home', {url:'/', templateUrl:'/template/path.html'}) .state('author', {url:'/{username:[regex-to-match-@username-here]}'}) .state('info', {url:'/:slug', templateUrl:'/template/path.html'}) .state('entry', {url:'/:type/:slug', templateUrl:'/template/path.html'}); I need a bit of regex for the 'author' route that will match @usernames. Currently, everything I try is caught by the 'entry' route.

    Read the article

  • MongoDb - $match filter not working in subdocument

    - by Ranjith
    This is Collection Structure [{ "_id" : "....", "name" : "aaaa", "level_max_leaves" : [ { level : "ObjectIdString 1", max_leaves : 4, } ] }, { "_id" : "....", "name" : "bbbb", "level_max_leaves" : [ { level : "ObjectIdString 2", max_leaves : 2, } ] }] I need to find the subdocument value of level_max_leaves.level filter when its matching with given input value. And this how I tried, For example, var empLevelId = 'ObjectIdString 1' ; MyModel.aggregate( {$unwind: "$level_max_leaves"}, {$match: {"$level_max_leaves.level": empLevelId } }, {$group: { "_id": "$level_max_leaves.level", "total": { "$sum": "$level_max_leaves.max_leaves" }}}, function (err, res) { console.log(res); }); But here the $match filter is not working. I can't find out exact results of ObjectIdString 1 If I filter with name field, its working fine. like this, {$match: {"$name": "aaaa" } }, But in subdocument level its returns 0. {$match: {"$level_max_leaves.level": "ObjectIdString 1"} }, My expected result was, { "_id" : "ObjectIdString 1", "total" : 4, }

    Read the article

  • Find last match with python regular expression

    - by SDD
    I wanto to match the last occurence of a simple pattern in a string, e.g. list = re.findall(r"\w+ AAAA \w+", "foo bar AAAA foo2 AAAA bar2) print "last match: ", list[len(list)-1] however, if the string is very long, a huge list of matches is generated. Is there a more direct way to match the second occurence of "AAAA" or should I use this workaround?

    Read the article

  • Match Anything Except a Sub-pattern

    - by Tim Lytle
    I'd like to accomplish what this (invalid I believe) regular expression tries to do: <p><a>([^(<\/a>)]+?)<\/a></p>uniquestring Essentially match anything except a closing anchor tag. Simple non-greedy doesn't help here because `uniquestring' may very well be after another distant closing anchor tag: <p><a>text I don't <tag>want</tag> to match</a></p>random data<p><a>text I do <tag>want to</tag> match</a></p>uniquestring more matches <p><a>of <tag>text I do</tag> want to match</a></p>uniquestring So I have more tag in between the anchor tags. And I'm using the presence of uniquestring to determine if I want to match the data. So a simple non-greedy ends up matching everything from the start of the data I don't want to the end of the data I do want. I know I'm edging close to the problems regular expressions (or at least my knowledge of them) aren't good at solving. I could just through the data at an HTML/XML parser, but it is just one simple(ish) search. Is there some easy way to do this that I'm just missing?

    Read the article

  • RegEx - character not before match

    - by danneth
    I understand the consepts of RegEx, but this is more or less the first time I've actually been trying to write some myself. As a part of a project, I'm attempting to parse out strings which match to a certain domain (actually an array of domains, but let's keep it simple). At first I started out with this: url.match('www.example.com') But I noticed I was also getting input like this: http://www.someothersite.com/page?ref=http://www.example.com These rows will ofcourse match for www.example.com but I wish to exclude them. So I was thinking along these lines: Only match rows that contain www.example.com, but not after a ? character. This is what I came up with: var reg = new RegExp("[^\\?]*" + url + "(\\.*)", "gi"); This does however not seem to work, any suggestions would be greatly appreciated as I fear I've used what little knowledge I yet possess in the matter.

    Read the article

  • Regex: Match any character (including whitespace) except a comma

    - by selecsosi
    I would like to match any character and any whitespace except comma with regex. Only matching any character except comma gives me: [^,]* but I also want to match any whitespace characters, tabs, space, newline, etc. anywhere in the string. For example, I would like to be able to match all of this up until the comma: "bla bla bla" "asdfasdfasdfasdfasdfasdf" "asdfasdfasdf", Is there a simple way to do this without knowing where the whitespace may be?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • efficientcy effort: grep with a vectored pattern or match with a list of values

    - by Elad663
    I guess this is trivial, I apologize, I couldn't find how to do it. I am trying to abstain from a loop, so I am trying to vectorize the process: I need to do something like grep, but where the pattern is a vector. Another option is a match, where the value is not only the first location. For example data (which is not how the real data is, otherswise I would exploit it structure): COUNTRIES=c("Austria","Belgium","Denmark","France","Germany", "Ireland","Italy","Luxembourg","Netherlands", "Portugal","Sweden","Spain","Finland","United Kingdom") COUNTRIES_Target=rep(COUNTRIES,times=4066) COUNTRIES_Origin=rep(COUNTRIES,each=4066) Now, currently I got a loop that: var_pointer=list() for (i in 1:length(COUNTRIES_Origin)) { var_pointer[[i]]=which(COUNTRIES_Origin[i]==COUNTRS_Target) } The problem with match is that match(x=COUNTRIES_Origin,table=COUNTRIES_Target) returns a vector of the same length as COUNTRIES_Origin and the value is the first match, while I need all of them. The issue with grep is that grep(pattern=COUNTRIES_Origin,x=COUNTRIES_Target) is the given warning: Warning message: In grep(pattern = COUNTRIES_Origin, x = COUNTRIES_Target) : argument 'pattern' has length > 1 and only the first element will be used Any suggestions?

    Read the article

  • Slow parity initialization of RAID-5 array on HP Smart Array 411 controller

    - by Rob Nicholson
    On 29th October 2011, I built a RAID-5 array using 4 x 146.8GB Seagate SAS ST3146855SS drives running at 15k connected to a PowerEdge R515 with HP Smart Array P411 controller running Windows 2008 (so nothing particularly unusual). I know that parity initialisation of a RAID-5 array can take some time but it's still running after 2.5 weeks which seems a little unusual. I'd previously built another array on the same controller using 4 x 2TB SATA-2 drives and that did take a while to complete but a) I'm sure it was less than 2.5 weeks, b) that array was ~12 times bigger and c) during initialization, the percentrage slowly increased each day. At the moment, the status display for this new 2nd array simply says "Parity Initialization Status: In Progress" and it's said that since the start. It's this lack of change on the status that worries me the most - feels like it's not actually doing anything. Do you think something has gone wrong or am I being unpatient and for some reason, the status not increasing is normal? I kind of expected a much smaller array on faster drives (15k SAS versus 7.5k SATA-2) to build in a few days. This is our primary SAN running StarWind so my "have a play" options are very limited. This 2nd array is currently in use for one small virtual disk so I could shut the target machine down, move the virtual disk to another drive and try rebuilding.

    Read the article

  • Mac Outlook showing all links in smart quotes?

    - by user2727128
    I was given the task of fixing my friend's email today and really don't know what the problem is. When an email is sent from his laptop (Mac) from Outlook the email address link in the signature shows exactly like this: [email protected]<mailto:[email protected]>. Additionally the website link displays like this: www.website.com<http://www.website.com>. And lastly, the image comes through as cid:randomstringofnumbers. When I sent him an email and he sent one back it converted my signature to same weird formatting. Plus, even in the header where it shows our emails, they are displaying the same way: [email protected]<mailto:[email protected]>. And the weirdest thing is that this problem seems to be "compounding". So when I scroll down to the last, most recent email in the thread I see this www.website.com<http://www.website.com> next email shows this: www.website.com<http://www.website.com><http://www.website.com> and the next this: www.website.com<http://www.website.com><http://www.website.com><http://www.website.com> This is happening to the emails too, everywhere. I'm thinking this might be something to do with smart quotes and the auto formatting but I'm not sure. Could this be the problem? And if so how do I fix it?

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >