Search Results

Search found 78026 results on 3122 pages for 'android file'.

Page 131/3122 | < Previous Page | 127 128 129 130 131 132 133 134 135 136 137 138  | Next Page >

  • Android - Using Camera Intent but not updating correctly?

    - by Tyler
    Hello - I am using an intent to capture a picture: Intent i = new Intent(android.provider.MediaStore.ACTION_IMAGE_CAPTURE); i.putExtra(android.provider.MediaStore.EXTRA_OUTPUT, Uri.fromFile(new File(Environment.getExternalStorageDirectory(), "test.jpg"))); startActivityForResult(i, 2); And then once taken I do the following: sendBroadcast(new Intent(Intent.ACTION_MEDIA_MOUNTED, Uri.parse("file://" + Environment.getExternalStorageDirectory()))); launchGallery(); While the above seems to work the first time without issue, whenever I run through a second time (so test.jpg already exists) the image actually saves correctly to /sdcard/ but I am finding that the thumbnail does not update and when the gallery loads it shows the previous test.jpg image! I was under the impression that sendBroadcast should update the thumbnails, but it doesn't appear to be.. Is there some other way to go about this and ensure when I call my launchGallery(); method the most recent image I just took appears? Thanks!

    Read the article

  • android custom map marker bounds

    - by max4ever
    Hello i am using a resized version of this marker( http://www.clker.com/clipart-orange-pin-4.html ) for showing markers in google maps on android. The problem is i don't know how to make the marker point match the coordinates. The arrow point is at about 1/5 of the Width coordinates and MAX of the Height. here is my class public class GestionaleItemizedOverlay extends com.google.android.maps.ItemizedOverlay { public GestionaleItemizedOverlay(Drawable defaultMarker, Context context) { //super(boundCenterBottom(defaultMarker)); super(boundCenter(defaultMarker)); this.mContext = context; } ... And this this.marker_poi = this.getContext().getResources().getDrawable(R.drawable.marker); this.marker_poi.setBounds(this.marker_poi.getIntrinsicWidth() / 2, this.marker_poi.getIntrinsicHeight(), this.marker_poi.getIntrinsicWidth() / 2, 0); new GestionaleItemizedOverlay(this.poi, this.context); Do i need to setBounds on the marker before passing it to the constructor? and why does super(defaultMarker) makes all the markers not to show ?

    Read the article

  • Trouble Installing the new Android SDK

    - by Dan Monego
    I've installed the newest Android SDK using eclipse's software updates feature to hit the resource at https://dl-ssl.google.com/android/eclipse/. After installing it, it seems like the SDK is integrated into Eclipse, but when I try to create a new project with a single blank activity in it, I get the following error: [2009-06-06 11:41:24 - TestProject] no classfiles specified [2009-06-06 11:41:24 - TestProject] Conversion to Dalvik format failed with error 1 This is using eclipse version 3.4.2 running on top of Mac OS 10.5.7 on a 32 bit processor. Is this a misconfiguration on my part? Have I missed a part of the installation?

    Read the article

  • How to View Android Native Code Profiling?

    - by David R.
    I started my emulator with ./emulator -trace profile -avd emulator_15. I then tracked down the trace files to ~/.android/avd/rodgers_emulator_15.avd/traces/profile, where there are six files: qtrace.bb, qtrace.exc, qtrace.insn, qtrace.method, qtrace.pid, qtrace.static. I can't figure out what to do with these files. I've tried both dmtracedump and traceview on all of the files, but none seem to generate any output I can do anything with. How can I view the proportion of time taken by native method calls on Android?

    Read the article

  • Scala Programming for Android

    - by Lemmy
    I have followed the tutorial at Scala and Android with Scala 2.7.3 final. The resulting Android App works but even the most basic application takes several minutes (!) to compile and needs 900 kb compressed, which is a show stopper for mobile applications. Additionally, the IDE runs out of memory every now and then. I assume dex is not made for big libraries like the scala-library. So my question is: Has anyone actually done this and is there any cure for this?

    Read the article

  • Minimum Hardware requirements for Android development

    - by vishwanath
    I need information about minimum hardware requirement I need to have better experience in developing Android application. My current configuration is as follows. P4 3.0 GHz, 512 MB of ram. Started with Hello Android development on my machine and experience was sluggish, was using Eclipse Helios for development. Emulator used to take lot of time to start. And running program too. Do I need to upgrade my machine for the development purpose or is there anything else I am missing on my machine(like heavy processing by some other application I might have installed). And If I do need to upgrade, do I need to upgrade my processor too(that counts to new machine actually, which I am not in favor of), or only upgrading RAM will suffice.

    Read the article

  • android zxing intentintegrator

    - by cristi _b
    I've written the following code that works fine if you decide to scan a QR code (using zxing) and store it in private storage but in case you decide to cancel scanning, it crashes and the file previously stored content disappears. I think it might be a design error, not sure why. Below is relevant code ... /** * menu generation */ @Override public boolean onCreateOptionsMenu(Menu menu) { MenuInflater inflater = getMenuInflater(); inflater.inflate(R.menu.menu, menu); return true; } /** * menu handling */ @Override public boolean onOptionsItemSelected(MenuItem item) { Context context = getApplicationContext(); Toast toast = Toast.makeText(context, "", Toast.LENGTH_LONG); toast.setGravity(Gravity.FILL_HORIZONTAL, 0, 0); switch (item.getItemId()) { case R.id.qrScan: IntentIntegrator integrator = new IntentIntegrator(this); integrator.initiateScan(); return true; case R.id.qrReset: File dir = getFilesDir(); File file = new File(dir, qrCodeFile); boolean deleted = file.delete(); return true; case R.id.appClose: this.finish(); return true; default: return super.onOptionsItemSelected(item); } } ... public void onActivityResult(int requestCode, int resultCode, Intent intent) { IntentResult scanResult = IntentIntegrator.parseActivityResult(requestCode, resultCode, intent); Context context = getApplicationContext(); Toast toast = Toast.makeText(context, "", Toast.LENGTH_SHORT); if (scanResult != null) { FileOutputStream fos = null; CharSequence text = scanResult.getContents(); try { fos = openFileOutput(qrCodeFile, Context.MODE_PRIVATE); try { fos.write(text.toString().getBytes()); fos.close(); toast.setGravity(Gravity.FILL_HORIZONTAL, 0, 0); toast.setText("Code saved"); toast.show(); } catch (IOException ex) { toast.setGravity(Gravity.FILL_HORIZONTAL, 0, 0); toast.setText("Invalid code"); toast.show(); Logger.getLogger(MainActivity.class.getName()).log(Level.SEVERE, null, ex); } } catch (FileNotFoundException ex) { toast.setGravity(Gravity.FILL_HORIZONTAL, 0, 0); toast.setText("Error while saving"); toast.show(); Logger.getLogger(MainActivity.class.getName()).log(Level.SEVERE, null, ex); } } else { toast.setGravity(Gravity.FILL_HORIZONTAL, 0, 0); toast.setText("Invalid code"); toast.show(); } }

    Read the article

  • image decoding problem in android

    - by achie
    Some of the images are not being displayed in the web browser in android while they work fine on all other machines and mobile devices. this is an example of one of those images http://s3.amazonaws.com/itriage/logos/19/iphone_list.jpg?1261515055 So I tried to pull the image to see it if it works from code. This is what I did URL url = new URL(address); InputStream is = (InputStream) url.getContent(); Drawable d = Drawable.createFromStream(is, "src"); It works for most images but for some images including this images it gives this error D/skia (28314): --- decoder-decode returned false Why is this happening and how can I prevent this. I saw an example on the developers forum but thats when we are accessing the image directly. But what I want is the browser to handle it. So how do I encode my images on my server for the android devices to recognise them correctly?

    Read the article

  • Android Market, Search results position Mystery.

    - by Paul G.
    How is an app's position in the Android Market search results determined? Is it as mysterious and complex as Google Web search results? We obviously don't want to change any words in our app's title or description that would hurt our position. Same question applies for not only search results, but when clicking on a Category in the Android Market. How is the order of the list determined? Hopefully someone here can help. I would think that Google would have published some guidelines at least that could help, but I haven't found anything yet.

    Read the article

  • Android FileOutputStream

    - by zaid
    i am attempting to save an image file using "openFileOutput" and then adding that file to my intent with EXTRA_STREAM. but logcat keeps saying that file size is 0, i have the proper permission in my manifest. FileOutputStream fos = openFileOutput("p001.jpg", Context.MODE_WORLD_READABLE); File jpg = getFileStreamPath("p001.jpg"); fos.close(); Intent share = new Intent(android.content.Intent.ACTION_SEND); share.setType("image/jpeg"); share.putExtra(Intent.EXTRA_SUBJECT, "Fail picture"); share.putExtra(Intent.EXTRA_TEXT, "Epic fail!!!"); share.putExtra(Intent.EXTRA_STREAM, Uri.fromFile(jpg)); startActivity(Intent.createChooser(share, "Choose share method."));

    Read the article

  • Android new Intent

    - by Sukitha
    Hi Im trying to start android market via my app to search similar products. I'm using this code. Intent intent = new Intent(Intent.ACTION_VIEW,Uri.parse("http://market.android.com/search?q=pub:\"some txt\"")); c.startActivity(intent); This works fine but when I hit on Home button with in the market and goto home phone home screen. When I open again the app it still shows market results. (i want to goto main menu) Whats the solution? thanks

    Read the article

  • Android Activities UI Persistence

    - by aandroid
    I need to have two activities in an Android app that can be switched between each other with UI persistence as follows: Activity A launches Activity B. User triggers some UI changes in Activity B. Activity B returns to Activity A (by a call to onBackPressed() or something similar) Activity A re-launches Activity B. I would like the changes made in step 2 to be visible in step 4. I have tried using the singleInstance activity tag on Activity B to no avail. I would also prefer a more elegant solution than simply writing all object properties to a file or SQLite table. It seems that this behaviour must be easily achievable given that Android does it automatically for calls to onBackPressed() where the parent Activity's UI is saved. Any help is much appreciated.

    Read the article

  • Recovering the deleted data from Android SD Card ?

    - by Nish
    I am trying to make an Android application which would try to recover deleted content from the SD Card. How feasible it is ? I have following method in mind: 1) Since, the files are not actually deleted, can I access the file system to see files which has been marked to be overwritten. 2) Or will I have do header/footer file carving ? Is it possible from the application layer of android ? I am concerned about files stored on contiguous sectors and not the fragmented once. I want to do a basic file retrieval. Please let me know some resources which I can use to make this application ?

    Read the article

  • Android - When to use Service

    - by Chris
    This question is related to my previous question: http://stackoverflow.com/questions/2786720/android-service-ping-url So I have an Android app that on the click of a button, opens up a web page. Now, in the background I want to call another http url for gathering stats. My question is does this have to be a service? I know a service is for background tasks that run for an indefinite period of time, while the user is busy doing something else. In my case, all I really need is to get the URL in the background, not show it to the user, instead show the web page to the user. Can I just not write code to get contents of the http url and fire up the activity that displays the web page? Coz all I want is to get the url in the background and be done with it. Or does this have to be done using the Service class? I am confused. Thanks Chris

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Android Broadcast Address

    - by Eef
    Hey, I am making a Client Server application for my Android phone. I have created a UDP Server in Python which sits and listens for connections. I can put either the server IP address in directly like 192.169.0.100 and it sends data fine. I can also put in 192.168.0.255 and it find the server on 192.169.0.100. Is it possible to get the broadcast address of the network my Android phone is connected to? I am only ever going to use this application on my Wifi network or other Wifi networks. Cheers

    Read the article

  • Android HelloWorld Build Path error

    - by BahaiResearch.com
    On my Mac I installed Eclipse, the SDK and created a new project, then hit build expecting to see my first helloworld app. I got the error "the project cannot be built until build path errors are fixed". After going thru all the path-like options in Preferences, I noticed that on the tab "Java Build Path" the "Google APIs [Android 2.2]" option did not have its check box checked. Checking it made the problem go away. It works now and I can see the app in the Emulator Have I not set up my environment correctly? I used all the defaults in Eclipse and the Android SDK.

    Read the article

  • Android forwards compatibility

    - by Brian515
    Hi all, I just published my first application to the market, but i just found out that android.telephony.gsm.smsmanager was depreciated as of Android 1.6. My application depends on sending SMS messages, so it cannot not work in 1.6 or newer. I built the project against 1.5, but I only have a device with 1.5 to test on. Since I built on 1.5, am I fine in terms of newer OSes, or will users get force closes? Thanks in advance! P.S. Is there a way to send/receive SMS messages in the emulator? That would be helpful.

    Read the article

  • How to gain greater control of network packets on Android

    - by mauvehead
    I'm looking to design an application that will require some deep control over IP packets. Looking over the reference guide on the developers site at Android I see very limited control over packets from java.net:SocketOptions and java.net:DatagramPacket. Specifically I'm looking to control the individual bits within the packet to set TCP Flags, SYN/ACK/RST, and so forth. Based on the docs I am assuming I cannot do this within the Java API provided by Android and I'm guessing I'll have to do it some other way? Anyone have any insight on this?

    Read the article

< Previous Page | 127 128 129 130 131 132 133 134 135 136 137 138  | Next Page >