Search Results

Search found 78026 results on 3122 pages for 'android file'.

Page 132/3122 | < Previous Page | 128 129 130 131 132 133 134 135 136 137 138 139  | Next Page >

  • Android Broadcast Address

    - by Eef
    Hey, I am making a Client Server application for my Android phone. I have created a UDP Server in Python which sits and listens for connections. I can put either the server IP address in directly like 192.169.0.100 and it sends data fine. I can also put in 192.168.0.255 and it find the server on 192.169.0.100. Is it possible to get the broadcast address of the network my Android phone is connected to? I am only ever going to use this application on my Wifi network or other Wifi networks. Cheers

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Does Android support near real time push notification

    - by j pimmel
    I recently learned about the ability of iPhone apps to receive nearly instantaneous notifications to apps. This is provided in the form of push notifications, a bespoke protocol which keeps an always on data connection to the iPhone and messages binary packets to the app, which pops up alerts incredibly quickly, between 0.5 - 5 seconds from server app send to phone app response time. This is sent as data - rather than SMS - in very very small packets charged as part of the data plan not as incoming messages. I would like to know if using Android there is either a similar facility, or whether it's possible to implement something close to this using Android APIs. To clarify I define similar as: Not an SMS message, but some data driven solution As real time as is possible Is scalable - ie: as the server part of a mobile app, I could notify thousands of app instances in seconds I appreciate the app could be pull based, HTTP request/response style, but ideally I don't want to to be polling that heavily just to check for notification .. besides which it's like drip draining the data plan.

    Read the article

  • AdMob Android integration - what permissions to ask for?

    - by AngryHacker
    In the various videos on the AdMob integration, I've seen that only permission to access the internet is asked for: <uses-permission android:name="android.permission.INTERNET" /> Not that I am an expert in advertising, but wouldn't AdMob need the user's geographic location as well, so that they can serve location specific ads? Or avoid serving certain ads based on a location, like maybe not offering me a Big Mac if I am in India or not adverting a ham sandwich if I am in an Arab country? If AdMob needs those permissions, how do I ask for them?

    Read the article

  • sending binary data via POST on android

    - by wo_shi_ni_ba_ba
    Android supports a limited version of apache's http client(v4). typically if I want to send binary data using content type= application/octet-stream via POST, I do the following: HttpClient client = getHttpClient(); HttpPost method=new HttpPost("http://192.168.0.1:8080/xxx"); System.err.println("send to server "+s); if(compression){ byte[]compressed =compress(s); RequestEntity entity = new ByteArrayRequestEntity(compressed); method.setEntity(entity); } HttpResponse resp=client.execute(method); however ByteArrayRequestEntity is not supported on android. what can I do?

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Building Android app from ant via Hudson - chicken and egg problem

    - by Eno
    When using an Android-generated ant build file, the file references your SDK installation via an sdk.dir property inside the local.properties files which is generated by "android update project -p .". The comments in build.xml suggest that local.properties should NOT be checked into version control. BUT, when you run your build from Hudson, it does a fresh checkout of your code from version control, hence local.properties does not exist and subsequently the build fails without sdk.dir being set. So its kind of chicken and egg problem. As a workaround I have checked local.properties into version control for now (nobody else will use it) but I was curious as to how other developers had tackled this problem ?

    Read the article

  • Trying to make E-commerce android application like E-bay

    - by kaibuki
    Hi All!! I am newbie to android development, and I have got assignment, of creating an android based shopping application something like bestbuy or ebay. so far the challenges I see in it are : 1) how to connect to SQL Server and get the data from there and show it on device. 2) how to do the ordering and other transactions kind of stuff. 3) really is it possible to make such application, as I am alone working on this assignment. looking forward for help from you guys and also any issues which might pop up while developing such application. Thanks regards KAI

    Read the article

  • Android P2P Multiplayer game (with a) XMPP/Google talk b) JXTA peerdroid c) other way)

    - by Kristof
    Hi, I am an android developer and I made some board games. Now i want to make some of my board games multiplayer. I don't want to create and host my own web service, so i thought about P2P. The first thing i found was the XMPP protocol, however it's not real P2P, but if i can use the existing google talk service, i'm ready to go. Is this possible while using your existing google account without interfering with the normal working of your google talk client? Then i heard about JXTA, a real P2P solution, and it's already ported from J2ME to Android (http://code.google.com/p/peerdroid/). Maybe i am overcomplexing things here (as i do sometimes) I just want to know the easiest way to do simple P2P for a boardgame. All your opinions are welcome! Thanks in advance

    Read the article

  • Android: Creating custom class of resources

    - by Sebastian
    Hi, R class on android has it's limitations. You can't use the resources dynamically for loading audio, pictures or whatever. If you wan't for example, load a set of audio files for a choosen object you can't do something like: R.raw."string-upon-choosen-object" I'm new to android and at least I didn't find how you could do that, depending on what objects are choosen or something more dynamic than that. So, I thought about making it dynamic with a little of memory overhead. But, I'm in doubt if it's worth it or just working different with external resources. The idea is this: Modify the ant build xml to execute my own task. This task, is a java program that parses the R.java file building a set of HashMaps with it's pair (key, value). I have done this manually and It's working good. So I need some experts voice about it. This is how I will manage the whole thing: Generate a base Application class, e.g. MainApplicationResources that builds up all the require methods and attributes. Then, you can access those methods invoking getApplication() and then the desired method. Something like this: package [packageName] import android.app.Application; import java.util.HashMap; public class MainActivityResources extends Application { private HashMap<String,Integer> [resNameObj1]; private HashMap<String,Integer> [resNameObj2]; ... private HashMap<String,Integer> [resNameObjN]; public MainActivityResources() { super(); [resNameObj1] = new HashMap<String,Integer>(); [resNameObj1].put("[resNameObj1_Key1]", new Integer([resNameObj1_Value1])); [resNameObj1].put("[resNameObj1_Key2]", new Integer([resNameObj1_Value2])); [resNameObj2] = new HashMap<String,Integer>(); [resNameObj2].put("[resNameObj2_Key1]", new Integer([resNameObj2_Value1])); [resNameObj2].put("[resNameObj2_Key2]", new Integer([resNameObj2_Value2])); ... [resNameObjN] = new HashMap<String,Integer>(); [resNameObjN].put("[resNameObjN_Key1]", new Integer([resNameObjN_Value1])); [resNameObjN].put("[resNameObjN_Key2]", new Integer([resNameObjN_Value2])); } public int get[ResNameObj1](String resourceName) { return [resNameObj1].get(resourceName).intValue(); } public int get[ResNameObj2](String resourceName) { return [resNameObj2].get(resourceName).intValue(); } ... public int get[ResNameObjN](String resourceName) { return [resNameObjN].get(resourceName).intValue(); } } The question is: Will I add too much memory use of the device? Is it worth it? Regards,

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Android - Looking for an AOP solution

    - by Serj Lotutovici
    I'm writing an application that on the bottom line uses it's internal API for some manipulations. The problem is that to call any method provided by that class first I (or anybody who uses the API) have to call #prepare() and after that #cleanup(). It all worked fine until the application and the API started to grow. And the risk of not calling one of the supplied methods before or after the API is now to big to be ignored (which makes it a bug risky application). Searching for a solution I found this question. I use Google Guice in my app for other purposes, but Android doesn't support AOP, that's why a use only guice-no_aop-x.jar. So I end-up with two questions: Is there an AOP solution for android to implement the same approach that is shown in the link above? Or may be someone has an idea that will be suitable for my case? Thanks in advice!

    Read the article

  • Gears or HTML5 Location API on Android 1.5

    - by Dmitry
    Hi there, I am trying to use gwt-mobile-webkit, particularly its location api. It works well with iPhone (both device and simulator) and Firefox and on G1 with 1.6 Android, however, it does not work on G2 with Android 1.5 on it. In result I am getting onFailure callback with Permission Denied error. So it seems, that there is some geolocation API (gears or HTML5) in the browser available, but it just does not want to ask user for granting permissions. Do you know if there is any workaround or just enable it somewhere in settings?

    Read the article

  • Making the user change the time in Android

    - by Casebash
    Android doesn't appear to provide a way for a user application to change the system time. What I would like to do instead is to get the user to change the time. It is easy to open up the Date & Time settings: startActivity(new Intent(android.provider.Settings.ACTION_DATE_SETTINGS)); What I would like to know is: Is it possible to link directly to the set time option? Is it possible to check that the user set the time correctly? I am aware of the TIME_CHANGED broadcast message, but I can't find any documentaion on it

    Read the article

  • UI Guidelines for Android Honeycomb on Tablets

    - by Jason Hanley
    The UI in Android Honeycomb is very different. I'm looking for things that have changed that would be of interest to developers. Google hasn't updated it's UI guidelines yet, so I am trying to find this stuff out by inspecting the layouts. I am mainly interested in dimensions of icons and new types of views. The action bar height is 56dp (?android:attr/actionBarSize). It seems that the menu icons are 32 x 32 dp now, they were 48 x 48 dp before. Since they are in the action bar, they have a lot of padding around them. The size of a menu icon with padding is 64 x 56 dp. I needed this since I was trying to put a ProgressBar as a menu item. Anything else change? Also, I'm interested in the size of some common UI patterns, like the widths for a list/detail layout like the mail client.

    Read the article

  • iPhone or Android for development?

    - by user974873
    I have programming experience and would like to start developing for mobile platforms. Now I see that iPhone and Android are both dominating he smartphone market, but also that more and more people are buying iPhones. Which one would be better to start developing for? I currently do not own a Mac but would purchase a Mac Mini if I was to buy an iPhone. Would it be better to buy iPhone and Mac because it will be better in the long run because of the amount of users or Android?

    Read the article

< Previous Page | 128 129 130 131 132 133 134 135 136 137 138 139  | Next Page >