Search Results

Search found 17448 results on 698 pages for 'regular expressions info'.

Page 136/698 | < Previous Page | 132 133 134 135 136 137 138 139 140 141 142 143  | Next Page >

  • FacebookRestClientException: A session key is required for calling this method in

    - by simple
    I have a app, that is used in the fanpage, so basically I am showing up the user request/invite form, after submission which refers to my server and I get friends ids(from $_POST) and info about user who sent invite, to get user info I am using $user = $this->_facebook->api_client->users_getLoggedInUser(); $dataToRetrive = array(....); $usersInfo = $this->_facebook->api_client->users_getInfo($user,$dataToRetrive); and then I redirect to fan page again in FF it is working fine but OPera and Chrome it is loosing the session.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • accessing SQL syntax reference in mysql workbench

    - by dcompiled
    Finding it a little bit tedious migrating to the new Mysql Workbench (5.2.22) even though it has many more features than the older GUI tools. Right now I'm confused why I can't find an SQL reference when I open the Doc Library. Is there a way to access this info within the workbench, I'd prefer not to have to open a browser to access reference info on the web.

    Read the article

  • How to parse json data in jquery ajax success?

    - by samarh.k
    info = {'phone_number': '123456', 'personal_detail': {'foo':foo, 'bar':bar}, 'is_active': 1, 'document_detail': {'baz':baz, 'saz':saz}, 'is_admin': 1, 'email': '[email protected]'} return HttpResponse(simplejson.dumps({'success':'True', 'result':info}), mimetype='application/javascript') if(data["success"] === "True") { alert(data[**here I want to display personal_detail and document_details**]); } How can I do this?

    Read the article

  • Parameters through postback

    - by Brian Roisentul
    I'm working with Ruby on rails 2.3.4 and I'd like to pass some parameters from one page to another ones the first one is submitted. For example: On the first page, I have a form that when it's filled a Preview button can be clicked to check all the info entered before submitting the form. That button redirects to another page with the info entered before, but I don't know how to get it in the second page.

    Read the article

  • make user attend event through sdk

    - by Jakob Dam Jensen
    I was wondering if it's possible to make a user attend an event through the sdk (probably fql). I've been looking at the wiki for FQL info as well as the graph api. But both look like they only support fetching info and not changing... Any suggestions? I would like to build this feature into an application....

    Read the article

  • Debug the StackOverFlow exception

    - by BDotA
    When I run my C# program it throws an Stack Overflow exception in one of the methods on a DLL that I have a reference to it in my solution. but no debugging info is available to me because it says it is an stack overflow exception and no info is available. what are the next debugging steps that I should follow to understand what is going on and why ? thanks Edit: here is the code that stops at: static public Collection SortCollection(Collection oCollection, string sPropertyName, string sKeyPropertyName) { return SortCollection(oCollection, sPropertyName, sKeyPropertyName); }

    Read the article

  • Get functions called with GDB

    - by Werner
    Hi, I am using GDB to understand a C++ program. I put a break in the middle of the running which turns to be something like: break main.cpp:500 and I would like to see which functions have been called before. I tried "backtrace" but it shows only info about main, as previous calls to previous functions have already finished. My question is how can I get (with GDB or another method) the info about which functions have been called before this point, even if the call has been returned. Thanks

    Read the article

  • Check directory for files, retrieve first file

    - by Lowgain
    I'm writing a small ruby daemon that I am hoping will do the following: Check if a specific directory has files (in this case, .yml files) If so, take the first file (numerically sorted preferrably), and parse into a hash Do a 'yield', with this hash as the argument What I have right now is like: loop do get_next_in_queue { |s| THINGS } end def get_next_in_queue queue_dir = Dir[File.dirname(__FILE__)+'/../queue'] info = YAML::load_file(queue_dir[0]) #not sure if this works or not yield info end I'd like to make the yield conditional if possible, so it only happens if a file is actually found. Thanks!

    Read the article

  • How do I make the main window to react to a table click

    - by Ayelet
    I am a new user of Java swing. I need to be able to create a popup with row info when the user clicks on that row. I managed to incorporate the mouseClick event reaction in my table class, and I have the row info available. But I don't know how to notify the main window about the event so it can display the dialog box/popup box. Can you help me?

    Read the article

  • Parse metadata from http live stream

    - by supo
    Hi, I'd like to extract the info string from an internet radio streamed over HTTP. By info string I mean the short note about the currently played song, band name etc. Preferably I'd like to do it in python. So far I've tried opening a socket but from there I got a bunch of binary data that I could not parse... thanks for any hints

    Read the article

  • Binary string search on one field.

    - by CrazyJoe
    I have 300 boolean fields in one table, and im trying to do somithing like that: One string field: 10000010000100100100100100010001 Ha a simple way to do a simple search os this field like: select * from table where field xor "10000010000100100100000000010001" Im tring this but is to long: select * from teste where mid(info,2,1) and mid(info,3,1) :) Help!!

    Read the article

  • Parse livescores from web site

    - by Venno
    Hi all, I was thinking of parsing live scores from a web site via PHP and them use them for an application I am planning to implement, so my question is is it legal to do that, parse info from web site and use it ? If I quote the source if the info ?

    Read the article

  • How to stop windows from adding additional keyboards to languages

    - by MMavipc
    I have the English language setup with the normal en-us layout, and only this layout. I have the Spanish language setup with united states - international layout. When I switch to English it gives me the option to select the regular keyboard or the international version. Only the regular version is listed under EN in my language settings. How do I get it to remove the international keyboard from English? Sometimes it switches to international while I'm on English mode and screws up my typing, which is a pain in the ass.

    Read the article

  • add new records using signal in django admin

    - by ganesh
    I've a model called broadcastinfo, It has fields viz.. info,userid...userid is excluded. when i add an new info, my broadcastinfo table should get the records of all userid from user table and the given message. Im trying this via signal.Any idea is highly appreciated. Thanks

    Read the article

  • WinCheat / WinSpy-like tool for C++ Builder exes

    - by mawg
    I just came back to C++ Builder after 5 or more years away. I seem to remember a nice tool where I could drag its pointer over the GUI of my running application and get lots of info about what was pointed at - handle, size, text, parent, children, etc IIRC, if the exe include debug info I could also get the actual variable name as used in the source. Does anyone know what program I am talking about? Thanks

    Read the article

  • Cakephp: how do I know what route was used

    - by Jason
    So I am a total cakephp newb and one of the first things I expected to see basic info about each page request logged. More specifically, what route data including what controller/method is being used. Obviously I did not find what I was expecting and about the only kind of meaning info I can find is from the apache logs. What I expected was to see something similar to first log entry for a rails app request. Does cakephp not log this kind of data?

    Read the article

  • PHP and MySQL - correct way to use mysqli_real_escape_string

    - by TaG
    I was wondering if the code below is the correct way to use mysqli_real_escape_string() when storing users data in a database. Here is the PHP & MySQL code. if (mysqli_num_rows($dbc) == 0) { $mysqli = mysqli_connect("localhost", "root", "", "sitename"); $dbc = mysqli_query($mysqli,"INSERT INTO info (user_id, url) VALUES ('$user_id', 'mysqli_real_escape_string($url)')"); } if ($dbc == TRUE) { $dbc = mysqli_query($mysqli,"UPDATE info SET url = 'mysqli_real_escape_string($url)' WHERE user_id = '$user_id'");

    Read the article

  • ruby sortby 3rd element in a multidimential array npot working properly

    - by Steven
    Hi, I'm using ruby to sort an array where each element in the array is another array. I have this: Data = Data.SortBy { |Info| info[3] } example data in this column: 3.1 2 5.65 -1 0.4 -9.43 -10.87 -2.3 It should sort this into: 5.65 3.1 2 0.4 -1 -2.3 -9.43 -10.87 But it comes out like this: 5.65 3.1 2 0.4 -1 -10.87 -2.3 -9.43 It's only comparing the first char of the float... not the whole number?

    Read the article

  • Registration form validation not validating

    - by jgray
    I am a noob when it comes to web development. I am trying to validate a registration form and to me it looks right but it will not validate.. This is what i have so far and i am validating through a repository or database. Any help would be greatly appreciated. thanks <?php session_start(); $title = "User Registration"; $keywords = "Name, contact, phone, e-mail, registration"; $description = "user registration becoming a member."; require "partials/_html_header.php"; //require "partials/_header.php"; require "partials/_menu.php"; require "DataRepository.php"; // if all validation passed save user $db = new DataRepository(); // form validation goes here $first_nameErr = $emailErr = $passwordErr = $passwordConfirmErr = ""; $first_name = $last_name = $email = $password = $passwordConfirm = ""; if(isset($_POST['submit'])) { $valid = TRUE; // check if all fields are valid { if ($_SERVER["REQUEST_METHOD"] == "POST") { if (empty($_POST["first_name"])) {$first_nameErr = "Name is required";} else { // $first_name = test_input($_POST["first_name"]); // check if name only contains letters and whitespace if (!preg_match("/^[a-zA-Z ]*$/",$first_name)) { $first_nameErr = "Only letters and white space allowed"; } } if (empty($_POST["email"])) {$emailErr = "Email is required";} else { // $email = test_input($_POST["email"]); // check if e-mail address syntax is valid if (!preg_match("/([\w\-]+\@[\w\-]+\.[\w\-]+)/",$email)) { $emailErr = "Invalid email format"; } } if (!preg_match("/(......)/",$password)) { $passwordErr = "Subject must contain THREE or more characters!"; } if ($_POST['password']!= $_POST['passwordConfirm']) { echo("Oops! Password did not match! Try again. "); } function test_input($data) { $data = trim($data); $data = stripslashes($data); $data = htmlspecialchars($data); return $data; } } } if(!$db->isEmailUnique($_POST['email'])) { $valid = FALSE; //display errors in the correct places } // if still valid save the user if($valid) { $new_user = array( 'first_name' => $_POST['first_name'], 'last_name' => $_POST['last_name'], 'email' => $_POST['email'], 'password' => $_POST['password'] ); $results = $db->saveUser($new_user); if($results == TRUE) { header("Location: login.php"); } else { echo "WTF!"; exit; } } } ?> <head> <style> .error {color: #FF0000;} </style> </head> <h1 class="center"> World Wide Web Creations' User Registration </h1> <p><span class="error"></span><p> <form method="POST" action="<?php echo htmlspecialchars($_SERVER["PHP_SELF"]);?>" onsubmit="return validate_form()" > First Name: <input type="text" name="first_name" id="first_name" value="<?php echo $first_name;?>" /> <span class="error"> <?php echo $first_nameErr;?></span> <br /> <br /> Last Name(Optional): <input type="text" name="last_name" id="last_name" value="<?php echo $last_name;?>" /> <br /> <br /> E-mail: <input type="email" name="email" id="email" value="<?php echo $email;?>" /> <span class="error"> <?php echo $emailErr;?></span> <br /> <br /> Password: <input type="password" name="password" id="password" value="" /> <span class="error"> <?php echo $passwordErr;?></span> <br /> <br /> Confirmation Password: <input type="password" name="passwordConfirm" id="passwordConfirm" value="" /> <span class="error"> <?php echo $passwordConfirmErr;?></span> <br /> <br /> <br /> <br /> <input type="submit" name="submit" id="submit" value="Submit Data" /> <input type="reset" name="reset" id="reset" value="Reset Form" /> </form> </body> </html> <?php require "partials/_footer.php"; require "partials/_html_footer.php"; ?> class DataRepository { // version number private $version = "1.0.3"; // turn on and off debugging private static $debug = FALSE; // flag to (re)initialize db on each call private static $initialize_db = FALSE; // insert test data on initialization private static $load_default_data = TRUE; const DATAFILE = "203data.txt"; private $data = NULL; private $errors = array(); private $user_fields = array( 'id' => array('required' => 0), 'created_at' => array('required' => 0), 'updated_at' => array('required' => 0), 'first_name' => array('required' => 1), 'last_name' => array('required' => 0), 'email' => array('required' => 1), 'password' => array('required' => 1), 'level' => array('required' => 0, 'default' => 2), ); private $post_fields = array( 'id' => array('required' => 0), 'created_at' => array('required' => 0), 'updated_at' => array('required' => 0), 'user_id' => array('required' => 1), 'title' => array('required' => 1), 'message' => array('required' => 1), 'private' => array('required' => 0, 'default' => 0), ); private $default_user = array( 'id' => 1, 'created_at' => '2013-01-01 00:00:00', 'updated_at' => '2013-01-01 00:00:00', 'first_name' => 'Admin Joe', 'last_name' => 'Tester', 'email' => '[email protected]', 'password' => 'a94a8fe5ccb19ba61c4c0873d391e987982fbbd3', 'level' => 1, ); private $default_post = array( 'id' => 1, 'created_at' => '2013-01-01 00:00:00', 'updated_at' => '2013-01-01 00:00:00', 'user_id' => 1, 'title' => 'My First Post', 'message' => 'This is the message of the first post.', 'private' => 0, ); // constructor will load existing data into memory // if it does not exist it will create it and initialize if desired public function __construct() { // check if need to reset if(DataRepository::$initialize_db AND file_exists(DataRepository::DATAFILE)) { unlink(DataRepository::DATAFILE); } // if file doesn't exist, create the initial datafile if(!file_exists(DataRepository::DATAFILE)) { $this->log("Data file does not exist. Attempting to create it... (".__FUNCTION__.":".__LINE__.")"); // create initial file $this->data = array( 'users' => array( ), 'posts' => array() ); // load default data if needed if(DataRepository::$load_default_data) { $this->data['users'][1] = $this->default_user; $this->data['posts'][1] = $this->default_post; } $this->writeTheData(); } // load the data into memory for use $this->loadTheData(); } private function showErrors($break = TRUE, $type = NULL) { if(count($this->errors) > 0) { echo "<div style=\"color:red;font-weight: bold;font-size: 1.3em\":<h3>$type Errors</h3><ol>"; foreach($this->errors AS $error) { echo "<li>$error</li>"; } echo "</ol></div>"; if($break) { "</br></br></br>Exiting because of errors!"; exit; } } } private function writeTheData() { $this->log("Attempting to write the datafile: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); file_put_contents(DataRepository::DATAFILE, json_encode($this->data)); $this->log("Datafile written: ".DataRepository::DATAFILE." (line: ".__LINE__.")"); } private function loadTheData() { $this->log("Attempting to load the datafile: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); $this->data = json_decode(file_get_contents(DataRepository::DATAFILE), true); $this->log("Datafile loaded: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")", $this->data); } private function validateFields(&$info, $fields, $pre_errors = NULL) { // merge in any pre_errors if($pre_errors != NULL) { $this->errors = array_merge($this->errors, $pre_errors); } // check all required fields foreach($fields AS $field => $reqs) { if(isset($reqs['required']) AND $reqs['required'] == 1) { if(!isset($info[$field]) OR strlen($info[$field]) == 0) { $this->errors[] = "$field is a REQUIRED field"; } } // set any default values if not present if(isset($reqs['default']) AND (!isset($info[$field]) OR $info[$field] == "")) { $info[$field] = $reqs['default']; } } $this->showErrors(); if(count($this->errors) == 0) { return TRUE; } else { return FALSE; } } private function validateUser(&$user_info) { // check if the email is already in use $this->log("About to check pre_errors: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")", $user_info); $pre_errors = NULL; if(isset($user_info['email'])) { if(!$this->isEmailUnique($user_info['email'])) { $pre_errors = array('The email: '.$user_info['email'].' is already used in our system'); } } $this->log("After pre_error check: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")", $pre_errors); return $this->validateFields($user_info, $this->user_fields, $pre_errors); } private function validatePost(&$post_info) { // check if the user_id in the post actually exists $this->log("About to check pre_errors: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")", $post_info); $pre_errors = NULL; if(isset($post_info['user_id'])) { if(!isset($this->data['users'][$post_info['user_id']])) { $pre_errors = array('The posts must belong to a valid user. (User '.$post_info['user_id'].' does not exist in the data'); } } $this->log("After pre_error check: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")", $pre_errors); return $this->validateFields($post_info, $this->post_fields, $pre_errors); } private function log($message, $data = NULL) { $style = "background-color: #F8F8F8; border: 1px solid #DDDDDD; border-radius: 3px; font-size: 13px; line-height: 19px; overflow: auto; padding: 6px 10px;"; if(DataRepository::$debug) { if($data != NULL) { $dump = "<div style=\"$style\"><pre>".json_encode($data, JSON_PRETTY_PRINT)."</pre></div>"; } else { $dump = NULL; } echo "<code><b>Debug:</b> $message</code>$dump<br />"; } } public function saveUser($user_info) { $this->log("Entering saveUser: (".__FUNCTION__.":".__LINE__.")", $user_info); $mydata = array(); $update = FALSE; // check for existing data if(isset($user_info['id']) AND $this->data['users'][$user_info['id']]) { $mydata = $this->data['users'][$user_info['id']]; $this->log("Loaded prior user: ".print_r($mydata, TRUE)." (".__FUNCTION__.":".__LINE__.")"); } // copy over existing values $this->log("Before copying over existing values: (".__FUNCTION__.":".__LINE__.")", $mydata); foreach($user_info AS $k => $v) { $mydata[$k] = $user_info[$k]; } $this->log("After copying over existing values: (".__FUNCTION__.":".__LINE__.")", $mydata); // check required fields if($this->validateUser($mydata)) { // hash password if new if(isset($mydata['password'])) { $mydata['password'] = sha1($mydata['password']); } // if no id, add the next available one if(!isset($mydata['id']) OR (int)$mydata['id'] < 1) { $this->log("No id set: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); if(count($this->data['users']) == 0) { $mydata['id'] = 1; $this->log("Setting id to 1: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); } else { $mydata['id'] = max(array_keys($this->data['users']))+1; $this->log("Found max id and added 1 [".$mydata['id']."]: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); } } // set created date if null if(!isset($mydata['created_at'])) { $mydata['created_at'] = date ("Y-m-d H:i:s", time()); } // update modified time $mydata['modified_at'] = date ("Y-m-d H:i:s", time()); // copy into data and save $this->log("Before data save: (".__FUNCTION__.":".__LINE__.")", $this->data); $this->data['users'][$mydata['id']] = $mydata; $this->writeTheData(); } return TRUE; } public function getUserById($id) { if(isset($this->data['users'][$id])) { return $this->data['users'][$id]; } else { return array(); } } public function isEmailUnique($email) { // find the user that has the right username/password foreach($this->data['users'] AS $k => $v) { $this->log("Checking unique email: {$v['email']} == $email (".__FUNCTION__.":".__LINE__.")", NULL); if($v['email'] == $email) { $this->log("FOUND NOT unique email: {$v['email']} == $email (".__FUNCTION__.":".__LINE__.")", NULL); return FALSE; break; } } $this->log("Email IS unique: $email (".__FUNCTION__.":".__LINE__.")", NULL); return TRUE; } public function login($username, $password) { // hash password for validation $password = sha1($password); $this->log("Attempting to login with $username / $password: (".__FUNCTION__.":".__LINE__.")", NULL); $user = NULL; // find the user that has the right username/password foreach($this->data['users'] AS $k => $v) { if($v['email'] == $username AND $v['password'] == $password) { $user = $v; break; } } $this->log("Exiting login: (".__FUNCTION__.":".__LINE__.")", $user); return $user; } public function savePost($post_info) { $this->log("Entering savePost: (".__FUNCTION__.":".__LINE__.")", $post_info); $mydata = array(); // check for existing data if(isset($post_info['id']) AND $this->data['posts'][$post_info['id']]) { $mydata = $this->data['posts'][$post_info['id']]; $this->log("Loaded prior posts: ".print_r($mydata, TRUE)." (".__FUNCTION__.":".__LINE__.")"); } $this->log("Before copying over existing values: (".__FUNCTION__.":".__LINE__.")", $mydata); foreach($post_info AS $k => $v) { $mydata[$k] = $post_info[$k]; } $this->log("After copying over existing values: (".__FUNCTION__.":".__LINE__.")", $mydata); // check required fields if($this->validatePost($mydata)) { // if no id, add the next available one if(!isset($mydata['id']) OR (int)$mydata['id'] < 1) { $this->log("No id set: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); if(count($this->data['posts']) == 0) { $mydata['id'] = 1; $this->log("Setting id to 1: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); } else { $mydata['id'] = max(array_keys($this->data['posts']))+1; $this->log("Found max id and added 1 [".$mydata['id']."]: ".DataRepository::DATAFILE." (".__FUNCTION__.":".__LINE__.")"); } } // set created date if null if(!isset($mydata['created_at'])) { $mydata['created_at'] = date ("Y-m-d H:i:s", time()); } // update modified time $mydata['modified_at'] = date ("Y-m-d H:i:s", time()); // copy into data and save $this->data['posts'][$mydata['id']] = $mydata; $this->log("Before data save: (".__FUNCTION__.":".__LINE__.")", $this->data); $this->writeTheData(); } return TRUE; } public function getAllPosts() { return $this->loadPostsUsers($this->data['posts']); } public function loadPostsUsers($posts) { foreach($posts AS $id => $post) { $posts[$id]['user'] = $this->getUserById($post['user_id']); } return $posts; } public function dump($line_number, $temp = 'NO') { // if(DataRepository::$debug) { if($temp == 'NO') { $temp = $this->data; } echo "<pre>Dumping from line: $line_number\n"; echo json_encode($temp, JSON_PRETTY_PRINT); echo "</pre>"; } } } /* * Change Log * * 1.0.0 * - first version * 1.0.1 * - Added isEmailUnique() function for form validation and precheck on user save * 1.0.2 * - Fixed getAllPosts() to include the post's user info * - Added loadPostsUsers() to load one or more posts with their user info * 1.0.3 * - Added autoload to always add admin Joe. */

    Read the article

  • How do I mysql select with aliases from another table?

    - by Rob
    I'm working with a CMS system where I cannot control database column names. And I've got two related tables: Table: content +------------+----------+----------+----------+----------+ | content_id | column_1 | column_2 | column_3 | column_4 | +------------+----------+----------+----------+----------+ | 1 | stuff | junk | text | info | | 2 | trash | blah | what | bio | +------------+----------+----------+----------+----------+ Table: column_names +------------+-------------+ | column_id | column_name | +------------+-------------+ | 1 | good_text | | 2 | bad_text | | 3 | blue_text | | 4 | red_text | +------------+-------------+ What I'd like to do here is select from the first table, but select the columns AS the column_name from the second table. So my result would look like: +------------+-----------+----------+-----------+----------+ | content_id | good_text | bad_text | blue_text | red_text | +------------+-----------+----------+-----------+----------+ | 1 | stuff | junk | text | info | | 2 | trash | blah | what | bio | +------------+-----------+----------+-----------+----------+

    Read the article

< Previous Page | 132 133 134 135 136 137 138 139 140 141 142 143  | Next Page >