Search Results

Search found 10046 results on 402 pages for 'repository pattern'.

Page 154/402 | < Previous Page | 150 151 152 153 154 155 156 157 158 159 160 161  | Next Page >

  • Proper way to use Linq with WPF

    - by Ingó Vals
    I'm looking for a good guide into the right method of using Linq to Sql together with WPF. Most guides only go into the bare basics like how to show data from a database but noone I found goes into how to save back to the database. Can you answer or point out to me a guide that can answer these questions. I have a separate Data project because the same data will also be used in a web page so I have the repository method. That means I have a seperate class that uses the DataContext and there are methods like GetAllCompanies() and GetCompanyById ( int id ). 1) Where there are collections is it best to return as a IQueryable or should I return a list? Inside the WPF project I have seen reccomendations to wrap the collection in a ObservabgleCollection. 2) Why should I use ObservableCollection and should I use it even with Linq / IQueryable Some properties of the linq entities should be editable in the app so I set them to two-way mode. That would change the object in the observableCollection. 3) Is the object in the ObservableCollection still a instance of the original linq entity and so is the change reflected in the database ( when submitchanges is called ) I should have somekind of save method in the repository. But when should I call it? What happens if someone edits a field but decides not to save it, goes to another object and edits it and then press save. Doesn't the original change also save? When does it not remember the changes to a linq entity object anymore. Should I instance the Datacontext class in each method so it loses scope when done. 4) When and how to call the SubmitChanges method 5) Should I have the DataContext as a member variable of the repository class or a method variable To add a new row I should create a new object in a event ( "new" button push ) and then add it to the database using a repo method. 6) When I add the object to the database there will be no new object in the ObservableCollection. Do I refresh somehow. 7) I wan't to reuse the edit window when creating new but not sure how to dynamically changing from referencing selected item from a listview to this new object. Any examples you can point out.

    Read the article

  • str_replace match only first instance

    - by kylex
    A followup question to http://stackoverflow.com/questions/3063704/ Given the following POST data: 2010-June-3 <remove>2010-June-3</remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-3 2010-June-1 I'm wanting to remove ONLY the first instance of 2010-June-3, but the following code removes all the data. $i = 1; $pattern = "/<remove>(.*?)<\/remove>/"; preg_match_all($pattern, $_POST['exclude'], $matches, PREG_SET_ORDER); if (!empty($matches)) { foreach ($matches as $match) { // replace first instance of excluded data $_POST['exclude'] = str_replace($match[1], "", $_POST['exclude'], $i); } } echo "<br /><br />".$_POST['exclude']; This echos: <remove></remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-1 It should echo: <remove>2010-June-3</remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-3 2010-June-1

    Read the article

  • If you are forced to use an Anemic domain model, where do you put your business logic and calculated

    - by Jess
    Our current O/RM tool does not really allow for rich domain models, so we are forced to utilize anemic (DTO) entities everywhere. This has worked fine, but I continue to struggle with where to put basic object-based business logic and calculated fields. Current layers: Presentation Service Repository Data/Entity Our repository layer has most of the basic fetch/validate/save logic, although the service layer does a lot of the more complex validation & saving (since save operations also do logging, checking of permissions, etc). The problem is where to put code like this: Decimal CalculateTotal(LineItemEntity li) { return li.Quantity * li.Price; } or Decimal CalculateOrderTotal(OrderEntity order) { Decimal orderTotal = 0; foreach (LineItemEntity li in order.LineItems) { orderTotal += CalculateTotal(li); } return orderTotal; } Any thoughts?

    Read the article

  • WCF client proxy initialization

    - by 123Developer
    I am consuming a WCF service and created its proxy using the VS 2008 service reference. I am looking for the best pattern to call WCF service method Should I create the client proxy instance every time I call the service method and close the client as soon as I am done with that? When I profiled my client application, I could see that it is taking lot of time to get the Channel while initializing the proxy client Should I use a Singleton pattern for the client proxy so that I can use the only once instance and get rid of the re-initializing overhead? Is there any hidden problem with this approach? I am using .Net framework 3.5 SP1, basicHttp binding with little customization.

    Read the article

  • javascript string exec strange behavior

    - by Michael
    have funciton in my object which is called regularly. parse : function(html) { var regexp = /...some pattern.../ var match = regexp.exec(html); while (match != null) { ... match = regexp.exec(html); } ... var r = /...pattern.../g; var m = r.exec(html); } with unchanged html the m returns null each other call. let's say parse(html);// ok parse(html);// m is null!!! parse(html);// ok parse(html);// m is null!!! // ...and so on... is there any index or somrthing that has to be reset on html ... I'm really confused. Why match always returns proper result?

    Read the article

  • Source control on internet i.e. no private networks.

    - by Kavitesh Singh
    Me and my friend are in the process of starting a small project and want to implement a source control. Now both are located in different cities and can communicate using internet for file sharing etc. I need an online hosting solution or any way where i can maintain the source code repository for both of us to check in/out. As of now we want to maintain it as private project. Does sourceforge allow hosting projects which would not be opensource? One option i was thinking, to obtain a static IP form ISP and host the repository.But that mean my system needs to be online when my friend wants to checkin/out or do some diff with old version code. Secondly, would SVN or git be a better choice in such a situation. I have no experience in git/mercurial as of now.

    Read the article

  • Windows Phone 7, MVVM, Silverlight and navigation best practice / patterns and strategies

    - by Matt F
    Whilst building a Windows Phone 7 app. using the MVVM pattern we've struggled to get to grips with a pattern or technique to centralise navigation logic that will fit with MVVM. To give an example, everytime the app. calls our web service we check that the logon token we've assigned the app. earlier hasn't expired. We always return some status to the phone from the web service and one of those might be Enum.AuthenticationExpired. If we receive that I'd imagine we'd alert the user and navigate back to the login screen. (this is one of many examples of status we might receive) Now, wanting to keep things DRY, that sort of logic feels like it should be in one place. Therein lies my question. How should I go about modelling navigation that relies on (essentially) switch or if statements to tell us where to navigate to next without repeating that in every view. Are there recognised patterns or techniques that someone could recommend? Thanks

    Read the article

  • Auto deployment of PHP applications

    - by Christopher McCann
    My team currently has a development web/database server and a live deployment web server and a live database server. We use SVN with the repository stored on the development server but the problem is our deployment process. Currently when we need to deploy an update to the live application we simply use SFTP to transfer from the repository to the live web server and then amend the database on the live server to reflect the development database. This is a really slow process as we also minify all javascript and CSS files. I have used Capistrano for Ruby and Cruise Control for java but I have never used anything for PHP. I'd rather not have to build our own if something already existed. Does anyone know of anything?

    Read the article

  • plist vs static array

    - by morticae
    Generally, I use static arrays and dictionaries for containing lookup tables in my classes. However, with the number of classes creeping quickly into the hundreds, I'm hesitant to continue using this pattern. Even if these static collections are initialized lazily, I've essentially got a bounded memory leak going on as someone uses my app. Most of these are arrays of strings so I can convert strings into NSInteger constants that can be used with switch statements, etc. I could just recreate the array/dictionary on every call, but many of these functions are used heavily and/or in tight loops. So I'm trying to come up with a pattern that is both performant and not persistent. If I store the information in a plist, does the iphoneOS do anything intelligent about caching those when loaded? Do you have another method that might be related?

    Read the article

  • How to display a DateTime with chosen date parts, but in the order of the FormatProvider?

    - by Stephane
    I want to display the date in the order that the culture provides, but with the elements I want only. The DateTime.Tostring() method has a list of patterns that are very useful but I would like a very small change in it. The CultureInfo used in the following the following code are chosen as example, I don't want to rely on a specific list of CultureInfo, if possible var now = DateTime.Now; string nowString = now.ToString("m", CultureInfo.GetCultureInfo("en-us")); Console.WriteLine(nowString); nowString = now.ToString("m", CultureInfo.GetCultureInfo("fr-FR")); Console.WriteLine(nowString); displays : April 12 12 avril I would like a pattern that display the abbreviation of the month and the day, but that keeps the correct order from the specified CultureInfo. using the pattern "MMM dd" will always display the month's abbreviation first, followed by the day, breaking the french order for example. Any way to achieve that without too much custom code?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to see a branch created in master

    - by richard
    Hi, I create a branch in my master repository (192.168.1.2). And in my other computer, I did '$ git pull --rebase ', I see Unpacking objects: 100% (16/16), done. From git+ssh://[email protected]/media/LINUXDATA/mozilla-1.9.1 62d004e..b291703 master -> origin/master * [new branch] improv -> origin/improv But when I do a 'git branch' in my local repository, I see only 1 branch and I did '$ git checkout improv ' $ git branch * master $ git checkout improv error: pathspec 'improv' did not match any file(s) known to git. Did you forget to 'git add'?

    Read the article

  • Integrating Fish eye with Jenkins

    - by ramaperumal
    Jenkins is up and running in my organization.In configure tab under Repository browser we have an option called fish eye.If I select fish eye as an repository browser it is asking the fish eye URL (such as http://fisheye6.cenqua.com/browse/ant/)My requirment is I need to fetch the reports such as (we would like to track the SVN to take chain change report, to give statistics on how many check-in happening in each code base, how many cut has been taken from each branches…etc ).We need to achieve all these things in Jenkins itself. For performing such things we need to setup the seperate fish eye server.If that is the case why we have the fish eye option in jenkins.We can perform all these activities in Fisheye instead of Jenkins. Please suggest, Thx Rama

    Read the article

  • How to combine designable components with dependency injection

    - by Wim Coenen
    When creating a designable .NET component, you are required to provide a default constructor. From the IComponent documentation: To be a component, a class must implement the IComponent interface and provide a basic constructor that requires no parameters or a single parameter of type IContainer. This makes it impossible to do dependency injection via constructor arguments. (Extra constructors could be provided, but the designer would ignore them.) Some alternatives we're considering: Service Locator Don't use dependency injection, instead use the service locator pattern to acquire dependencies. This seems to be what IComponent.Site.GetService is for. I guess we could create a reusable ISite implementation (ConfigurableServiceLocator?) which can be configured with the necessary dependencies. But how does this work in a designer context? Dependency Injection via properties Inject dependencies via properties. Provide default instances if they are necessary to show the component in a designer. Document which properties need to be injected. Inject dependencies with an Initialize method This is much like injection via properties but it keeps the list of dependencies that need to be injected in one place. This way the list of required dependencies is documented implicitly, and the compiler will assists you with errors when the list changes. Any idea what the best practice is here? How do you do it? edit: I have removed "(e.g. a WinForms UserControl)" since I intended the question to be about components in general. Components are all about inversion of control (see section 8.3.1 of the UMLv2 specification) so I don't think that "you shouldn't inject any services" is a good answer. edit 2: It took some playing with WPF and the MVVM pattern to finally "get" Mark's answer. I see now that visual controls are indeed a special case. As for using non-visual components on designer surfaces, I think the .NET component model is fundamentally incompatible with dependency injection. It appears to be designed around the service locator pattern instead. Maybe this will start to change with the infrastructure that was added in .NET 4.0 in the System.ComponentModel.Composition namespace.

    Read the article

  • handle when callback to a dealloced delegate?

    - by athanhcong
    Hi all, I implemented the delegate-callback pattern between two classes without retaining the delegate. But in some cases, the delegate is dealloced. (My case is that I have a ViewController is the delegate object, and when the user press back button to pop that ViewController out of the NavigationController stack) Then the callback method get BAD_EXE: if (self.delegate != nil && [self.delegate respondsToSelector:selector]) { [self.delegate performSelector:selector withObject:self withObject:returnObject]; } I know the delegate-callback pattern is implemented in a lot of application. What is your solution for this?

    Read the article

  • Rollback in lucene

    - by Petrick Lim
    Is there a rollback in lucene? I'm saving & updating database repository & lucene repository simultaneously so that the lucene index & database are in sync.. ex. CustomerRepository.add(customer); SupplierRepository.add(supplier); CustomerLuceneRepository.add(customer); SupplierLuceneRepository.add(supplier); // If this here fails i cannot rollback the customer above DataContext.SubmitChanges();

    Read the article

  • Sorting based on existing elements in xslt

    - by Teelo
    Hi , I want to sort in xslt based on existing set of pattern . Let me explain with the code: <Types> <Type> <Names> <Name>Ryan</Name> </Names> <Address>2344</Address> </Type> <Type> <Names> </Name>Timber</Name> </Names> <Address>1234</Address> </Type> <Type> <Names> </Name>Bryan</Name> </Names> <Address>34</Address> </Type> </Types> Right now I m just calling it and getting it like (all hyperlinks) Ryan Timber Bryan Now I don't want sorting on name but I have existing pattern how I want it to get displayed.Like Timber Bryan Ryan (Also I don't want to lose the url attached to my names earlier while doing this) I was thinking of putting earlier value in some array and sort based on the other array where I will store my existing pattern. But I am not sure how to achieve that.. My xslt looks like this now(there can be duplicate names also) <xsl:for-each select="/Types/Type/Names/Name/text()[generate-id()=generate-id(key('Name',.)[1])]"> <xsl:call-template name="typename"> </xsl:call-template> </xsl:for-each> <xsl:template name="typename"> <li> <a href="somelogicforurl"> <xsl:value-of select="."/> </a> </li> </xsl:template> I am using xsl 1.0

    Read the article

  • SVN Path Based Authorization: Granting listing access but not read access

    - by Jim
    Hello, We're using path-based-authorization module for Apache SVN. It all works fine, except that when users try to check out code they have access to, their SVN clients get confused if they don't have at least read access to the parent directories - all the way up to root. It works, but some clients just get confused sometimes. Because SVN path-based-authorization is recursively applied, we don't want to give all users read access to root, because that would give them access to all source code in the repository. It would, however, be acceptable if users could get directory listings (just not actual lines of code) for the entire repository. This would prevent the svn clients from getting confused. Does any one know how to grant permissions to get directory listings without granting permissions to the actual contents of the files? Thanks!

    Read the article

  • Subversion error, but I don't know what it means

    - by DaveDev
    I'm trying to do an Update on my solution but I'm getting the following subversion error: SharpSvn.SvnFileSystemException: Working copy path 'Path_to_image/logo LoRes.jpg' does not exist in repository but I can see that the image is in the repository. The stack trace is as follows: at SharpSvn.SvnClientArgs.HandleResult(SvnClientContext client, SvnException error) at SharpSvn.SvnClientArgs.HandleResult(SvnClientContext client, svn_error_t* error) at SharpSvn.SvnClient.Update(ICollection`1 paths, SvnUpdateArgs args, SvnUpdateResult& result) at SharpSvn.SvnClient.Update(String path, SvnUpdateArgs args, SvnUpdateResult& result) at Ankh.Commands.SolutionUpdateCommand.UpdateRunner.Work(Object sender, ProgressWorkerArgs e) at Ankh.ProgressRunnerService.ProgressRunner.Run(Object arg) Is there something else that could be wrong?

    Read the article

  • linq-to-sql "an attempt has been made to attach or add an entity that is not new"?

    - by Curtis White
    I've been getting several errors: cannot add an entity with a key that is already in use An attempt has been made to attach or add an entity that is not new, perhaps having been loaded from another datacontext In case 1, this stems from trying to set the key for an entity versus the entity. In case 2, I'm not attaching an entity but I am doing this: MyParent.Child = EntityFromOtherDataContext; I've been using using the pattern of wrap everything with a using datacontext. In my case, I am using this in a web forms scenario, and obviously moving the datacontext object to a class wide member variables solves this. My questions are thus 2 fold: How can I get rid of these errors and not have to structure my program in an odd way or pass the datacontext around while keeping the local-wrap pattern? I assume I could make another hit to the database but that seems very inefficient. Would most people recommend that moving the datacontext to the class wide scope is desirable for web pages?

    Read the article

  • Sharing beans from contextListener -- dispatcher servlet

    - by Ernest
    Hello! ok, i have another question now. I have a bunch of beans loaded succesfully in applicationContext.xml, which loads from web.xml: contextConfigLocation applicationContext.xml org.springframework.web.context.ContextLoaderListener Here are is the bean defined in applicationContext.xml that i want to share: it loads other beans (DAOs) which are initialized with hibernet. I need to acces catalogFacadeTarget from the dispatcherServlet, declared in web.xml: dispatcher org.springframework.web.servlet.DispatcherServlet 1 <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>*.htm</url-pattern> </servlet-mapping> and configured dispatcher-servlet.xml like this: welcome There! in the property called catalogFacadeImpl. If you need the entire applicationCOntext.xml, web.xml, and dispatcher-servlet.xml please let me know. From what i read, i should be able to share beans if i declared them in the contextConfigLocation configuration file. Thank you very much in advance.

    Read the article

  • Using 'git pull' vs 'git checkout -f' for website deployment

    - by Michelle
    I've found two common approaches to automatically deploying website updates using a bare remote repo. The first requires that the repo is cloned into the document root of the webserver and in the post-update hook a git pull is used. cd /srv/www/siteA/ || exit unset GIT_DIR git pull hub master The second approach adds a 'detached work tree' to the bare repository. The post-receive hook uses git checkout -f to replicate the repository's HEAD into the work directory which is the webservers document root i.e. GIT_WORK_TREE=/srv/www/siteA/ git checkout -f The first approach has the advantage that changes made in the websites working directory can be committed and pushed back to the bare repo (however files should not be updated on the live server). The second approach has the advantage that the git directory is not within the document root but this is easily solved using htaccess. Is one method objectively better than the other in terms of best practice? What other advantages and disadvantages am I missing?

    Read the article

  • Method hiding with interfaces

    - by fearofawhackplanet
    interface IFoo { int MyReadOnlyVar { get; } } class Foo : IFoo { int MyReadOnlyVar { get; set; } } public IFoo GetFoo() { return new Foo { MyReadOnlyVar = 1 }; } Is the above an acceptable way of implementing a readonly/immutable object? The immutability of IFoo can be broken with a temporary cast to Foo. In general (non-critical) cases, is hiding functionality through interfaces a common pattern? Or is it considered lazy coding? Or even an anti-pattern?

    Read the article

  • OO design for business logic

    - by hotyi
    I have one Sell Operation object and two Buy Operation objects, i want to implement such behavior that one Sell Operation discharges two Buy Operation, it looks like: sellOperation.Discharge(oneBuyOperation); sellOperation.Discharge(twoBuyOperation); so i want to ask whether i should call the repository function in the Discharge method, or i'd better call the repository save method outside Discharge method. like: opRepository.Save(sellOpertion); So anyone could give me some advise what are you going to implement in this scenario? using Service class or anything better way?

    Read the article

< Previous Page | 150 151 152 153 154 155 156 157 158 159 160 161  | Next Page >