Search Results

Search found 10046 results on 402 pages for 'repository pattern'.

Page 155/402 | < Previous Page | 151 152 153 154 155 156 157 158 159 160 161 162  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can you use Github App with Beanstalk?

    - by mikemick
    Being new to Git, I wanted to use a GUI (Windows based) and preferred the Github App. However, I would like to integrate this site with a Beanstalkapp account. I'm pretty sure this is possible, but I can't figure it out. Inside of the Github app, I navigate to my repository. When I choose "Tools Settings...", I place the Git Clone URL for the repository provided by Beanstalk into the "Primary Remote (origin)" field in my Github app. Now when I click "Publish" (which says "Click to publish this branch to server" when I hover over it) it changes to "Publishing...". After a few seconds, I get this error: server failure The remote server disconnected. Try again later, or if this persists, contact [email protected] I am pretty sure I set the SSH keys up properly (never done this before). I added the key to both the Beanstalkapp and my Github web account.

    Read the article

  • Maintaining Project with Git

    - by gkrdvl
    Hi All, I have 2 project, and actually these 2 project is about 80% same each other, the mainly difference is just about language and business model, one is for larger audience using english language and have a 9$/month business model, another is using local language with freemium business model. Sometime when I want to add new feature/functionality, I want to add it in both of the project, but also sometime I want to add feature especially just for the local project. My question is, how do I maintain these 2 project with git ? Maintain 2 git repository for each project or Maintain single git repository with 2 mainly branch or Any other suggestion ?

    Read the article

  • WCF Multiple Services

    - by David
    Hi, im brand spanking new to WCF and Im trying to understand how to correctly expose my BLL to it. I created my first Resource.svc and IResource.svc Resource.svc [ServiceBehavior] public class Resources : IResources { #region IResources Members public List<Model.Resource> GetAll() { return Repository.Inventory.Resource.GetAll(true); } public List<Model.Resource> GetAllEnabled() { return Repository.Inventory.Resource.GetAllEnabled(true); } #endregion } IResource.cs [ServiceContract] public interface IResources { [OperationContract] List<Model.Resource> GetAll(); [OperationContract] List<Model.Resource> GetAllEnabled(); } So this all works, My windows app can talk to the service and all is great. So I now need to access some information, I have created another .svc file called Project.svc and IProject.cs, this contains the same info as resource (apart from the type is Project) But this now means I have another webservice, surley this is not right!?

    Read the article

  • Maintaining both free and pro versions of an application

    - by Immortal
    I want to create a PRO version of my application for Android and was wondering how to structure my repository. For know I have a trunk and feature branches. I'd like to put a pro version in another branch but maybe there is a better way? For example, maybe I should create two branches - one for free version, the other for pro? Pro version will have additional features and will be ads-free, so eg. I don't want to include AdMob libraries in the pro version. Do you have any experience or suggestions as to what would be the best way to structure the repository in this case?

    Read the article

  • NHibernate filters don't work with Session.Get

    - by Khash
    I'm trying to implement a Soft-deletable repository. Usually this can be easily done with a Delete Event listener. To filter out the deleted entities, I can add a Where attribute to my class mapping. However, I also need to implement two more methods in the repository for this entity: Restore and Purge. Restore will "undelete" entities and Purge will hard-delete them. This means I can't use Where attribute (since it block out soft-deleted entities to any access) I tried using filters instead. I can create a filter and enable or disable it within session to achieve the same result. But the problem is filters don't have any effect on Session.Get method (they only affect ICriteria based access). Any ideas as to how solve this problem? Thanks

    Read the article

  • PDF text search and split library

    - by Horace Ho
    I am look for a server side PDF library (or command line tool) which can: split a multi-page PDF file into individual PDF files, based on a search result of the PDF file content Examples: Search "Page ???" pattern in text and split the big PDF into 001.pdf, 002,pdf, ... ???.pdf A server program will scan the PDF, look for the search pattern, save the page(s) which match the patten, and save the file in the disk. It will be nice with integration with PHP / Ruby. Command line tool is also acceptable. It will be a server side (linux or win32) batch processing tool. GUI/login is not supported. i18n support will be nice but no required. Thanks~

    Read the article

  • PHP regex help -- reverse search?

    - by Ian Silber
    So, I have a regex that searches for HTML tags and modifies them slightly. It's working great, but I need to do something special with the last closing HTML tag I find. Not sure of the best way to do this. I'm thinking some sort of reverse reg ex, but haven't found a way to do that. Here's my code so far: $html = "<div id="test"><p style="hello_world">This is a test.</p></div>"; $pattern = array('/<([A-Z][A-Z0-9]*)(\b[^>]*)>/i'); $replace = array('<tag>'); $html = preg_replace($pattern,$replace,$html); // Outputs: <tag><tag>This is a test</p></div> I'd like to replace the last occurance of "" with something special, say for example, "". Any ideas?

    Read the article

  • Using free function as pseudo-constructors to exploit template parameter deduction

    - by Poita_
    Is it a common pattern/idiom to use free functions as pseudo-constructors to avoid having to explicitly specify template parameters? For example, everyone knows about std::make_pair, which uses its parameters to deduce the pair types: template <class A, class B> std::pair<A, B> make_pair(A a, B b) { return std::pair<A, B>(a, b); } // This allows you to call make_pair(1, 2), // instead of having to type pair<int, int>(1, 2) // as you can't get type deduction from the constructor. I find myself using this quite often, so I was just wondering if many other people use it, and if there is a name for this pattern?

    Read the article

  • Using 'git pull' vs 'git checkout -f' for website deployment

    - by Michelle
    I've found two common approaches to automatically deploying website updates using a bare remote repo. The first requires that the repo is cloned into the document root of the webserver and in the post-update hook a git pull is used. cd /srv/www/siteA/ || exit unset GIT_DIR git pull hub master The second approach adds a 'detached work tree' to the bare repository. The post-receive hook uses git checkout -f to replicate the repository's HEAD into the work directory which is the webservers document root i.e. GIT_WORK_TREE=/srv/www/siteA/ git checkout -f The first approach has the advantage that changes made in the websites working directory can be committed and pushed back to the bare repo (however files should not be updated on the live server). The second approach has the advantage that the git directory is not within the document root but this is easily solved using htaccess. Is one method objectively better than the other in terms of best practice? What other advantages and disadvantages am I missing?

    Read the article

  • WPF - Handling events from user control in View Model

    - by Vitaly
    I’m building a WPF application using MVVM pattern (both are new technologies for me). I use user controls for simple bits of reusable functionality that doesn’t contain business logic, and MVVM pattern to build application logic. Suppose a view contains my user control that fires events, and I want to add an event handler to that event. That event handler should be in the view model of the view, because it contains business logic. The question is – view and the view model are connected only by binding; how do I connect an event handler using binding? Is it even possible (I suspect not)? If not – how should I handle events from a control in the view model? Maybe I should use commands or INotifyPropertyChanged?

    Read the article

  • Better exception for non-exhaustive patterns in case

    - by toofarsideways
    Is there a way to get GHCi to produce better exception messages when it finds at runtime that a call has produced value that does not match the function's pattern matching? It currently gives the line numbers of the function which produced the non-exhaustive pattern match which though helpful at times does require a round of debugging which at times I feel is doing the same set of things over and over. So before I tried to put together a solution I wanted to see if something else exists. An exception message that in addition to giving the line numbers shows what kind of call it attempted to make? Is this even possible?

    Read the article

  • In C, how do you capture a group with regex?

    - by Sylvain
    Hi, I'm trying to extract a string from another using regex. I'm using the POSIX regex functions (regcomp, regexec ...), and I fail at capturing a group ... For instance, let the pattern be something as simple as "MAIL FROM:<(.*)>" (with REG_EXTENDED cflags) I want to capture everything between '<' and '' My problem is that regmatch_t gives me the boundaries of the whole pattern (MAIL FROM:<...) instead of just what's between the parenthesis ... What am I missing ? Thanks in advance,

    Read the article

  • Java Time Zone When Parsing DateFormat

    - by shipmaster
    I had code that parses date as follows: String ALT_DATE_TIME_FORMAT = "yyyy-MM-dd'T'HH:mm:ss.SSSZ"; SimpleDateFormat sdf = new SimpleDateFormat( ALT_DATE_TIME_FORMAT); Date date = sdf.parse(requiredTimeStamp); And it was working fine, suddenly, this stopped working. It turns out an admin made some config changes on the server and the date is currently being returned as "2010-12-27T10:50:44.000-08:00" which is not parse-able by the above pattern. I have two questions: The first would be what pattern would parse the date being returned by the JVM in the format above (specifically, just '-08:00' as the time zone)? And second, where exactly would one change such settings on a linux RHEL 5 server so that we are aware of such changes in the future?

    Read the article

  • CMIS explorer webapp

    - by Nicolas Raoul
    CMIS is a recently approved standard for accessing ECM repositories. My idea is to create a repository explorer using CMIS, under the form of an open source Java/JEE Web Application. The main interest would probably be for integrators, using it as a framework on which to quickly build repository access intranet/extranet applications. Of course, if such an open source project already exists, I would rather contribute to it rather than start a competing effort. So, does such an application/framework already exist? As open source? The only one I have found so far is chemistry-opencmis-test-browser, which is intended for tests and seems really inconvenient to extend for business use (no MVC, no IoC).

    Read the article

  • Git: how do you merge with remote repo?

    - by Marco
    Please help me understand how git works. I clone my remote repository on two different machines. I edit the same file on both machines. I successfully commit and push the update from the first machine to the remote repository. I then try to push the update on the second machine, but get an error: ! [rejected] master -> master (non-fast-forward) I understand why I received the error. How can I merge my changes into the remote repo? Do I need to pull the remote repo first?

    Read the article

  • Find Methods in a c# File programmatically

    - by sajad
    Hi Friends, I want to write a code to search for method defination and methods called in a c# file. So obviously my pattern should search for text like 1.public void xyz(blahtype blahvalue); 2.string construct = SearchData(blahvalue); Has anyone done similar to this, is Regex helpful in this case. if yes provide me the pattern. Any other workarounds. I dont know reflection(will it help in my case) Thanks, you guys gave it a try, i did not know this wud be so complex. All i wanted to do was suppose i have method like this public method1(int val) { method2(); method3(); } void method2(int val2) { method4() } i wanted to construct a string as Method1:Method2:method4 and Method1:Method3.... I guess its really complex

    Read the article

  • How to Command Query Responsibility Segregation (CQRS) with ASP.NET MVC?

    - by Jeffrey
    I have been reading about Command Query Responsibility Segregation (CQRS). I sort of wonder how would this work with ASP.NET MVC? I get the idea of CQRS conceptually it sounds nice and sure does introduce some complexities (event and messaging pattern) compared to the "normal/common" approach . Also the idea of CQRS sort of against the use of ORM in some ways. I am trying to think how I could use this pattern in the coming projects so if anyone has experience in combining CQRS with ASP.NET MVC and NHibernate please give some concrete examples to help me better understand CQRS and use with ASP.NET MVC. Thanks!

    Read the article

  • Using Tortoise SVN with C++ in Visual Studio 2008

    - by Dr. Monkey
    I have an online repository with some .h and .cpp files that make up part of a project. I'm trying to check these out and use them in a new project, but am getting errors (C4627 and C1010). All the files have been added to the project (with AddExisting Item...), and the subdirectories that contain these files have been added to the "Additional include directories" of the project. Would I be better off having the entire project tree in the repository? My reason for not doing so is that my colleague and I are working on different parts of the code and so want to use different main methods to test things as we go, and I didn't see any need to be passing around any compiled code etc. since I assumed that given the .h and .cpp files (with the correct settings), visual studio would be able to compile the project. What's the best way to make Visual Studio 2008 and TortoiseSVN work well together (without spending any money)?

    Read the article

  • Caching for a Custom Repositiory Adapter for WebSphere Portal Virtual Member Manager

    - by Spike Williams
    I'm looking at writing a custom repository adapter to interact with Virtual Member Manager on WebSphere Portal 6.1. Basically, its a layer that takes a request in the form of a commonj.sco.DataObject and passes that on to an external web service, to get various information on our logged in users that is not otherwise available in LDAP. I'm concerned about the performance hit of going to a service every time we want to pull some permission from the back end. My question is, can the Virtual Member Manager handle caching of data going in and out of the custom repository adapters, or is that something I'm going to have to build into the adapter myself?

    Read the article

  • How do I branch an individual file in SVN?

    - by Michael Carman
    The subversion concept of branching appears to be focused on creating an [un]stable fork of the entire repository on which to do development. Is there a mechanism for creating branches of individual files? For a use case, think of a common header (*.h) file that has multiple platform-specific source (*.c) implementations. This type of branch is a permanent one. All of these branches would see ongoing development with occasional cross-branch merging. This is in sharp contrast to unstable development/stable release branches which generally have a finite lifespan. I do not want to branch the entire repository (cheap or not) as it would create an unreasonable amount of maintenance to continuously merge between the trunk and all the branches. At present I'm using ClearCase, which has a different concept of branching that makes this easy. I've been asked to consider transitioning to SVN but this paradigm difference is important. I'm much more concerned about being able to easily create alternate versions for individual files than about things like cutting a stable release branch.

    Read the article

  • Overwhelmed by design patterns... where to begin?

    - by Pete
    I am writing a simple prototype code to demonstrate & profile I/O schemes (HDF4, HDF5, HDF5 using parallel IO, NetCDF, etc.) for a physics code. Since focus is on IO, the rest of the program is very simple: class Grid { public: floatArray x,y,z; }; class MyModel { public: MyModel(const int &nip1, const int &njp1, const int &nkp1, const int &numProcs); Grid grid; map<string, floatArray> plasmaVariables; }; Where floatArray is a simple class that lets me define arbitrary dimensioned arrays and do mathematical operations on them (i.e. x+y is point-wise addition). Of course, I could use better encapsulation (write accessors/setters, etc.), but that's not the concept I'm struggling with. For the I/O routines, I am envisioning applying simple inheritance: Abstract I/O class defines read & write functions to fill in the "myModel" object HDF4 derived class HDF5 HDF5 using parallel IO NetCDF etc... The code should read data in any of these formats, then write out to any of these formats. In the past, I would add an AbstractIO member to myModel and create/destroy this object depending on which I/O scheme I want. In this way, I could do something like: myModelObj.ioObj->read('input.hdf') myModelObj.ioObj->write('output.hdf') I have a bit of OOP experience but very little on the Design Patterns front, so I recently acquired the Gang of Four book "Design Patterns: Elements of Reusable Object-Oriented Software". OOP designers: Which pattern(s) would you recommend I use to integrate I/O with the myModel object? I am interested in answering this for two reasons: To learn more about design patterns in general Apply what I learn to help refactor an large old crufty/legacy physics code to be more human-readable & extensible. I am leaning towards applying the Decerator pattern to myModel, so I can attach the I/O responsibilities dynamically to myModel (i.e. whether to use HDF4, HDF5, etc.). However, I don't feel very confident that this is the best pattern to apply. Reading the Gang of Four book cover-to-cover before I start coding feels like a good way to develop an unhealthy caffeine addiction. What patterns do you recommend?

    Read the article

  • subversion problem - commit access

    - by Calvin
    Hi everyone, I'm new to setting up subversion but originally when I made a repository, all my team members could update and commit without problem. There was a problem with it so we decided to recreate it, but now only I can commit changes to it. And my username/password doesn't work on their computers, so I'm sure it's something obvious and silly, but I just don't know enough to know what's causing it. The passwd and svnserve.conf files are the same as the original repository that worked for everyone. Any ideas? Thanks in advance.

    Read the article

  • linq-to-sql "an attempt has been made to attach or add an entity that is not new"?

    - by Curtis White
    I've been getting several errors: cannot add an entity with a key that is already in use An attempt has been made to attach or add an entity that is not new, perhaps having been loaded from another datacontext In case 1, this stems from trying to set the key for an entity versus the entity. In case 2, I'm not attaching an entity but I am doing this: MyParent.Child = EntityFromOtherDataContext; I've been using using the pattern of wrap everything with a using datacontext. In my case, I am using this in a web forms scenario, and obviously moving the datacontext object to a class wide member variables solves this. My questions are thus 2 fold: How can I get rid of these errors and not have to structure my program in an odd way or pass the datacontext around while keeping the local-wrap pattern? I assume I could make another hit to the database but that seems very inefficient. Would most people recommend that moving the datacontext to the class wide scope is desirable for web pages?

    Read the article

  • How do negated patterns work in .gitignore?

    - by chrisperkins
    I am attempting to use a .gitignore file with negated patterns (lines starting with !), but it's not working the way I expect. As a minimal example, I have the folllowing directory structure: C:/gittest -- .gitignore -- aaa/ -- bbb/ -- file.txt -- ccc/ -- otherfile.txt and in my gitignore file, I have this: aaa/ !aaa/ccc/ My understanding (based on this: http://ftp.sunet.se/pub//Linux/kernel.org/software/scm/git/docs/gitignore.html) is that the file aaa/ccc/otherfile.txt should not be ignored, but in fact git is ignoring everything under aaa. Am I misunderstanding this sentence: "An optional prefix ! which negates the pattern; any matching file excluded by a previous pattern will become included again."? BTW, this is on Windows with msysgit 1.7.0.2.

    Read the article

< Previous Page | 151 152 153 154 155 156 157 158 159 160 161 162  | Next Page >