Search Results

Search found 13006 results on 521 pages for 'exception'.

Page 157/521 | < Previous Page | 153 154 155 156 157 158 159 160 161 162 163 164  | Next Page >

  • How do encrypt a long or int using the Bouncy Castle crypto routines for BlackBerry?

    - by DanG
    How do encrypt/decrypt a long or int using the Bouncy Castle crypto routines for BlackBerry? I know how to encrypt/decrypt a String. I can encrypt a long but can't get a long to decrypt properly. Some of this is poorly done, but I'm just trying stuff out at the moment. I've included my entire crypto engine here: import org.bouncycastle.crypto.BufferedBlockCipher; import org.bouncycastle.crypto.DataLengthException; import org.bouncycastle.crypto.InvalidCipherTextException; import org.bouncycastle.crypto.engines.AESFastEngine; import org.bouncycastle.crypto.paddings.PaddedBufferedBlockCipher; import org.bouncycastle.crypto.params.KeyParameter; public class CryptoEngine { // Global Variables // Global Objects private static AESFastEngine engine; private static BufferedBlockCipher cipher; private static KeyParameter key; public static boolean setEncryptionKey(String keyText) { // adding in spaces to force a proper key keyText += " "; // cutting off at 128 bits (16 characters) keyText = keyText.substring(0, 16); keyText = HelperMethods.cleanUpNullString(keyText); byte[] keyBytes = keyText.getBytes(); key = new KeyParameter(keyBytes); engine = new AESFastEngine(); cipher = new PaddedBufferedBlockCipher(engine); // just for now return true; } public static String encryptString(String plainText) { try { byte[] plainArray = plainText.getBytes(); cipher.init(true, key); byte[] cipherBytes = new byte[cipher.getOutputSize(plainArray.length)]; int cipherLength = cipher.processBytes(plainArray, 0, plainArray.length, cipherBytes, 0); cipher.doFinal(cipherBytes, cipherLength); String cipherString = new String(cipherBytes); return cipherString; } catch (DataLengthException e) { Logger.logToConsole(e); } catch (IllegalArgumentException e) { Logger.logToConsole(e); } catch (IllegalStateException e) { Logger.logToConsole(e); } catch (InvalidCipherTextException e) { Logger.logToConsole(e); } catch (Exception ex) { Logger.logToConsole(ex); } // else return "";// default bad value } public static String decryptString(String encryptedText) { try { byte[] cipherBytes = encryptedText.getBytes(); cipher.init(false, key); byte[] decryptedBytes = new byte[cipher.getOutputSize(cipherBytes.length)]; int decryptedLength = cipher.processBytes(cipherBytes, 0, cipherBytes.length, decryptedBytes, 0); cipher.doFinal(decryptedBytes, decryptedLength); String decryptedString = new String(decryptedBytes); // crop accordingly int index = decryptedString.indexOf("\u0000"); if (index >= 0) { decryptedString = decryptedString.substring(0, index); } return decryptedString; } catch (DataLengthException e) { Logger.logToConsole(e); } catch (IllegalArgumentException e) { Logger.logToConsole(e); } catch (IllegalStateException e) { Logger.logToConsole(e); } catch (InvalidCipherTextException e) { Logger.logToConsole(e); } catch (Exception ex) { Logger.logToConsole(ex); } // else return "";// default bad value } private static byte[] convertLongToByteArray(long longToConvert) { return new byte[] { (byte) (longToConvert >>> 56), (byte) (longToConvert >>> 48), (byte) (longToConvert >>> 40), (byte) (longToConvert >>> 32), (byte) (longToConvert >>> 24), (byte) (longToConvert >>> 16), (byte) (longToConvert >>> 8), (byte) (longToConvert) }; } private static long convertByteArrayToLong(byte[] byteArrayToConvert) { long returnable = 0; for (int counter = 0; counter < byteArrayToConvert.length; counter++) { returnable += ((byteArrayToConvert[byteArrayToConvert.length - counter - 1] & 0xFF) << counter * 8); } if (returnable < 0) { returnable++; } return returnable; } public static long encryptLong(long plainLong) { try { String plainString = String.valueOf(plainLong); String cipherString = encryptString(plainString); byte[] cipherBytes = cipherString.getBytes(); long returnable = convertByteArrayToLong(cipherBytes); return returnable; } catch (Exception e) { Logger.logToConsole(e); } // else return Integer.MIN_VALUE;// default bad value } public static long decryptLong(long encryptedLong) { byte[] cipherBytes = convertLongToByteArray(encryptedLong); cipher.init(false, key); byte[] decryptedBytes = new byte[cipher.getOutputSize(cipherBytes.length)]; int decryptedLength = cipherBytes.length; try { cipher.doFinal(decryptedBytes, decryptedLength); } catch (DataLengthException e) { // TODO Auto-generated catch block e.printStackTrace(); } catch (IllegalStateException e) { // TODO Auto-generated catch block e.printStackTrace(); } catch (InvalidCipherTextException e) { // TODO Auto-generated catch block e.printStackTrace(); } catch (Exception e) { // TODO Auto-generated catch block e.printStackTrace(); } long plainLong = convertByteArrayToLong(decryptedBytes); return plainLong; } public static boolean encryptBoolean(int plainBoolean) { return false; } public static boolean decryptBoolean(int encryptedBoolean) { return false; } public static boolean testLongToByteArrayConversion() { boolean returnable = true; // fails out of the bounds of an integer, the conversion to long from byte // array does not hold, need to figure out a better solution for (long counter = -1000000; counter < 1000000; counter++) { long test = counter; byte[] bytes = convertLongToByteArray(test); long result = convertByteArrayToLong(bytes); if (result != test) { returnable = false; Logger.logToConsole("long conversion failed"); Logger.logToConsole("test = " + test + "\n result = " + result); } // regardless } // the end Logger.logToConsole("final returnable result = " + returnable); return returnable; } }

    Read the article

  • Play wave file using AudioFormat in java

    - by angelina
    Dear all, I m getting following exception while running my code on linux operating system.This code works fine on windows operating system.below is the exception and code used. java.lang.IllegalArgumentException: No line matching interface Clip supporting format PCM_SIGNED unknown sample rate, 16 bit, stereo, 4 bytes/frame, big-endian is supported. AudioFormat format = sourceaudio.getFormat(); format = new AudioFormat( AudioFormat.Encoding.PCM_SIGNED, format.getSampleRate(), format.getSampleSizeInBits() * 2, format.getChannels(), format.getFrameSize() * 2, format.getFrameRate(), true); AudioFileFormat.Type targettype = AudioFileFormat.Type.WAVE; AudioInputStream targetaudiostream = AudioSystem.getAudioInputStream(format, sourceaudio); sourceaudio.close(); targetaudiostream.close(); System.out.println("55555555"); URL url = new URL("http://localhost:8084/newvideo/PCMfile.wav"); Clip clip = AudioSystem.getClip(); AudioInputStream ais = AudioSystem.getAudioInputStream(url); clip.open(ais); System.out.println("seconds: " + (clip.getMicrosecondLength() / 1000000));

    Read the article

  • Performance Counters Registry validation

    - by anchandra
    I have a C# application that adds some performance counters when it starts up. But if the registry HKEY_LOCAL_MACHINE-SOFTWARE-Microsoft-Windows NT-CurrentVersion-Perflib is corrupted (missing or invalid data), the operation of checking the existence of the performance counters (PerformanceCounterCategory.Exists(category) takes a really long time (around 30 secs) before finally throwing exception (InvalidOperation: Category does not exist). My question is how can i verify the validity of the registry before trying to add the performance counters (and what validity means) or if there is a way i can timeout the perf counter operations, so that it doesn't take 30 seconds to get an exception.

    Read the article

  • Help needed to resolve RMI RemoteException

    - by Gabriel Parenza
    Hello friends, Any idea why do I get RemoteException while trying to invoke methods on Unix machine from Windows. I am inside the network and dont think this is because of firewall problem as I can do "telnet" from Windows to Unix box after starting the RMI server at the unix box. I also could not understand why is it going to local loopback IP? Stack Trace:: RemoteException occured, details java.rmi.ConnectException: Connection refused to host: 127.0.0.1; nested exception is: java.net.ConnectException: Connection refused: connect java.rmi.ConnectException: Connection refused to host: 127.0.0.1; nested exception is: java.net.ConnectException: Connection refused: connect Many thanks in advance.

    Read the article

  • How to add an XML parameter to a stored procedure in C#?

    - by salvationishere
    I am developing a C# web application in VS 2008 which interacts with my Adventureworks database in my SQL Server 2008. Now I am trying to add new records to one of the tables which has an XML column in it. How do I do this? This is the error I'm getting: System.Data.SqlClient.SqlException was caught Message="XML Validation: Text node is not allowed at this location, the type was defined with element only content or with simple content. Location: /" Source=".Net SqlClient Data Provider" ErrorCode=-2146232060 Class=16 LineNumber=22 Number=6909 Procedure="AppendDataC" Server="." State=1 StackTrace: at System.Data.SqlClient.SqlConnection.OnError(SqlException exception, Boolean breakConnection) at System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) at System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) at System.Data.SqlClient.TdsParser.Run(RunBehavior runBehavior, SqlCommand cmdHandler, SqlDataReader dataStream, BulkCopySimpleResultSet bulkCopyHandler, TdsParserStateObject stateObj) at System.Data.SqlClient.SqlCommand.FinishExecuteReader(SqlDataReader ds, RunBehavior runBehavior, String resetOptionsString) at System.Data.SqlClient.SqlCommand.RunExecuteReaderTds(CommandBehavior cmdBehavior, RunBehavior runBehavior, Boolean returnStream, Boolean async) at System.Data.SqlClient.SqlCommand.RunExecuteReader(CommandBehavior cmdBehavior, RunBehavior runBehavior, Boolean returnStream, String method, DbAsyncResult result) at System.Data.SqlClient.SqlCommand.InternalExecuteNonQuery(DbAsyncResult result, String methodName, Boolean sendToPipe) at System.Data.SqlClient.SqlCommand.ExecuteNonQuery() at ADONET_namespace.ADONET_methods.AppendDataC(DataRow d, Hashtable ht) in C:\Documents and Settings\Admin\My Documents\Visual Studio 2008\Projects\AddFileToSQL\AddFileToSQL\ADONET methods.cs:line 212 InnerException: And this is a portion of my code in C#: try { SqlConnection conn2 = new SqlConnection(connString); SqlCommand cmd = conn2.CreateCommand(); cmd.CommandText = "dbo.AppendDataC"; cmd.CommandType = CommandType.StoredProcedure; cmd.Connection = conn2; ... sqlParam10.SqlDbType = SqlDbType.VarChar; SqlParameter sqlParam11 = cmd.Parameters.AddWithValue("@" + ht["@col11"], d[10]); sqlParam11.SqlDbType = SqlDbType.VarChar; SqlParameter sqlParam12 = cmd.Parameters.AddWithValue("@" + ht["@col12"], d[11]); sqlParam12.SqlDbType = SqlDbType.Xml; ... conn2.Open(); cmd.ExecuteNonQuery(); //This is the line it fails on and then jumps //to the Catch statement conn2.Close(); errorMsg = "The Person.Contact table was successfully updated!"; } catch (Exception ex) { Right now in my text input MDF file I have the XML parameter as: '<Products><id>3</id><id>6</id><id>15</id></Products>' Is this valid format for XML?

    Read the article

  • Java RMI : connection refused

    - by mihsathe
    I have written following code for the client of RMI. But getting java.rmi.ConnectException: Connection refused to host: localhost; nested exception is: java.net.ConnectException: Connection refused: connect code : import java.rmi.*; import java.net.*; import java.rmi.registry.*; class client { public static void main(String [] ars) { Iface serv; Registry r; String serveraddr = ars[0]; String serverport = ars[1]; String text = "Hey jude"; System.out.println("Sending" + text); try{ r = LocateRegistry.getRegistry( serveraddr, (new Integer(serverport)).intValue() ); serv = (Iface) r.lookup("rmi://server"); serv.receive(text); } catch(Exception e){ System.out.println(e); } } }

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • ELMAH - Using custom error pages to collecting user feedback

    - by vdh_ant
    Hey guys I'm looking at using ELMAH for the first time but have a requirement that needs to be met that I'm not sure how to go about achieving... Basically, I am going to configure ELMAH to work under asp.net MVC and get it to log errors to the database when they occur. On top of this I be using customErrors to direct the user to a friendly message page when an error occurs. Fairly standard stuff... The requirement is that on this custom error page I have a form which enables to user to provide extra information if they wish. Now the problem arises due to the fact that at this point the error is already logged and I need to associate the loged error with the users feedback. Normally, if I was using my own custom implementation, after I log the error I would pass through the ID of the error to the custom error page so that an association can be made. But because of the way that ELMAH works, I don't think the same is quite possible. Hence I was wondering how people thought that one might go about doing this.... Cheers UPDATE: My solution to the problem is as follows: public class UserCurrentConextUsingWebContext : IUserCurrentConext { private const string _StoredExceptionName = "System.StoredException."; private const string _StoredExceptionIdName = "System.StoredExceptionId."; public virtual string UniqueAddress { get { return HttpContext.Current.Request.UserHostAddress; } } public Exception StoredException { get { return HttpContext.Current.Application[_StoredExceptionName + this.UniqueAddress] as Exception; } set { HttpContext.Current.Application[_StoredExceptionName + this.UniqueAddress] = value; } } public string StoredExceptionId { get { return HttpContext.Current.Application[_StoredExceptionIdName + this.UniqueAddress] as string; } set { HttpContext.Current.Application[_StoredExceptionIdName + this.UniqueAddress] = value; } } } Then when the error occurs, I have something like this in my Global.asax: public void ErrorLog_Logged(object sender, ErrorLoggedEventArgs args) { var item = new UserCurrentConextUsingWebContext(); item.StoredException = args.Entry.Error.Exception; item.StoredExceptionId = args.Entry.Id; } Then where ever you are later you can pull out the details by var item = new UserCurrentConextUsingWebContext(); var error = item.StoredException; var errorId = item.StoredExceptionId; item.StoredException = null; item.StoredExceptionId = null; Note this isn't 100% perfect as its possible for the same IP to have multiple requests to have errors at the same time. But the likely hood of that happening is remote. And this solution is independent of the session, which in our case is important, also some errors can cause sessions to be terminated, etc. Hence why this approach has worked nicely for us.

    Read the article

  • Blob object not working properly even though the class is seralized

    - by GustlyWind
    I have class which is seralized and does convert a very large amount of data object to blob to save it to database.In the same class there is decode method to convert blob to the actual object.Following is the code for encode and decode of the object. private byte[] encode(ScheduledReport schedSTDReport) { byte[] bytes = null; try { ByteArrayOutputStream bos = new ByteArrayOutputStream(); ObjectOutputStream oos = new ObjectOutputStream(bos); oos.writeObject(schedSTDReport); oos.flush(); oos.close(); bos.close(); //byte [] data = bos.toByteArray(); //ByteArrayOutputStream baos = new ByteArrayOutputStream(); //GZIPOutputStream out = new GZIPOutputStream(baos); //XMLEncoder encoder = new XMLEncoder(out); //encoder.writeObject(schedSTDReport); //encoder.close(); bytes = bos.toByteArray(); //GZIPOutputStream out = new GZIPOutputStream(bos); //out.write(bytes); //bytes = bos.toByteArray(); } catch (Exception e) { _log.error("Exception caught while encoding/zipping Scheduled STDReport", e); } decode(bytes); return bytes; } /* * Decode the report definition blob back to the * ScheduledReport object. */ private ScheduledReport decode(byte[] bytes) { ByteArrayInputStream bais = new ByteArrayInputStream(bytes); ScheduledReport sSTDR = null; try { ObjectInputStream ois = new ObjectInputStream(bais); //GZIPInputStream in = new GZIPInputStream(bais); //XMLDecoder decoder = new XMLDecoder(in); sSTDR = (ScheduledReport)ois.readObject();//decoder.readObject(); //decoder.close(); } catch (Exception e) { _log.error("IOException caught while decoding/unzipping Scheduled STDReport", e); } return sSTDR; } The problem here is whenver I change something else in this class means any other method,a new class version is created and so the new version the class is unable to decode the originally encoded blob object. The object which I am passing for encode is also seralized object but this problem exists. Any ideas thanks

    Read the article

  • WCF Fails when using impersonation over 2 machine boundaries (3 machines)

    - by MrTortoise
    These scenarios work in their pieces. Its when i put it all together that it breaks. I have a WCF service using netTCP that uses impersonation to get the callers ID (role based security will be used at this level) on top of this is a WCF service using basicHTTP with TransportCredientialOnly which also uses impersonation I then have a client front end that connects to the basicHttp. the aim of the game is to return the clients username from the netTCP service at the bottom - so ultimatley i can use role based security here. each service is on a different machine - and each service works when you remove any calls they make to other services when you run a client for them both locally and remotley. IE the problem only manifests when you jump accross more than one machine boundary. IE the setup breaks when i connect each part together - but they work fine on their own. I also specify [OperationBehavior(Impersonation = ImpersonationOption.Required)] in the method and have IIS setup to only allow windows authentication (actually i have ananymous enabled still, but disabling makes no difference) This impersonation works fine in the scenario where i have a netTCP Service on Machine A with a client with a basicHttp service on machine B with a clinet for the basicHttp service also on machine B ... however if i move that client to any machine C i get the following error: The exception is 'The socket connection was aborted. This could be caused by an error processing your message or a receive timeout being exceeded by the remote host, or an underlying network resource issue. Local socket timeout was '00:10:00'' the inner message is 'An existing connection was forcibly closed by the remote host' Am beginning to think this is more a network issue than config ... but then im grasping at straws ... the config files are as follows (heading from the client down to the netTCP layer) <?xml version="1.0" encoding="utf-8" ?> <configuration> <system.serviceModel> <bindings> <basicHttpBinding> <binding name="basicHttpBindingEndpoint" closeTimeout="00:02:00" openTimeout="00:02:00" receiveTimeout="00:10:00" sendTimeout="00:02:00" allowCookies="false" bypassProxyOnLocal="false" hostNameComparisonMode="StrongWildcard" maxBufferSize="65536" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" messageEncoding="Text" textEncoding="utf-8" transferMode="Buffered" useDefaultWebProxy="true"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Windows" proxyCredentialType="None" realm="" /> <message clientCredentialType="UserName" algorithmSuite="Default" /> </security> </binding> </basicHttpBinding> </bindings> <client> <endpoint address="http://panrelease01/WCFTopWindowsTest/Service1.svc" binding="basicHttpBinding" bindingConfiguration="basicHttpBindingEndpoint" contract="ServiceReference1.IService1" name="basicHttpBindingEndpoint" behaviorConfiguration="ImpersonationBehaviour" /> </client> <behaviors> <endpointBehaviors> <behavior name="ImpersonationBehaviour"> <clientCredentials> <windows allowedImpersonationLevel="Impersonation"/> </clientCredentials> </behavior> </endpointBehaviors> </behaviors> </system.serviceModel> </configuration> the service for the client (basicHttp service and the client for the netTCP service) <?xml version="1.0" encoding="UTF-8"?> <configuration> <system.web> <compilation debug="true" targetFramework="4.0" /> </system.web> <system.serviceModel> <bindings> <netTcpBinding> <binding name="netTcpBindingEndpoint" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" transactionFlow="false" transferMode="Buffered" transactionProtocol="OleTransactions" hostNameComparisonMode="StrongWildcard" listenBacklog="10" maxBufferPoolSize="524288" maxBufferSize="65536" maxConnections="10" maxReceivedMessageSize="65536"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <reliableSession ordered="true" inactivityTimeout="00:10:00" enabled="false" /> <security mode="Transport"> <transport clientCredentialType="Windows" protectionLevel="EncryptAndSign" /> <message clientCredentialType="Windows" /> </security> </binding> </netTcpBinding> <basicHttpBinding> <binding name="basicHttpWindows"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Windows"></transport> </security> </binding> </basicHttpBinding> </bindings> <client> <endpoint address="net.tcp://5d2x23j.panint.com/netTCPwindows/Service1.svc" binding="netTcpBinding" bindingConfiguration="netTcpBindingEndpoint" contract="ServiceReference1.IService1" name="netTcpBindingEndpoint" behaviorConfiguration="ImpersonationBehaviour"> <identity> <dns value="localhost" /> </identity> </endpoint> </client> <behaviors> <endpointBehaviors> <behavior name="ImpersonationBehaviour"> <clientCredentials> <windows allowedImpersonationLevel="Impersonation" allowNtlm="true"/> </clientCredentials> </behavior> </endpointBehaviors> <serviceBehaviors> <behavior name="WCFTopWindowsTest.basicHttpWindowsBehaviour"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="true" /> </behavior> </serviceBehaviors> </behaviors> <services> <service name="WCFTopWindowsTest.Service1" behaviorConfiguration="WCFTopWindowsTest.basicHttpWindowsBehaviour"> <endpoint address="" binding="basicHttpBinding" bindingConfiguration="basicHttpWindows" name ="basicHttpBindingEndpoint" contract ="WCFTopWindowsTest.IService1"> </endpoint> </service> </services> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> </system.serviceModel> <system.webServer> <modules runAllManagedModulesForAllRequests="true" /> <directoryBrowse enabled="true" /> </system.webServer> </configuration> then finally the service for the netTCP layer <?xml version="1.0" encoding="UTF-8"?> <configuration> <system.web> <authentication mode="Windows"></authentication> <authorization> <allow roles="*"/> </authorization> <compilation debug="true" targetFramework="4.0" /> <identity impersonate="true" /> </system.web> <system.serviceModel> <bindings> <netTcpBinding> <binding name="netTCPwindows"> <security mode="Transport"> <transport clientCredentialType="Windows"></transport> </security> </binding> </netTcpBinding> </bindings> <services> <service behaviorConfiguration="netTCPwindows.netTCPwindowsBehaviour" name="netTCPwindows.Service1"> <endpoint address="" bindingConfiguration="netTCPwindows" binding="netTcpBinding" name="netTcpBindingEndpoint" contract="netTCPwindows.IService1"> <identity> <dns value="localhost" /> </identity> </endpoint> <endpoint address="mextcp" binding="mexTcpBinding" contract="IMetadataExchange"/> <host> <baseAddresses> <add baseAddress="net.tcp://localhost:8721/test2" /> </baseAddresses> </host> </service> </services> <behaviors> <serviceBehaviors> <behavior name="netTCPwindows.netTCPwindowsBehaviour"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="false" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="true" /> </behavior> </serviceBehaviors> </behaviors> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> </system.serviceModel> <system.webServer> <modules runAllManagedModulesForAllRequests="true" /> <directoryBrowse enabled="true" /> </system.webServer> </configuration>

    Read the article

  • How to add ACTIVE DIRECTORY user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • struts validation problem in IE

    - by user265201
    I am using Struts 2.1.8 and facing validation problem in IE. I am getting the following error An exception occurred: Error. Error message: Invalid argument. I tried out to figure out the cause and found the following. My generated javascript code is: field = form.elements['district.name']; var error = "Enter only alphabets for district"; if (continueValidation && field.value != null && !field.value.match("^[a-zA-Z ]*$")) { addError(field, error); errors = true; } I tried to mock up by putting the same code in a function and calling it in onclick event. The method addError() throws the exception and the reason is field variable. If I change it to field[0], it works fine. How to fix this error?

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Graphics.FromHwnd(IntPtr.Zero) returns null, why?

    - by Martin Moser
    I'm currently investigating a problem with a 3rd party component (DevExpress) in my application. My issue is quite similar to this one DevExpress KB article. I get the same exception with more less the same stacktrace. So I used .NET Reflector to find out, what may be null in this scenario, and the only object which is a candiate to be null is Graphics. This is created with Graphics.FromHwnd(IntPtr.Zero). Because I don't have a broad knowledge about GDI, I would like to know if somebody can tell me possible scenarios when this may return null... I tried to reproduce it in a scenario where windows is out of GDI handle's, but then I'm getting a "out of handles" - exception at least once, which is not the case in the issue I'm investigating tia, Martin

    Read the article

  • Techniques to avoid DeadlineExceededException in GAE/J?

    - by Tahir Akram
    I am developing an Twitter4J web application in Google App Engine/Java. I need to show two lists. One is Twitter friends and other is followers. With photo and screen name. It is working fine for people who have 20-30 followers and friends. But it gave me DeadlineExceededException when I try a user who has 150+ followers and friends. GAE throws this exception if web request take time more than 30 seconds. So what techniques I can adopt to avoid this exception. Should I generate two AJAX calls for each of my list. After page loads. So that every call will have its own 30 secs limit? Or what else you think? I am gone make it. Please help.

    Read the article

  • Memory in Eclipse

    - by user247866
    I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • What are the essential COM componenets required for burning DVD in c#.net in Windows XP?

    - by shruti
    im trying to burn DVD/CD through frontend C#.net code... i have used IMAPI2 for buring CD/DVD in windows XP..but it is giving me unhandeled exception... as:- System.InvalidCastException: Unable to cast COM object of type 'IMAPI2.Interop.MsftFileSystemImageClass' to interface type 'IMAPI2.Interop.MsftFileSystemImage'. This operation failed because the QueryInterface call on the COM component for the interface with IID '{7CFF842C-7E97-4807-8304-910DD8F7C051}' failed due to the following error: No such interface supported (Exception from HRESULT: 0x80004002 (E_NOINTERFACE)) can anyone plz help me out to solve this pbm...im not able to solve this error.. this project is working fine in Windows7 but unable to work with XP...???

    Read the article

  • NHibernate ManyToMany Relationship Cascading AllDeleteOrphan StackOverflowException

    - by Chris
    I have two objects that have a ManyToMany relationship with one another through a mapping table. Though, when I try to save it, I get a stack overflow exception. The following is the code for the mappings: //EventMapping.cs HasManyToMany(x => x.Performers).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("EventId").ChildKeyColumn("PerformerId"); //PerformerMapping.cs HasManyToMany<Event>(x => x.Events).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("PerformerId").ChildKeyColumn("EventId"); When I change the performermapping.cs to Cascade.None() I get rid of the exception but then my Event Object doesn't have the performer I associate with it. //In a unit test, paraphrased event.Performers.Add(performer); //Event eventRepository.Save<Event>(event); eventResult = eventRepository.GetById<Event>(event.id); //Event eventResult.Performers[0]; //is null, should have performer in it How should I be writing this properly? Thanks

    Read the article

  • Cannot execute a program. The command being executed "dqiitg0c.cmdline"

    - by Laxman
    i have used impersonation in this application. whenever this error occurs i required to restart the IIS.. please guide me to solve this issue. Error: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline". Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Runtime.InteropServices.ExternalException: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline".

    Read the article

  • A generic error occurred in GDI+.

    - by Pinu
    A generic error occurred in GDI+ [ExternalException (0x80004005): A generic error occurred in GDI+.] System.Drawing.Image.Save(Stream stream, ImageCodecInfo encoder, EncoderParameters encoderParams) +615257 I have a webpage in which a pdf is converted to png, and using the response.outputstream it is displayed. when i run this on my local machine is works fine. but when i run the same code on server is throws this exception. my question is , where i could look in for error. as there is no inner exception or any other information provided. only clue is that it's happening on Image.Save , but the same code works perfectly fine on my local machine , then y is it not working on production???

    Read the article

  • C# MDX RenderToSurface, where to reset after device is lost?

    - by Moritz Schöfl
    Hi, I got a problem with the RenderToSurface class. When I resize the Form of my Device, the Draw method is still called, but doesnt throw an Exception, it looks like this: device.Clear(ClearFlags.Target, Color.Red, 0, 0); device.BeginScene(); // here is out commented code device.EndScene(); device.Present(); In another method, I wrote this: renderToSurface.BeginScene(surfaces[currentIndex]); // here is out commented code renderToSurface.EndScene(Filter.None); and this method seems to throw a nullpointer exception when I resize the window; So my question is: - where to reset / restore / handle the renderToSurface class? (i tried it with the DeviceReset event like following - void OnDeviceReset(object sender, EventArgs e) { renderToSurface = new RenderToSurface(Game.Device, Game.ClientSize.Width, Game.ClientSize.Height, Format.A8R8G8B8, true, DepthFormat.D16); } )

    Read the article

  • SQL Server (2005) Linked Server Issue

    - by David.Chu.ca
    I have SQL Server 2005 with several linked server defined. One of them is a connection to an Oracle server and another one is an ODBC bridge to another server on a remote machine (ODBC server). Recently I tried to use the linked server to Oracle to update data with two large size tables by using several joints. The update query took too long time and finally there was exception thrown: Update O set value = l.value FROM OracleServer..schema.largesizeTable O Join localLargeSizeTable l on .... The problem is that after the exception, I realized that another linked server to ODBC was not working any more. I had to restart SQL server to get the ODBC linked server back. It looks that the linked server pool could be crashed if any of them failed(not like sandbox in Chrome for each tab and no impact on other tabs or Chrome application at all). I am not sure if my assumption is correct or not. Is this a known issue of SQL server 2005?

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • If XmlException.SourceUri is read-only, what good is it?

    - by East of Nowhere
    I have a couple places in my code where it throwing a new System.Xml.XmlException seems appropriate. I could just do throw new XmlException("Your XML sucks go fix it then try again."); But I think it's better to take advantage whenever possible of members particular to the exception class (otherwise ya might as well throw a plain ol' Exception every time). SourceUri and LineNumber would be helpful, but they only have get methods, there's no way I can assign a value to them! There's only 3 constructor overloads and none of them have parameters for those members either; I can only initialize Message, nothing else. There has got to be some way to populate those data members with values, otherwise why does XmlException bother with them? I suppose I could make a new class that inherits XmlException and write a new constructor that initializes SourceUri etc. but still, there must be a way to just use XmlException. Right?

    Read the article

< Previous Page | 153 154 155 156 157 158 159 160 161 162 163 164  | Next Page >