Search Results

Search found 12798 results on 512 pages for 'inline images'.

Page 159/512 | < Previous Page | 155 156 157 158 159 160 161 162 163 164 165 166  | Next Page >

  • How to extract substrings with PHP

    - by shin
    PHP beginner's question. I need to keep image paths as following in the database for the admin backend. ../../../../assets/images/subfolder/myimage.jpg However I need image paths as follows for the front-end. assets/images/subfolder/myimage.jpg What is the best way to change this by PHP? I thought about substr(), but I am wondering if there is better ways. Thanks in advance.

    Read the article

  • Removing the transparency from image while keeping the actual image

    - by KPL
    Hello people, I have three images,and , they are not square or rectangular in shape. They are just like face of anyone. So, basically, my images are in the size 196x196 or anything like that, but complete square or rectangle with the face in the middle and transperant background in the rest of the portion. Now, I want to remove the transperant background too and just keep the faces. Don't know if this is possible and mind you, this isn't a programming question.

    Read the article

  • PHP, display image with Header()

    - by user271619
    I'm displaying images from outside my web root, like this: header('Content-type:image/png'); readfile($fullpath); The content-type: image/png is what confuses me. Someone else helped me out with this code, but I noticed that not all images are PNG. Many are jpg or gif. And still they are displayed successfully. does anyone know why?

    Read the article

  • Reportview export to pdf missing alt tags

    - by jestges
    Hi I'm working with reportviewer in vs2008, whey I try to export my report to pdf it is creating pdf successfully.. But here my problem is when I'm exporting my pdf file is missing alt tags for images which is previously there in my report. In my reportviewer it is showing alt tags for every image. But in pdf it is not showing any alt tag for images. Can somebody help me to solve this? Thanks in advance

    Read the article

  • How to create an "endless" scrolling slideshow?

    - by Andrew
    I know a good bit of JS and I'm familiar with jQuery, and I'm trying to create an "endless" slideshow (like the one on http://thisismedium.com/), where the images scroll -- one right behind the other -- and when it reaches the end it loops. I don't really know how to start, so I was hoping someone could point me in the right direction. I created a slideshow before that automatically switched images and let you click Next and Previous, but I'm stuck here. =/.

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • How much memory an app can use on iPad?

    - by Saurabh
    Hi All, Currently I am writing an iPad app. I am using a lot of images in this app around 40 MB of images! This app works fine in simulator but crashing on device. I think the problem is with memory. I wanted to know how much memory I can use on iPad? Thanks Saurabh

    Read the article

  • dynamically set the control template

    - by Saboor
    hi, i am using dictionaries in WPF. i have two bitmap image in it with name something like image1 and image2 now in forms, i like to set them to single image control depending on condition, some times image1 and sometimes image2. so how i set the source dynamically, in dictonary i have UriSource="/wpf1;component/images/infobarGreen.png" / UriSource="/wpf1;component/images/infobarRed.png" /

    Read the article

  • Wrapbootstrap integration

    - by Shaun Frost Duke Jackson
    Good Afternoon All, I'm having trouble integrating this template into my rails application. I've changes all the images and loaded all the files into their relevant areas. However they still have the subdirectories. Does anyone know of a guide I can walk through which might explain how you do this, especially to include the revolution-slider which has a whole subdirectory of CSS and images. Template being used: https://wrapbootstrap.com/theme/pixma-responsive-multipurpose-template-WB0B348C6 Thanks for the help.

    Read the article

  • Why Internet Explorer can not display an image on the site?

    - by Emanuel
    I have a site that is managed with Joomla. I want to display an image in one of my articles but that image can not be viewed in Internet Explorer but other browsers can display it, although the path is ok. I miss something? Link: http://ascorbrasov.ro/images/stories/necula_ctin2.jpg Html: <img src="/images/stories/constantin_necula2.jpg" border="0" title="Constantin Necula - Conferinta" /> Thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • error using rename function in PHP.

    - by Catfish
    I keep getting this error, although the file still gets moved into the correct directory. Anybody know why i'm getting this error? Warning: rename(../Images/uploaded/1162504_56863010.jpg,../Images/uploaded/Portraits/1162504_56863010.jpg) [function.rename]: No error in D:\Data\Websites\wamp\www\StephsSite\PHP\addImage.php on line 21

    Read the article

  • making changes in master page from front(calling) page in vb.net

    - by ferrer
    i have a page called a1.aspx, with the Masterpagefile = a1_master.master. Now the master page has its own div's and images for design purpose. I want a way where when i load a1.aspx, certain chosen 's and images should be hidden (visible=false). how can i do this? how can i change the visibility of a div or an image in the master page from the calling page?

    Read the article

  • how to refresh list of photos after uploadify jquery

    - by robert
    hello, I want to do a sort of photo editor, i use uploadify to upload images here are my files: http://www.mediafire.com/?nddjyzyygj5 the problem is: after upload the images i dinamicaly generate a thumb .. When I click on it it show me the large pictures in another page, i want to show the picture in a div or a paragraf! after I refresh the page is working! why? from my php script i recive only the image name (response) after UploadifyComplete i append this: jQuery("#" + jQuery(this).attr('id') + ID).html('<a href="uploads/' + response + '"><img width="60px" height="60px" src="uploads/' + response + '" alt="' + response + '" /></a>'); to this: jQuery(queue).append('<li class="uploadifyQueueItem">\ <span class="fileName">' + fileName + ' (' + byteSize + suffix + ')</span>\ <div class="uploadifyProgress">\ <div id="' + jQuery(this).attr('id') + ID + 'ProgressBar" class="uploadifyProgressBar"><!--Progress Bar--></div>\ </div>\ </li>'); } and the result will be: <div class="uploadifyQueue"> <ul id="mainftpQueue"> <li class="uploadifyQueueItem"> <a href="uploads/Winter.jpg"><img height="60px" width="60px" alt="Winter.jpg" src="uploads/Winter.jpg"></a> </li> </ul> </div> i putt all the images in 1 php array after all images uploaded i want to refresh the div where this code is: <div class="uploadifyQueue"> <?php if ($_SESSION['files']){ print '<ul id="mainftpQueue">'."\n"; foreach($_SESSION['files'] as $image ): print '<li class="uploadifyQueueItem">'."\n"; print '<a href="uploads/'.$image.'"><img height="60px" width="60px" alt="'.$image.'" src="uploads/'.$image.'"></a>'."\n"; print "</li>\n"; endforeach; print "</ul>\n"; } ?> </div> i try with: $('#mainftpQueue').load(location.href+" #mainftpQueue>*",""); $('#mainftpQueue').load("/ #mainftpQueue li"); buth no succes sorry 4 my bad english.. if any 1 can edit this thanks

    Read the article

  • Video Capture API remove dialog when capturing from two cameras

    - by sqlmaster
    Hi , I am trying to capture images from two cameras using avicap32.dll messages.I am able to capture images with the first camera but when the second camera start o capture it shows me the dialog "Select a video device".My application dosn't have interaction with the user so I need to select the second camera programatically. can anyone help me?

    Read the article

  • Using Office 2007 extension (i.e. docx) for skin based On-Screen keyboard.

    - by Peymankh
    Hi guys, I'm creating a On-Screen keyboard for my application, and it supports skins as well. Here's what I'm doing with the skins, I have a folder which contains some images and a xml file which maps the images to the keyboard, I want to be able to have the folder as a zip file like in Office 2007 (.docx) and iPhone firmwares (.ipsw), I know I can simply zip the folder and change the extension, what I need to know is how to read the files in the code. Thanks in advance.

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • How to successfully implement og:image for the LinkedIn

    - by Sabo
    THE PROBLEM: I am trying, without much success, to implement open graph image on site: http://www.guarenty-group.com/cz/ The homepage is completeply bypassing the og:image tag, where internal pages are reading all images from the site and place og:image as the last option. Other social networks are working fine on both internal pages and homepage. THE CONFIGURATION: I have no share buttons or alike, all I want is to be able to share the link via my profile. The image is well over 300x300px: http://guarenty-group.com/img/gg_seal.png Here is how my head tag looks like: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Guarenty Group : Pojištení pro nájemce a pronajímatelé</title> <meta name="keywords" content="" /> <meta name="description" content="Guarenty Group pojištuje príjem z nájmu pronajímatelum, kauci nájemcum - aby nemuseli platit velkou cástku v hotovostí predem - a dále nájemcum pojištuje príjmy, aby meli na nájem pri nemoci, úrazu ci nezamestnání." /> <meta name="image_src" content="http://guarenty-group.com/img/gg_seal.png" /> <meta name="image_url" content="http://guarenty-group.com/img/gg_seal.png" /> <meta property="og:title" content="Pojištení pro nájemce a pronajímatelé" /> <meta property="og:url" content="http://guarenty-group.com/cz/" /> <meta property="og:image" content="http://guarenty-group.com/img/gg_seal.png" /> <meta property="og:description" content="Guarenty Group pojištuje príjem z nájmu pronajímatelum, kauci nájemcum - aby nemuseli platit velkou cástku v hotovostí predem - a dále nájemcum pojištuje príjmy, aby meli na nájem pri nemoci, úrazu ci nezamestnání [...]" /> ... </head> THE TESTING RESULTS: In order to trick the cache i have tested the site with http://www.guarenty-group.com/cz/?try=N, where I have changed the N every time. The strange thing is that images found for different value of N is different. Sometimes there is no image, sometimes there is 1, 2 or 3 images, but each time there is a different set of images. But, in any case I could not find the image specified in the og:graph! MY QUESTIONS: https://developer.linkedin.com/documents/setting-display-tags-shares is saying one thing, and the personnel on the support forum is saying "over 300" Does anyone know What is the official minimum dimension of the image (both w and h)? Can an image be too large? Should I use the xmlns, should I not use xmlns or it doesn't matter? What are the maximum (and minimum) lengths for og:title and og:description tags? Any other suggestion is of course welcomed :) Thanks in advance, cheers~

    Read the article

  • Background Image comes up as white when displayed using Javascript

    - by AndroidNewbie
    I am trying to change the background image whenever the document is loaded, and when it hits this point: document.body.style.backgroundImage="url('../images/mobile-bckground.png')"; The page simply makes the background plain white. It is displayed like this in my javascript: $(function() { document.body.style.backgroundImage="url('../images/mobile-bckground.png')"; }); I have verified the image is in the right location, why is it doing this?

    Read the article

< Previous Page | 155 156 157 158 159 160 161 162 163 164 165 166  | Next Page >