Search Results

Search found 12798 results on 512 pages for 'inline images'.

Page 158/512 | < Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >

  • Types of PNG image in iPhone app

    - by user297491
    I have an iPhone app that picks images from my internet server. It picks images with png extension but only PNG-24 is workings. The problem is that PNG-24 need some disk space and internet bandwith in iphone. I tried using PNG-8 but the iphone does not recognize it. Someone knows if I have a way to use PNG-8 into my app? Thanks!

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • how to disable the lightbox to close after a clicking an add button?

    - by Mahmoud
    Hey there i have a lightbox that contains a button images where once the user/visitor clicks on that images its adds the item into cart. what i am trying to do is that once the button is clicked it adds the item without close the ifram is it possible i am using http://www.huddletogether.com/projects/lightbox2/ the cart that i used is http://conceptlogic.com/jcart/

    Read the article

  • Choosing a CMS for an artist's site?

    - by shoosh
    I'm looking for a simple CMS for a site I'm building for my girlfriend. The requirements are very minimal Show images one by one, possibly with a line of text for each Show an aggregate gallery of say 4x4 images. Possibly have several different such galleries Customizable look so i could fit it to her mockup Any suggestions come to mind? Can wordpress do this?

    Read the article

  • Are there any 3rd Party libraries for image processing in C#?

    - by Gaax
    Just wondering if there's anything out there to help make my project a lot easier to deal with. I'm working on a program that uses the Wiimote and infrared pen (mapped to the mouse) to manipulate images in real time and I'd much rather not have to use all my time figuring out how to make the program resize and rotate images efficiently with the least amount of distortion... I haven't really found anything when searching. Anybody know of any libraries that can help me?

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Changing elements in master page from content page in vb.net

    - by ferrer
    i have a page called a1.aspx, with the Masterpagefile = a1_master.master. Now the master page has its own divs and images for design purposes. I want a way where when i load a1.aspx, certain chosen 's and images should be hidden (visible=false). how can i do this? how can i change the visibility of a div or an image in the master page from the content page?

    Read the article

  • Flicker, orkut, picasa API for Flex? Need API?Please help?

    - by Ankur Sharma
    hello, I have to work on one new project, there we have to provide an option to download images from any website like, Orkut, picasa etc, so that the user, can view his/her pictures any time and his/her images are accessible any time, so i heard of APIs, that we developer can use. i hope u r getting me, i saw tour de flex, there are few available API like for Flicker, they have ready made API, but i need to work on Facebook, Picasso, Photobucket, etc please if any body of you having any solution on this, then plzz help me out, Thanks in advance

    Read the article

  • How to display part of an image for the specific width and height?

    - by Brady Chu
    Recently I participated in a web project which has a huge large of images to handle and display on web page, we know that the width and height of images end users uploaded cannot be control easily and then they are hard to display. At first, I attempted to zoom in/out the images to rearch an appropriate presentation, and I made it, but my boss is still not satisfied with my solution, the following is my way: var autoResizeImage = function(maxWidth, maxHeight, objImg) { var img = new Image(); img.src = objImg.src; img.onload = function() { var hRatio; var wRatio; var Ratio = 1; var w = img.width; var h = img.height; wRatio = maxWidth / w; hRatio = maxHeight / h; if (maxWidth == 0 && maxHeight == 0) { Ratio = 1; } else if (maxWidth == 0) { if (hRatio < 1) { Ratio = hRatio; } } else if (maxHeight == 0) { if (wRatio < 1) { Ratio = wRatio; } } else if (wRatio < 1 || hRatio < 1) { Ratio = (wRatio <= hRatio ? wRatio : hRatio); } if (Ratio < 1) { w = w * Ratio; h = h * Ratio; } w = w <= 0 ? 250 : w; h = h <= 0 ? 370 : h; objImg.height = h; objImg.width = w; }; }; This way is only intended to limit the max width and height for the image so that every image in album still has different width and height which are still very urgly. And right at this minute, I know we can create a DIV and use the image as its background image, this way is too complicated and not direct I don't want to take. So I's wondering whether there is a better way to display images with the fixed width and height without presentation distortion? Thanks.

    Read the article

  • jQuery animate on an image replacement

    - by Lee
    Hey All Hope you can advise I would like to add some simple fade in out of an image replacement which I have hooked into a select menu.ie, $("#vehicle").change(function(){ var selected = $(this).val(); $("#selectedVehicle").attr('src', '/assets/images/mini/'+selected+'.png'); }); <img id="selectedVehicle" src="/assets/v2/images/select-vehicle.png"> any suggestions how I can do it? Thanks in advanced

    Read the article

  • Background-position in css

    - by Mubeen
    Can we use more than 2 images for single navigation. That means when we hover on that image it will shows 6 different images. Is it possible to make for a single navigation image? If possible means how? I think you are all understand this

    Read the article

  • Wrapbootstrap integration

    - by Shaun Frost Duke Jackson
    Good Afternoon All, I'm having trouble integrating this template into my rails application. I've changes all the images and loaded all the files into their relevant areas. However they still have the subdirectories. Does anyone know of a guide I can walk through which might explain how you do this, especially to include the revolution-slider which has a whole subdirectory of CSS and images. Template being used: https://wrapbootstrap.com/theme/pixma-responsive-multipurpose-template-WB0B348C6 Thanks for the help.

    Read the article

  • Detecting Touches in an OpenGL rendered scene

    - by Icky
    Hey. I was wondering whether there is a way to detect a touch in an OpenGL rendered scene. What I have i a set of images which are being rendered in my main view. Now if the user touches one of these images (or objects) I would like to know which one was touched - similar to the CGRectContainsPoint(frame, [touch locationInView:self.view] method. Is there an easy way to find out? If there is none, this would also help.

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • How to successfully implement og:image for the LinkedIn

    - by Sabo
    THE PROBLEM: I am trying, without much success, to implement open graph image on site: http://www.guarenty-group.com/cz/ The homepage is completeply bypassing the og:image tag, where internal pages are reading all images from the site and place og:image as the last option. Other social networks are working fine on both internal pages and homepage. THE CONFIGURATION: I have no share buttons or alike, all I want is to be able to share the link via my profile. The image is well over 300x300px: http://guarenty-group.com/img/gg_seal.png Here is how my head tag looks like: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Guarenty Group : Pojištení pro nájemce a pronajímatelé</title> <meta name="keywords" content="" /> <meta name="description" content="Guarenty Group pojištuje príjem z nájmu pronajímatelum, kauci nájemcum - aby nemuseli platit velkou cástku v hotovostí predem - a dále nájemcum pojištuje príjmy, aby meli na nájem pri nemoci, úrazu ci nezamestnání." /> <meta name="image_src" content="http://guarenty-group.com/img/gg_seal.png" /> <meta name="image_url" content="http://guarenty-group.com/img/gg_seal.png" /> <meta property="og:title" content="Pojištení pro nájemce a pronajímatelé" /> <meta property="og:url" content="http://guarenty-group.com/cz/" /> <meta property="og:image" content="http://guarenty-group.com/img/gg_seal.png" /> <meta property="og:description" content="Guarenty Group pojištuje príjem z nájmu pronajímatelum, kauci nájemcum - aby nemuseli platit velkou cástku v hotovostí predem - a dále nájemcum pojištuje príjmy, aby meli na nájem pri nemoci, úrazu ci nezamestnání [...]" /> ... </head> THE TESTING RESULTS: In order to trick the cache i have tested the site with http://www.guarenty-group.com/cz/?try=N, where I have changed the N every time. The strange thing is that images found for different value of N is different. Sometimes there is no image, sometimes there is 1, 2 or 3 images, but each time there is a different set of images. But, in any case I could not find the image specified in the og:graph! MY QUESTIONS: https://developer.linkedin.com/documents/setting-display-tags-shares is saying one thing, and the personnel on the support forum is saying "over 300" Does anyone know What is the official minimum dimension of the image (both w and h)? Can an image be too large? Should I use the xmlns, should I not use xmlns or it doesn't matter? What are the maximum (and minimum) lengths for og:title and og:description tags? Any other suggestion is of course welcomed :) Thanks in advance, cheers~

    Read the article

  • python getelementbyid from string

    - by matthewgall
    Hey, I have the following program, that is trying to upload a file (or files) to an image upload site, however I am struggling to find out how to parse the returned HTML to grab the direct link (contained in a ). I have the code below: #!/usr/bin/python # -*- coding: utf-8 -*- import pycurl import urllib import urlparse import xml.dom.minidom import StringIO import sys import gtk import os import imghdr import locale import gettext try: import pynotify except: print "Please install pynotify." APP="Uploadir Uploader" DIR="locale" locale.setlocale(locale.LC_ALL, '') gettext.bindtextdomain(APP, DIR) gettext.textdomain(APP) _ = gettext.gettext ##STRINGS uploading = _("Uploading image to Uploadir.") oneimage = _("1 image has been successfully uploaded.") multimages = _("images have been successfully uploaded.") uploadfailed = _("Unable to upload to Uploadir.") class Uploadir: def __init__(self, args): self.images = [] self.urls = [] self.broadcasts = [] self.username="" self.password="" if len(args) == 1: return else: for file in args: if file == args[0] or file == "": continue if file.startswith("-u"): self.username = file.split("-u")[1] #print self.username continue if file.startswith("-p"): self.password = file.split("-p")[1] #print self.password continue self.type = imghdr.what(file) self.images.append(file) for file in self.images: self.upload(file) self.setClipBoard() self.broadcast(self.broadcasts) def broadcast(self, l): try: str = '\n'.join(l) n = pynotify.Notification(str) n.set_urgency(pynotify.URGENCY_LOW) n.show() except: for line in l: print line def upload(self, file): #Try to login cookie_file_name = "/tmp/uploadircookie" if ( self.username!="" and self.password!=""): print "Uploadir authentication in progress" l=pycurl.Curl() loginData = [ ("username",self.username),("password", self.password), ("login", "Login") ] l.setopt(l.URL, "http://uploadir.com/user/login") l.setopt(l.HTTPPOST, loginData) l.setopt(l.USERAGENT,"User-Agent: Uploadir (Python Image Uploader)") l.setopt(l.FOLLOWLOCATION,1) l.setopt(l.COOKIEFILE,cookie_file_name) l.setopt(l.COOKIEJAR,cookie_file_name) l.setopt(l.HEADER,1) loginDataReturnedBuffer = StringIO.StringIO() l.setopt( l.WRITEFUNCTION, loginDataReturnedBuffer.write ) if l.perform(): self.broadcasts.append("Login failed. Please check connection.") l.close() return loginDataReturned = loginDataReturnedBuffer.getvalue() l.close() #print loginDataReturned if loginDataReturned.find("<li>Your supplied username or password is invalid.</li>")!=-1: self.broadcasts.append("Uploadir authentication failed. Username/password invalid.") return else: self.broadcasts.append("Uploadir authentication successful.") #cookie = loginDataReturned.split("Set-Cookie: ")[1] #cookie = cookie.split(";",0) #print cookie c = pycurl.Curl() values = [ ("file", (c.FORM_FILE, file)) ] buf = StringIO.StringIO() c.setopt(c.URL, "http://uploadir.com/file/upload") c.setopt(c.HTTPPOST, values) c.setopt(c.COOKIEFILE, cookie_file_name) c.setopt(c.COOKIEJAR, cookie_file_name) c.setopt(c.WRITEFUNCTION, buf.write) if c.perform(): self.broadcasts.append(uploadfailed+" "+file+".") c.close() return self.result = buf.getvalue() #print self.result c.close() doc = urlparse.urlparse(self.result) self.urls.append(doc.getElementsByTagName("download")[0].childNodes[0].nodeValue) def setClipBoard(self): c = gtk.Clipboard() c.set_text('\n'.join(self.urls)) c.store() if len(self.urls) == 1: self.broadcasts.append(oneimage) elif len(self.urls) != 0: self.broadcasts.append(str(len(self.urls))+" "+multimages) if __name__ == '__main__': uploadir = Uploadir(sys.argv) Any help would be gratefully appreciated. Warm regards,

    Read the article

  • Conversion from jpg to gif with reduced size

    - by Ravi
    Hello, This is nice code. But it is uncertain. I am trying with jpg to gif conversion. With some images it reduces the size and with some images it increase the size. Can you help me that how can i get the reduced sized gif from jpg. Thanks, ravi

    Read the article

  • Background Image comes up as white when displayed using Javascript

    - by AndroidNewbie
    I am trying to change the background image whenever the document is loaded, and when it hits this point: document.body.style.backgroundImage="url('../images/mobile-bckground.png')"; The page simply makes the background plain white. It is displayed like this in my javascript: $(function() { document.body.style.backgroundImage="url('../images/mobile-bckground.png')"; }); I have verified the image is in the right location, why is it doing this?

    Read the article

  • Reportview export to pdf missing alt tags

    - by jestges
    Hi I'm working with reportviewer in vs2008, whey I try to export my report to pdf it is creating pdf successfully.. But here my problem is when I'm exporting my pdf file is missing alt tags for images which is previously there in my report. In my reportviewer it is showing alt tags for every image. But in pdf it is not showing any alt tag for images. Can somebody help me to solve this? Thanks in advance

    Read the article

  • Image Resize Aliasing in WPF v4 but not under v3.5

    - by McKAMEY
    I am using WPF for an image resizing pipeline which has been working beautifully under .NET v3.5. I just upgraded the project to target v4.0 and now all of my resized images are heavily aliased. None of the image pipeline code has changed. Has a default setting changed between v3.5 and v4.0? How do I control the dithering of my resized bitmap images in WPF?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Retrieve pictures from Excel file using OLEDB and C#

    - by CBoy
    I have an Excel sheet with two column, one is a number , and second column have a picture. i want to read these data from c# with oledb connection, i can read number easily , but pictures is not contained in second column , so in c# i just get first column. now, how can i read the images ? i want to extract the numbers and related images from this excel sheet. Thanks.

    Read the article

  • Unpacking an assembly inside of a war

    - by Walter White
    Hi all, I have another project which contains static content (css, images, JS, etc.), and I need that to be copied to the web root directory of jetty for testing. In that project, I output a zip file packaging up all of the images, CSS, etc. I have several of those virtualhost projects for different clients and my question is, how do I unpack the zip file that was already installed into the maven repository to the jetty web root? Walter

    Read the article

< Previous Page | 154 155 156 157 158 159 160 161 162 163 164 165  | Next Page >