Search Results

Search found 4206 results on 169 pages for 'equals operator'.

Page 165/169 | < Previous Page | 161 162 163 164 165 166 167 168 169  | Next Page >

  • Erasing and modifying elements in Boost MultiIndex Container

    - by Sarah
    I'm trying to use a Boost MultiIndex container in my simulation. My knowledge of C++ syntax is very weak, and I'm concerned I'm not properly removing an element from the container or deleting it from memory. I also need to modify elements, and I was hoping to confirm the syntax and basic philosophy here too. // main.cpp ... #include <boost/multi_index_container.hpp> #include <boost/multi_index/hashed_index.hpp> #include <boost/multi_index/member.hpp> #include <boost/multi_index/ordered_index.hpp> #include <boost/multi_index/mem_fun.hpp> #include <boost/tokenizer.hpp> #include <boost/shared_ptr.hpp> ... #include "Host.h" // class Host, all members private, using get fxns to access using boost::multi_index_container; using namespace boost::multi_index; typedef multi_index_container< boost::shared_ptr< Host >, indexed_by< hashed_unique< const_mem_fun<Host,int,&Host::getID> > // ordered_non_unique< BOOST_MULTI_INDEX_MEM_FUN(Host,int,&Host::getAge) > > // end indexed_by > HostContainer; typedef HostContainer::nth_index<0>::type HostsByID; int main() { ... HostContainer allHosts; Host * newHostPtr; newHostPtr = new Host( t, DOB, idCtr, 0, currentEvents ); allHosts.insert( boost::shared_ptr<Host>(newHostPtr) ); // allHosts gets filled up int randomHostID = 4; int newAge = 50; modifyHost( randomHostID, allHosts, newAge ); killHost( randomHostID, allHosts ); } void killHost( int id, HostContainer & hmap ){ HostsByID::iterator it = hmap.find( id ); cout << "Found host id " << (*it)->getID() << "Attempting to kill. hmap.size() before is " << hmap.size() << " and "; hmap.erase( it ); // Is this really erasing (freeing from mem) the underlying Host object? cout << hmap.size() << " after." << endl; } void modifyHost( int id, HostContainer & hmap, int newAge ){ HostsByID::iterator it = hmap.find( id ); (*it) -> setAge( newAge ); // Not actually the "modify" function for MultiIndex... } My questions are In the MultiIndex container allHosts of shared_ptrs to Host objects, is calling allHosts.erase( it ) on an iterator to the object's shared_ptr enough to delete the object permanently and free it from memory? It appears to be removing the shared_ptr from the container. The allhosts container currently has one functioning index that relies on the host's ID. If I introduce an ordered second index that calls on a member function (Host::getAge()), where the age changes over the course of the simulation, is the index always going to be updated when I refer to it? What is the difference between using the MultiIndex's modify to modify the age of the underlying object versus the approach I show above? I'm vaguely confused about what is assumed/required to be constant in MultiIndex. Thanks in advance. Update Here's my attempt to get the modify syntax working, based on what I see in a related Boost example. struct update_age { update_age():(){} // have no idea what this really does... elicits error void operator() (boost::shared_ptr<Host> ptr) { ptr->incrementAge(); // incrementAge() is a member function of class Host } }; and then in modifyHost, I'd have hmap.modify(it,update_age). Even if by some miracle this turns out to be right, I'd love some kind of explanation of what's going on.

    Read the article

  • nhibernate fatal error

    - by Afif Lamloumi
    i have an error ( System.InvalidCastException: Unable to cast object of type 'AccountProxy' to type 'System.String'.) when i did this code i mapped the tables( Account,AccountString,EventData,...) of the the database opengts ( open source) i have this error when i called a function from EventData.cs IQuery query = session.CreateQuery("FROM Eventdata"); IList pets = query.List(); return pets; the Stack Trace: [InvalidCastException: Impossible d'effectuer un cast d'un objet de type 'AccountProxy' en type 'System.String'.] (Object , Object[] , SetterCallback ) +431 NHibernate.Bytecode.Lightweight.AccessOptimizer.SetPropertyValues(Object target, Object[] values) +20 NHibernate.Tuple.Component.PocoComponentTuplizer.SetPropertyValues(Object component, Object[] values) +49 NHibernate.Type.ComponentType.SetPropertyValues(Object component, Object[] values, EntityMode entityMode) +34 NHibernate.Type.ComponentType.ResolveIdentifier(Object value, ISessionImplementor session, Object owner) +150 NHibernate.Type.ComponentType.NullSafeGet(IDataReader rs, String[] names, ISessionImplementor session, Object owner) +42 NHibernate.Loader.Loader.GetKeyFromResultSet(Int32 i, IEntityPersister persister, Object id, IDataReader rs, ISessionImplementor session) +93 NHibernate.Loader.Loader.GetRowFromResultSet(IDataReader resultSet, ISessionImplementor session, QueryParameters queryParameters, LockMode[] lockModeArray, EntityKey optionalObjectKey, IList hydratedObjects, EntityKey[] keys, Boolean returnProxies) +92 NHibernate.Loader.Loader.DoQuery(ISessionImplementor session, QueryParameters queryParameters, Boolean returnProxies) +675 NHibernate.Loader.Loader.DoQueryAndInitializeNonLazyCollections(ISessionImplementor session, QueryParameters queryParameters, Boolean returnProxies) +129 NHibernate.Loader.Loader.DoList(ISessionImplementor session, QueryParameters queryParameters) +116 [GenericADOException: could not execute query [ select eventdata0_.deviceID as deviceID5_, eventdata0_.timestamp as timestamp5_, eventdata0_.statusCode as statusCode5_, eventdata0_.accountID as accountID5_, eventdata0_.latitude as latitude5_, eventdata0_.longitude as longitude5_, eventdata0_.gpsAge as gpsAge5_, eventdata0_.speedKPH as speedKPH5_, eventdata0_.heading as heading5_, eventdata0_.altitude as altitude5_, eventdata0_.transportID as transpo11_5_, eventdata0_.inputMask as inputMask5_, eventdata0_.outputMask as outputMask5_, eventdata0_.address as address5_, eventdata0_.DataSource as DataSource5_, eventdata0_.rawdata as rawdata5_, eventdata0_.distanceKM as distanceKM5_, eventdata0_.odometerKM as odometerKM5_, eventdata0_.geozoneIndex as geozone19_5_, eventdata0_.geozoneID as geozoneID5_, eventdata0_.creationTime as creatio21_5_ from eventdata eventdata0_ ] [SQL: select eventdata0_.deviceID as deviceID5_, eventdata0_.timestamp as timestamp5_, eventdata0_.statusCode as statusCode5_, eventdata0_.accountID as accountID5_, eventdata0_.latitude as latitude5_, eventdata0_.longitude as longitude5_, eventdata0_.gpsAge as gpsAge5_, eventdata0_.speedKPH as speedKPH5_, eventdata0_.heading as heading5_, eventdata0_.altitude as altitude5_, eventdata0_.transportID as transpo11_5_, eventdata0_.inputMask as inputMask5_, eventdata0_.outputMask as outputMask5_, eventdata0_.address as address5_, eventdata0_.DataSource as DataSource5_, eventdata0_.rawdata as rawdata5_, eventdata0_.distanceKM as distanceKM5_, eventdata0_.odometerKM as odometerKM5_, eventdata0_.geozoneIndex as geozone19_5_, eventdata0_.geozoneID as geozoneID5_, eventdata0_.creationTime as creatio21_5_ from eventdata eventdata0_]] NHibernate.Loader.Loader.DoList(ISessionImplementor session, QueryParameters queryParameters) +213 NHibernate.Loader.Loader.ListIgnoreQueryCache(ISessionImplementor session, QueryParameters queryParameters) +18 NHibernate.Loader.Loader.List(ISessionImplementor session, QueryParameters queryParameters, ISet`1 querySpaces, IType[] resultTypes) +79 NHibernate.Hql.Ast.ANTLR.Loader.QueryLoader.List(ISessionImplementor session, QueryParameters queryParameters) +51 NHibernate.Hql.Ast.ANTLR.QueryTranslatorImpl.List(ISessionImplementor session, QueryParameters queryParameters) +231 NHibernate.Engine.Query.HQLQueryPlan.PerformList(QueryParameters queryParameters, ISessionImplementor session, IList results) +369 NHibernate.Impl.SessionImpl.List(String query, QueryParameters queryParameters, IList results) +317 NHibernate.Impl.SessionImpl.List(String query, QueryParameters parameters) +282 NHibernate.Impl.QueryImpl.List() +163 DATA1.EventdataExtensions.GetEventdata() in C:\Users\HP\Desktop\our_project\DATA1\Queries\Eventdata.cs:33 MvcApplication7.Controllers.HistoriqueController.Index() in C:\Users\HP\Desktop\our_project\MvcApplication7\Controllers\HistoriqueController.cs:17 lambda_method(Closure , ControllerBase , Object[] ) +62 System.Web.Mvc.ActionMethodDispatcher.Execute(ControllerBase controller, Object[] parameters) +17 System.Web.Mvc.ReflectedActionDescriptor.Execute(ControllerContext controllerContext, IDictionary`2 parameters) +208 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethod(ControllerContext controllerContext, ActionDescriptor actionDescriptor, IDictionary`2 parameters) +27 System.Web.Mvc.<>c__DisplayClass15.<InvokeActionMethodWithFilters>b__12() +55 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethodFilter(IActionFilter filter, ActionExecutingContext preContext, Func`1 continuation) +263 System.Web.Mvc.<>c__DisplayClass17.<InvokeActionMethodWithFilters>b__14() +19 System.Web.Mvc.ControllerActionInvoker.InvokeActionMethodWithFilters(ControllerContext controllerContext, IList`1 filters, ActionDescriptor actionDescriptor, IDictionary`2 parameters) +191 System.Web.Mvc.ControllerActionInvoker.InvokeAction(ControllerContext controllerContext, String actionName) +343 System.Web.Mvc.Controller.ExecuteCore() +116 System.Web.Mvc.ControllerBase.Execute(RequestContext requestContext) +97 System.Web.Mvc.ControllerBase.System.Web.Mvc.IController.Execute(RequestContext requestContext) +10 System.Web.Mvc.<>c__DisplayClassb.<BeginProcessRequest>b__5() +37 System.Web.Mvc.Async.<>c__DisplayClass1.<MakeVoidDelegate>b__0() +21 System.Web.Mvc.Async.<>c__DisplayClass8`1.<BeginSynchronous>b__7(IAsyncResult _) +12 System.Web.Mvc.Async.WrappedAsyncResult`1.End() +62 System.Web.Mvc.<>c__DisplayClasse.<EndProcessRequest>b__d() +50 System.Web.Mvc.SecurityUtil.<GetCallInAppTrustThunk>b__0(Action f) +7 System.Web.Mvc.SecurityUtil.ProcessInApplicationTrust(Action action) +22 System.Web.Mvc.MvcHandler.EndProcessRequest(IAsyncResult asyncResult) +60 System.Web.Mvc.MvcHandler.System.Web.IHttpAsyncHandler.EndProcessRequest(IAsyncResult result) +9 System.Web.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() +8841105 System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) +184 Any suggestions? how can correct this error Data entity class (outtake from comment): public class MyClass { public virtual string DeviceID { get; set; } public virtual int Timestamp { get; set; } public virtual string Account { get; set; } public virtual int StatusCode { get; set; } public virtual double Latitude { get; set; } public virtual double Longitude { get; set; } public virtual int GpsAge { get; set; } public virtual double SpeedKPH { get; set; } public virtual double Heading { get; set; } public override bool Equals(object obj) { return true; } public override int GetHashCode() { return 0; } }

    Read the article

  • Signals and threads - good or bad design decision?

    - by Jens
    I have to write a program that performs highly computationally intensive calculations. The program might run for several days. The calculation can be separated easily in different threads without the need of shared data. I want a GUI or a web service that informs me of the current status. My current design uses BOOST::signals2 and BOOST::thread. It compiles and so far works as expected. If a thread finished one iteration and new data is available it calls a signal which is connected to a slot in the GUI class. My question(s): Is this combination of signals and threads a wise idea? I another forum somebody advised someone else not to "go down this road". Are there potential deadly pitfalls nearby that I failed to see? Is my expectation realistic that it will be "easy" to use my GUI class to provide a web interface or a QT, a VTK or a whatever window? Is there a more clever alternative (like other boost libs) that I overlooked? following code compiles with g++ -Wall -o main -lboost_thread-mt <filename>.cpp code follows: #include <boost/signals2.hpp> #include <boost/thread.hpp> #include <boost/bind.hpp> #include <iostream> #include <iterator> #include <string> using std::cout; using std::cerr; using std::string; /** * Called when a CalcThread finished a new bunch of data. */ boost::signals2::signal<void(string)> signal_new_data; /** * The whole data will be stored here. */ class DataCollector { typedef boost::mutex::scoped_lock scoped_lock; boost::mutex mutex; public: /** * Called by CalcThreads call the to store their data. */ void push(const string &s, const string &caller_name) { scoped_lock lock(mutex); _data.push_back(s); signal_new_data(caller_name); } /** * Output everything collected so far to std::out. */ void out() { typedef std::vector<string>::const_iterator iter; for (iter i = _data.begin(); i != _data.end(); ++i) cout << " " << *i << "\n"; } private: std::vector<string> _data; }; /** * Several of those can calculate stuff. * No data sharing needed. */ struct CalcThread { CalcThread(string name, DataCollector &datcol) : _name(name), _datcol(datcol) { } /** * Expensive algorithms will be implemented here. * @param num_results how many data sets are to be calculated by this thread. */ void operator()(int num_results) { for (int i = 1; i <= num_results; ++i) { std::stringstream s; s << "["; if (i == num_results) s << "LAST "; s << "DATA " << i << " from thread " << _name << "]"; _datcol.push(s.str(), _name); } } private: string _name; DataCollector &_datcol; }; /** * Maybe some VTK or QT or both will be used someday. */ class GuiClass { public: GuiClass(DataCollector &datcol) : _datcol(datcol) { } /** * If the GUI wants to present or at least count the data collected so far. * @param caller_name is the name of the thread whose data is new. */ void slot_data_changed(string caller_name) const { cout << "GuiClass knows: new data from " << caller_name << std::endl; } private: DataCollector & _datcol; }; int main() { DataCollector datcol; GuiClass mc(datcol); signal_new_data.connect(boost::bind(&GuiClass::slot_data_changed, &mc, _1)); CalcThread r1("A", datcol), r2("B", datcol), r3("C", datcol), r4("D", datcol), r5("E", datcol); boost::thread t1(r1, 3); boost::thread t2(r2, 1); boost::thread t3(r3, 2); boost::thread t4(r4, 2); boost::thread t5(r5, 3); t1.join(); t2.join(); t3.join(); t4.join(); t5.join(); datcol.out(); cout << "\nDone" << std::endl; return 0; }

    Read the article

  • PHP Form not working IE and Chrome, but fine in FF

    - by RO
    <? if(isset($_POST['accountUser']) && isset($_POST['accountPassword'])) { include("dbase.php"); include("settings.php"); if ($_POST['accountType']=="member") { $database="chatusers"; } else if ($_POST['accountType']=="model") { $database="chatmodels"; } else if ($_POST['accountType']=="studioop") { $database="chatoperators"; } $userExists=false; $result = mysql_query("SELECT id,user,password,status FROM $database WHERE status!='pending' AND status!='rejected' "); while($row = mysql_fetch_array($result)) { $tempUser=$row["user"]; $tempPass=$row["password"]; $tempId=$row["id"]; if ($_POST['accountUser']==$tempUser && md5($_POST['accountPassword'])==$tempPass) { if ($row["status"]=="blocked") { $userExists=true; $errorMsg="Account is blocked, please contact the administrator for more details"; } else { $userExists=true; $currentTime=time(); mysql_query("UPDATE $database SET lastLogIn='$currentTime' WHERE id = '$tempId' LIMIT 1"); setcookie("usertype", $database, time()+3600); setcookie("id", $tempId, time()+3600); header("Location: cp/$database/"); } } } if (!$userExists){ $errorMsg="Wrong Username or password"; } } else if (isset($_GET['from']) && $_GET['from']=="recoverpass"){ $errorMsg="Your new password has been sent to your mail"; } else { $errorMsg="Please complete username and password fields"; } ?> <? include("_main.header.php"); ?> <table width="720" height="200" border="0" align="center" cellpadding="0" cellspacing="0"> <tr> <td align="center" valign="middle"><form action="login.php" method="post" enctype="application/x-www-form-urlencoded" name="form1"> <p>&nbsp;</p> <table width="720" border="0" align="center"> <tr> <td colspan="2"><p align="left"> <span class="error"><?php if ( isset($errorMsg) && $errorMsg!=""){ echo $errorMsg; } ?></span> <br> <br> </p></td> </tr> <tr> <td width="210" align="right" valign="top" class="form_definitions"><div align="right">Username:</div></td> <td align="left" valign="top"><input name="accountUser" type="text" id="accountUser" value="<? echo $_GET[user];?>" size="24" maxlength="24"></td> </tr> <tr> <td align="right" valign="top" class="form_definitions"><div align="right">Password:</div></td> <td align="left" valign="top"><input name="accountPassword" type="password" id="accountPassword2" size="24" maxlength="24"></td> </tr> <tr> <td align="right" valign="top" class="form_definitions"><div align="right">Account type:</div></td> <td align="left" valign="top"> <select name="accountType" id="select"> <option value="member" selected>Member</option> <option value="model">Model</option> <option value="studioop">Studio Operator</option> </select> <div align="left"></div></td> </tr> <tr> <td align="right" valign="top" class="form_definitions">&nbsp;</td> <td align="left" valign="top"> <input type="submit" name="Submit" value="Log In to your account"> <div align="left"></div></td> </tr> <tr> <td align="right" valign="top" class="form_definitions">&nbsp;</td> <td align="left" valign="top"><a href="lostpassword.php" class="left">Lost Password? Press Here!</a></td> </tr> </table> </form></td> </tr> </table> <br> <br> <? include("_main.footer.php"); ?>

    Read the article

  • java: how to compress data into a String and uncompress data from the String

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into data.zip server send to repository content of data.zip repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool I have tried a lots of compressing example found on the web but each time a send the data to the repository, my resulting zip file is corrupted. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • Gson Deserialize to Java Tree

    - by MountainX
    I need to deserialize some JSON to a Java tree structure that contains TreeNodes and NodeData. TreeNodes are thin wrappers around NodeData. I'll provide the JSON and the classes below. I have looked at the usual Gson help sources, including here, but I can't seem to come up with the solution. Serialization works fine with Gson. The JSON below was produced by Gson. But deserialization is the problem I need help with. Can someone show me how to write the deserializer (or suggest an alternative approach using Gson best practices)? Here is my JSON. The "data" element corresponds to class NodeData, and the "subList" JSON element corresponds to Java class TreeNode. { "data": { "version": "032", "name": "root", "path": "/", "id": "1", "parentId": "0", "toolTipText": "rootNode" }, "subList": [ { "data": { "version": "032", "name": "level1", "labelText": "Some Label Text at Level1", "path": "/root", "id": "2", "parentId": "1", "toolTipText": "a tool tip for level1" }, "subList": [ { "data": { "version": "032", "name": "level1_1", "labelText": "Label level1_1", "path": "/root/level1", "id": "3", "parentId": "2", "toolTipText": "ToolTipText for level1_1" } }, { "data": { "version": "032", "name": "level1_2", "labelText": "Label level1_2", "path": "/root/level1", "id": "4", "parentId": "2", "toolTipText": "ToolTipText for level1_2" } } ] }, { "data": { "version": "032", "name": "level2", "path": "/root", "id": "5", "parentId": "1", "toolTipText": "ToolTipText for level2" }, "subList": [ { "data": { "version": "032", "name": "level2_1", "labelText": "Label level2_1", "path": "/root/level2", "id": "6", "parentId": "5", "toolTipText": "ToolTipText for level2_1" }, "subList": [ { "data": { "version": "032", "name": "level2_1_1", "labelText": "Label level2_1_1", "path": "/root/level2/level2_1", "id": "7", "parentId": "6", "toolTipText": "ToolTipText for level2_1_1" } } ] } ] } ] } Here are the Java classes: public class Tree { private TreeNode rootElement; private HashMap<String, TreeNode> indexById; private HashMap<String, TreeNode> indexByKey; private long nextAvailableID = 0; public Tree() { indexById = new HashMap<String, TreeNode>(); indexByKey = new HashMap<String, TreeNode>(); } public long getNextAvailableID() { return this.nextAvailableID; } ... [snip] ... } public class TreeNode { private Tree tree; private NodeData data; public List<TreeNode> subList; private HashMap<String, TreeNode> indexById; private HashMap<String, TreeNode> indexByKey; //this default ctor is used only for Gson deserialization public TreeNode() { this.tree = new Tree(); indexById = tree.getIdIndex(); indexByKey = tree.getKeyIndex(); this.makeRoot(); tree.setRootElement(this); } //makes this node the root node. Calling this obviously has side effects. public NodeData makeRoot() { NodeData rootProp = new NodeData(TreeFactory.version, "example", "rootNode"); String nextAvailableID = getNextAvailableID(); if (!nextAvailableID.equals("1")) { throw new IllegalStateException(); } rootProp.setId(nextAvailableID); rootProp.setParentId("0"); rootProp.setKeyPathOnly("/"); rootProp.setSchema(tree); this.data = rootProp; rootProp.setNode(this); indexById.put(rootProp.getId(), this); indexByKey.put(rootProp.getKeyFullName(), this); return rootProp; } ... [snip] ... } public class NodeData { protected static Tree tree; private LinkedHashMap<String, String> keyValMap; protected String version; protected String name; protected String labelText; protected String path; protected String id; protected String parentId; protected TreeNode node; protected String toolTipText;//tool tip or help string protected String imagePath;//for things like images; not persisted to properties protected static final String delimiter = "/"; //this default ctor is used only for Gson deserialization public NodeData() { this("NOT_SET", "NOT_SET", "NOT_SET"); } ... [snip] ... } Side note: The tree data structure is a bit strange, as it includes indexes. Obviously, this isn't a typical search tree. In fact, the tree is used mainly to create a hierarchical path element (String) in each NodeData element. (Example: "path": "/root/level2/level2_1".) The indexes are actually used for NodeData retrieval.

    Read the article

  • Unable to Start Activity ComponentInfo when Starting a New Activity

    - by Timtim17
    {I know there's already a whole bunch of questions like this, but I can't see any problems that related to my program.} I have an Android App that is supposed to take a name from a EditText and put it in a TextView in another activity. It previously worked, but then I wanted it to start another activity if the EditText's value was equal to "ANDROID". However, now the app crashes whenever I try to start either activity. First Activity: package net.timtim17.dev.android.fun.nametag; import android.os.Bundle; import android.app.Activity; import android.content.Intent; import android.view.View; import android.view.View.OnClickListener; import android.widget.Button; import android.widget.EditText; public class MainActivity extends Activity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); final EditText et = (EditText) findViewById(R.id.editText1); Button submit = (Button) findViewById(R.id.button1); submit.setOnClickListener(new OnClickListener(){ @Override public void onClick(View v) { String text = et.getText().toString(); if(text.equals("ANDROID")){ Intent android = new Intent(MainActivity.this, AndroidNameTag.class); startActivity(android); }else{ Intent intent = new Intent(MainActivity.this, NameTag.class); intent.putExtra("name", text); startActivity(intent); } } }); } } NameTag Activity: package net.timtim17.dev.android.fun.nametag; import android.app.Activity; import android.os.Bundle; import android.widget.TextView; public class NameTag extends Activity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_tag); TextView tv = (TextView) findViewById(R.id.textView2); tv.setText(getIntent().getExtras().getString("name")); } } AndroidNameTag Activity: package net.timtim17.dev.android.fun.nametag; import android.app.Activity; import android.graphics.drawable.AnimationDrawable; import android.os.Bundle; import android.widget.ImageView; public class AndroidNameTag extends Activity { @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_android); ImageView iv = (ImageView) findViewById(R.id.imageView1); iv.setBackgroundResource(R.anim.animation); AnimationDrawable anim = (AnimationDrawable) iv.getBackground(); anim.start(); } } LogCat Error: 10-26 11:26:35.602: E/AndroidRuntime(2900): FATAL EXCEPTION: main 10-26 11:26:35.602: E/AndroidRuntime(2900): java.lang.RuntimeException: Unable to start activity ComponentInfo{net.timtim17.dev.android.fun.nametag/net.timtim17.dev.android.fun.nametag.NameTag}: java.lang.NullPointerException 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2211) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2261) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.ActivityThread.access$600(ActivityThread.java:141) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1256) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.os.Handler.dispatchMessage(Handler.java:99) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.os.Looper.loop(Looper.java:137) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.ActivityThread.main(ActivityThread.java:5103) 10-26 11:26:35.602: E/AndroidRuntime(2900): at java.lang.reflect.Method.invokeNative(Native Method) 10-26 11:26:35.602: E/AndroidRuntime(2900): at java.lang.reflect.Method.invoke(Method.java:525) 10-26 11:26:35.602: E/AndroidRuntime(2900): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:737) 10-26 11:26:35.602: E/AndroidRuntime(2900): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:553) 10-26 11:26:35.602: E/AndroidRuntime(2900): at dalvik.system.NativeStart.main(Native Method) 10-26 11:26:35.602: E/AndroidRuntime(2900): Caused by: java.lang.NullPointerException 10-26 11:26:35.602: E/AndroidRuntime(2900): at net.timtim17.dev.android.fun.nametag.NameTag.onCreate(NameTag.java:15) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.Activity.performCreate(Activity.java:5133) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1087) 10-26 11:26:35.602: E/AndroidRuntime(2900): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2175) 10-26 11:26:35.602: E/AndroidRuntime(2900): ... 11 more MainActivity Layout: <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" xmlns:tools="http://schemas.android.com/tools" android:layout_width="match_parent" android:layout_height="match_parent" android:paddingBottom="@dimen/activity_vertical_margin" android:paddingLeft="@dimen/activity_horizontal_margin" android:paddingRight="@dimen/activity_horizontal_margin" android:paddingTop="@dimen/activity_vertical_margin" tools:context=".MainActivity" > <TextView android:id="@+id/textView1" android:layout_width="match_parent" android:layout_height="wrap_content" android:layout_alignParentLeft="true" android:layout_alignParentTop="true" android:layout_marginTop="16dp" android:text="@string/main_text" android:textAppearance="?android:attr/textAppearanceMedium" /> <Button android:id="@+id/button1" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_alignRight="@+id/textView1" android:layout_below="@+id/textView1" android:layout_marginTop="14dp" android:text="@string/submit_button" /> <EditText android:id="@+id/editText1" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_alignLeft="@+id/textView1" android:layout_alignTop="@+id/button1" android:ems="10" android:inputType="textPersonName" > <requestFocus /> </EditText>

    Read the article

  • Matlab Image watermarking question , using both SVD and DWT

    - by Georgek
    Hello all . here is a code that i got over the net ,and it is supposed to embed a watermark of size(50*20) called _copyright.bmp in the Code below . the size of the cover object is (512*512), it is called _lena_std_bw.bmp.What we did here is we did DWT2 2 times for the image , when we reached our second dwt2 cA2 size is 128*128. You should notice that the blocksize and it equals 4, it is used to determine the max msg size based on cA2 according to the following code:max_message=RcA2*CcA2/(blocksize^2). in our current case max_message would equal 128*128/(4^2)=1024. i want to embed a bigger watermark in the 2nd dwt2 and lets say the size of that watermark is 400*10(i can change the dimension using MS PAINT), what i have to do is change the size of the blocksize to 2. so max_message=4096.Matlab gives me 3 errors and they are : ??? Error using == plus Matrix dimensions must agree. Error in == idwt2 at 93 x = upsconv2(a,{Lo_R,Lo_R},sx,dwtEXTM,shift)+ ... % Approximation. Error in == two_dwt_svd_low_low at 88 CAA1 = idwt2(cA22,cH2,cV2,cD2,'haar',[RcA1,CcA1]); The origional Code is (the origional code where blocksize =4): %This algorithm makes DWT for the whole image and after that make DWT for %cH1 and make SVD for cH2 and embed the watermark in every level after SVD %(1) -------------- Embed Watermark ------------------------------------ %Add the watermar W to original image I and give the watermarked image in J %-------------------------------------------------------------------------- % set the gain factor for embeding and threshold for evaluation clc; clear all; close all; % save start time start_time=cputime; % set the value of threshold and alpha thresh=.5; alpha =0.01; % read in the cover object file_name='_lena_std_bw.bmp'; cover_object=double(imread(file_name)); % determine size of watermarked image Mc=size(cover_object,1); %Height Nc=size(cover_object,2); %Width % read in the message image and reshape it into a vector file_name='_copyright.bmp'; message=double(imread(file_name)); T=message; Mm=size(message,1); %Height Nm=size(message,2); %Width % perform 1-level DWT for the whole cover image [cA1,cH1,cV1,cD1] = dwt2(cover_object,'haar'); % determine the size of cA1 [RcA1 CcA1]=size(cA1) % perform 2-level DWT for cA1 [cA2,cH2,cV2,cD2] = dwt2(cA1,'haar'); % determine the size of cA2 [RcA2 CcA2]=size(cA2) % set the value of blocksize blocksize=4 % reshape the watermark to a vector message_vector=round(reshape(message,Mm*Nm,1)./256); W=message_vector; % determine maximum message size based on cA2, and blocksize max_message=RcA2*CcA2/(blocksize^2) % check that the message isn't too large for cover if (length(message) max_message) error('Message too large to fit in Cover Object') end %----------------------- process the image in blocks ---------------------- x=1; y=1; for (kk = 1:length(message_vector)) [cA2u cA2s cA2v]=svd(cA2(y:y+blocksize-1,x:x+blocksize-1)); % if message bit contains zero, modify S of the original image if (message_vector(kk) == 0) cA2s = cA2s*(1 + alpha); % otherwise mask is filled with zeros else cA2s=cA2s; end cA22(y:y+blocksize-1,x:x+blocksize-1)=cA2u*cA2s*cA2v; % move to next block of mask along x; If at end of row, move to next row if (x+blocksize) >= CcA2 x=1; y=y+blocksize; else x=x+blocksize; end end % perform IDWT CAA1 = idwt2(cA22,cH2,cV2,cD2,'haar',[RcA1,CcA1]); watermarked_image= idwt2(CAA1,cH1,cV1,cD1,'haar',[Mc,Nc]); % convert back to uint8 watermarked_image_uint8=uint8(watermarked_image); % write watermarked Image to file imwrite(watermarked_image_uint8,'dwt_watermarked.bmp','bmp'); % display watermarked image figure(1) imshow(watermarked_image_uint8,[]) title('Watermarked Image') %(2) ---------------------------------------------------------------------- %---------- Extract Watermark from attacked watermarked image ------------- %-------------------------------------------------------------------------- % read in the watermarked object file_name='dwt_watermarked.bmp'; watermarked_image=double(imread(file_name)); % determine size of watermarked image Mw=size(watermarked_image,1); %Height Nw=size(watermarked_image,2); %Width % perform 1-level DWT for the whole watermarked image [ca1,ch1,cv1,cd1] = dwt2(watermarked_image,'haar'); % determine the size of ca1 [Rca1 Cca1]=size(ca1); % perform 2-level DWT for ca1 [ca2,ch2,cv2,cd2] = dwt2(ca1,'haar'); % determine the size of ca2 [Rca2 Cca2]=size(ca2); % process the image in blocks % for each block get a bit for message x=1; y=1; for (kk = 1:length(message_vector)) % sets correlation to 1 when patterns are identical to avoid /0 errors % otherwise calcluate difference between the cover image and the % watermarked image [cA2u cA2s cA2v]=svd(cA2(y:y+blocksize-1,x:x+blocksize-1)); [ca2u1 ca2s1 ca2v1]=svd(ca2(y:y+blocksize-1,x:x+blocksize-1)); correlation(kk)=diag(ca2s1-cA2s)'*diag(ca2s1-cA2s)/(alpha*alpha)/(diag(cA2s)*diag(cA2s)); % move on to next block. At and of row move to next row if (x+blocksize) >= Cca2 x=1; y=y+blocksize; else x=x+blocksize; end end % if correlation exceeds average correlation correlation(kk)=correlation(kk)+mean(correlation(1:Mm*Nm)); for kk = 1:length(correlation) if (correlation(kk) > thresh*alpha);%thresh*mean(correlation(1:Mo*No))) message_vector(kk)=0; end end % reshape the message vector and display recovered watermark. figure(2) message=reshape(message_vector(1:Mm*Nm),Mm,Nm); imshow(message,[]) title('Recovered Watermark') % display processing time elapsed_time=cputime-start_time, please do help,its my graduation project and i have been trying this code for along time but failed miserable. Thanks in advance

    Read the article

  • actionlistener not responding in java calculator

    - by tokee
    hi, please see calculator interface code below, from my beginners point of view the "1" should display when it's pressed but evidently i'm doing something wrong. any suggestiosn please? import java.awt.*; import javax.swing.*; import javax.swing.border.*; import java.awt.event.*; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import javax.swing.JButton; import javax.swing.JFrame; import javax.swing.JPanel; /** *A Class that operates as the framework for a calculator. *No calculations are performed in this section */ public class CalcFrame extends JPanel { private CalcEngine calc; private JFrame frame; private JTextField display; private JLabel status; /** * Constructor for objects of class GridLayoutExample */ //public CalcFrame(CalcEngine engine) //{ //frame.setVisible(true); // calc = engine; // makeFrame(); //} public CalcFrame() { makeFrame(); calc = new CalcEngine(); } class ButtonListener implements ActionListener { ButtonListener() { } public void actionPerformed(ActionEvent e) { if (e.getActionCommand().equals("1")) { System.out.println("1"); } } } /** * This allows you to quit the calculator. */ // Alows the class to quit. private void quit() { System.exit(0); } // Calls the dialog frame with the information about the project. private void showAbout() { JOptionPane.showMessageDialog(frame, "Declan Hodge and Tony O'Keefe Group Project", "About Calculator Group Project", JOptionPane.INFORMATION_MESSAGE); } // ---- swing stuff to build the frame and all its components ---- /** * The following creates a layout of the calculator frame. */ private void makeFrame() { frame = new JFrame("Group Project Calculator"); makeMenuBar(frame); JPanel contentPane = (JPanel)frame.getContentPane(); contentPane.setLayout(new BorderLayout(8, 8)); contentPane.setBorder(new EmptyBorder( 10, 10, 10, 10)); /** * Insert a text field */ display = new JTextField(8); contentPane.add(display, BorderLayout.NORTH); //Container contentPane = frame.getContentPane(); contentPane.setLayout(new GridLayout(4, 5)); JPanel buttonPanel = new JPanel(new GridLayout(4, 4)); contentPane.add(new JButton("9")); contentPane.add(new JButton("8")); contentPane.add(new JButton("7")); contentPane.add(new JButton("6")); contentPane.add(new JButton("5")); contentPane.add(new JButton("4")); contentPane.add(new JButton("3")); contentPane.add(new JButton("2")); contentPane.add(new JButton("1")); contentPane.add(new JButton("0")); contentPane.add(new JButton("+")); contentPane.add(new JButton("-")); contentPane.add(new JButton("/")); contentPane.add(new JButton("*")); contentPane.add(new JButton("=")); contentPane.add(new JButton("C")); contentPane.add(new JButton("CE")); contentPane.add(new JButton("%")); contentPane.add(new JButton("#")); //contentPane.add(buttonPanel, BorderLayout.CENTER); frame.pack(); frame.setVisible(true); } /** * Create the main frame's menu bar. * The frame that the menu bar should be added to. */ private void makeMenuBar(JFrame frame) { final int SHORTCUT_MASK = Toolkit.getDefaultToolkit().getMenuShortcutKeyMask(); JMenuBar menubar = new JMenuBar(); frame.setJMenuBar(menubar); JMenu menu; JMenuItem item; // create the File menu menu = new JMenu("File"); menubar.add(menu); // create the Quit menu with a shortcut "Q" key. item = new JMenuItem("Quit"); item.setAccelerator(KeyStroke.getKeyStroke(KeyEvent.VK_Q, SHORTCUT_MASK)); item.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { quit(); } }); menu.add(item); // Adds an about menu. menu = new JMenu("About"); menubar.add(menu); // Displays item = new JMenuItem("Calculator Project"); item.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { showAbout(); } }); menu.add(item); } }

    Read the article

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • Printing an array in a method, from a different class?

    - by O.Lodhi
    Hello All, I'm a fairly inexperienced programmer, and i'm currently working on a Console Application project. It's basically a little 'mathematics game'; the application generates two random numbers, that have either been added, subtracted, multiplied or divided against each other randomly. The answer is shown on screen and the user has to pick from the menu which is the right mathematical operator, once the correct answer is picked the application then displays on screen how long it took for the user in milliseconds to input the correct answer. Now I want to save the times of the players in an array that can be called up later with all the scores. I need to include a method in this programme and I figured a method to save the times into an array would be suitable. I seem to have stumbled across a little problem though. I'm not quite sure what's wrong: using System; using System.Collections.Generic; using System.Linq; using System.Text; namespace Mathgame { class Program { } class arrayclass { public static void saveInArray(int duration) { int[] TopTenScores = {000,1000,2000,3000,4000,5000,6000,7000,8000,9000}; if (duration < 1000) { duration = TopTenScores[000]; } else if ((duration >= 1000) && (duration <= 1999)) { duration = TopTenScores[1000]; } else if ((duration >= 2000) && (duration <= 2999)) { duration = TopTenScores[2000]; } else if ((duration >= 3000) && (duration <= 3999)) { duration = TopTenScores[3000]; } else if ((duration >= 4000) && (duration <= 4999)) { duration = TopTenScores[4000]; } else if ((duration >= 5000) && (duration <= 5999)) { duration = TopTenScores[5000]; } else if ((duration >= 6000) && (duration <= 6999)) { duration = TopTenScores[6000]; } else if ((duration >= 7000) && (duration <= 7999)) { duration = TopTenScores[7000]; } else if ((duration >= 8000) && (duration <= 8999)) { duration = TopTenScores[8000]; } else if ((duration >= 9000) && (duration <= 9999)) { duration = TopTenScores[9000]; } Console.WriteLine(TopTenScores); } static void Main(string[] args) { int intInput, num1, num2, incorrect, array1; float answer; string input; System.Random randNum = new System.Random(); Console.WriteLine("Welcome to the Maths game!"); Console.WriteLine("(Apologies for the glitchiness!)"); Console.WriteLine(); Console.WriteLine("Please choose from the following options:"); Console.WriteLine(); retry: Console.WriteLine("1 - Test your Maths against the clock!"); Console.WriteLine("2 - Exit the application."); Console.WriteLine("3 - Top scores"); Console.WriteLine(); input = Console.ReadLine(); intInput = int.Parse(input); if (intInput == 1) { goto start; } else if (intInput == 2) { goto fin; } else if (intInput == 3) { array1 = array1.saveInArray; goto retry; } Now, in the last 'else if' statement in the code, you can see my variable array1 trying to call the method, but no matter what I do I keep getting errors. This is the only error I have at the moment, but I have a feeling soon as I resolve that error, another will come up. For now i'm just determined to get past this error: 'int' does not contain a definition for 'saveInArray' and no extension method 'saveInArray' accepting a first argument of type 'int' could be found (are you missing a using directive or an assembly reference?). Any help would be kindly appreciated, apologies in advanced for my ugly written code! And thank you to any help that I receive! Regards, Omar.

    Read the article

  • capturing video from ip camera

    - by Ruby
    I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

    Read the article

  • C# Generic Arrays and math operations on it

    - by msedi
    Hello, I'm currently involved in a project where I have very large image volumes. This volumes have to processed very fast (adding, subtracting, thresholding, and so on). Additionally most of the volume are so large that they event don't fit into the memory of the system. For that reason I have created an abstract volume class (VoxelVolume) that host the volume and image data and overloads the operators so that it's possible to perform the regular mathematical operations on volumes. Thereby two more questions opened up which I will put into stackoverflow into two additional threads. Here is my first question. My volume is implemented in a way that it only can contain float array data, but most of the containing data is from an UInt16 image source. Only operations on the volume can create float array images. When I started implementing such a volume the class looked like following: public abstract class VoxelVolume<T> { ... } but then I realized that overloading the operators or return values would get more complicated. An example would be: public abstract class VoxelVolume<T> { ... public static VoxelVolume<T> Import<T>(param string[] files) { } } also adding two overloading operators would be more complicated: ... public static VoxelVolume<T> operator+(VoxelVolume<T> A, VoxelVolume<T> B) { ... } Let's assume I can overcome the problems described above, nevertheless I have different types of arrays that contain the image data. Since I have fixed my type in the volumes to float the is no problem and I can do an unsafe operation when adding the contents of two image volume arrays. I have read a few threads here and had a look around the web, but found no real good explanation of what to do when I want to add two arrays of different types in a fast way. Unfortunately every math operation on generics is not possible, since C# is not able to calculate the size of the underlying data type. Of course there might by a way around this problem by using C++/CLR, but currently everything I have done so far, runs in 32bit and 64bit without having to do a thing. Switching to C++/CLR seemed to me (pleased correct me if I'm wrong) that I'm bound to a certain platform (32bit) and I have to compile two assemblies when I let the application run on another platform (64bit). Is this true? So asked shortly: How is it possible to add two arrays of two different types in a fast way. Is it true that the developers of C# haven't thought about this. Switching to a different language (C# - C++) seems not to be an option. I realize that simply performing this operation float []A = new float[]{1,2,3}; byte []B = new byte[]{1,2,3}; float []C = A+B; is not possible and unnecessary although it would be nice if it would work. My solution I was trying was following: public static class ArrayExt { public static unsafe TResult[] Add<T1, T2, TResult>(T1 []A, T2 []B) { // Assume the length of both arrays is equal TResult[] result = new TResult[A.Length]; GCHandle h1 = GCHandle.Alloc (A, Pinned); GCHandle h2 = GCHandle.Alloc (B, Pinned); GCHandle hR = GCHandle.Alloc (C, Pinned); void *ptrA = h1.ToPointer(); void *ptrB = h2.ToPointer(); void *ptrR = hR.ToPointer(); for (int i=0; i<A.Length; i++) { *((TResult *)ptrR) = (TResult *)((T1)*ptrA + (T2)*ptrB)); } h1.Free(); h2.Free(); hR.Free(); return result; } } Please excuse if the code above is not quite correct, I wrote it without using an C# editor. Is such a solution a shown above thinkable? Please feel free to ask if I made a mistake or described some things incompletely. Thanks for your help Martin

    Read the article

  • Ignoring focusLost(), SWT.Verify, or other SWT listeners in Java code.

    - by Zoot
    Outside of the actual SWT listener, is there any way to ignore a listener via code? For example, I have a java program that implements SWT Text Widgets, and the widgets have: SWT.Verify listeners to filter out unwanted text input. ModifyListeners to wait for the correct number of valid input characters and automatically set focus (using setFocus())to the next valid field, skipping the other text widgets in the tab order. focusLost(FocusEvent) FocusListeners that wait for the loss of focus from the text widget to perform additional input verification and execute an SQL query based on the user input. The issue I run into is clearing the text widgets. One of the widgets has the format "####-##" (Four Numbers, a hyphen, then two numbers) and I have implemented this listener, which is a modified version of SWT Snippet Snippet179. The initial text for this text widget is " - " to provide visual feedback to the user as to the expected format. Only numbers are acceptable input, and the program automatically skips past the hyphen at the appropriate point. /* * This listener was adapted from the "verify input in a template (YYYY/MM/DD)" SWT Code * Snippet (also known as Snippet179), from the Snippets page of the SWT Project. * SWT Code Snippets can be found at: * http://www.eclipse.org/swt/snippets/ */ textBox.addListener(SWT.Verify, new Listener() { boolean ignore; public void handleEvent(Event e) { if (ignore) return; e.doit = false; StringBuffer buffer = new StringBuffer(e.text); char[] chars = new char[buffer.length()]; buffer.getChars(0, chars.length, chars, 0); if (e.character == '\b') { for (int i = e.start; i < e.end; i++) { switch (i) { case 0: /* [x]xxx-xx */ case 1: /* x[x]xx-xx */ case 2: /* xx[x]x-xx */ case 3: /* xxx[x]-xx */ case 5: /* xxxx-[x]x */ case 6: /* xxxx-x[x] */ { buffer.append(' '); break; } case 4: /* xxxx[-]xx */ { buffer.append('-'); break; } default: return; } } textBox.setSelection(e.start, e.start + buffer.length()); ignore = true; textBox.insert(buffer.toString()); ignore = false; textBox.setSelection(e.start, e.start); return; } int start = e.start; if (start > 6) return; int index = 0; for (int i = 0; i < chars.length; i++) { if (start + index == 4) { if (chars[i] == '-') { index++; continue; } buffer.insert(index++, '-'); } if (chars[i] < '0' || '9' < chars[i]) return; index++; } String newText = buffer.toString(); int length = newText.length(); textBox.setSelection(e.start, e.start + length); ignore = true; textBox.insert(newText); ignore = false; /* * After a valid key press, verifying if the input is completed * and passing the cursor to the next text box. */ if (7 == textBox.getCaretPosition()) { /* * Attempting to change the text after receiving a known valid input that has no results (0000-00). */ if ("0000-00".equals(textBox.getText())) { // "0000-00" is the special "Erase Me" code for these text boxes. ignore = true; textBox.setText(" - "); ignore = false; } // Changing focus to a different textBox by using "setFocus()" method. differentTextBox.setFocus(); } } } ); As you can see, the only method I've figured out to clear this text widget from a different point in the code is by assigning "0000-00" textBox.setText("000000") and checking for that input in the listener. When that input is received, the listener changes the text back to " - " (four spaces, a hyphen, then two spaces). There is also a focusLost Listener that parses this text widget for spaces, then in order to avoid unnecessary SQL queries, it clears/resets all fields if the input is invalid (i.e contains spaces). // Adding focus listener to textBox to wait for loss of focus to perform SQL statement. textBox.addFocusListener(new FocusAdapter() { @Override public void focusLost(FocusEvent evt) { // Get the contents of otherTextBox and textBox. (otherTextBox must be <= textBox) String boxFour = otherTextBox.getText(); String boxFive = textBox.getText(); // If either text box has spaces in it, don't perform the search. if (boxFour.contains(" ") || boxFive.contains(" ")) { // Don't perform SQL statements. Debug statement. System.out.println("Tray Position input contains spaces. Ignoring."); //Make all previous results invisible, if any. labels.setVisible(false); differentTextBox.setText(""); labelResults.setVisible(false); } else { //... Perform SQL statement ... } } } ); OK. Often, I use SWT MessageBox widgets in this code to communicate to the user, or wish to change the text widgets back to an empty state after verifying the input. The problem is that messageboxes seem to create a focusLost event, and using the .setText(string) method is subject to SWT.Verify listeners that are present on the text widget. Any suggestions as to selectively ignoring these listeners in code, but keeping them present for all other user input? Thank you in advance for your assistance.

    Read the article

  • Searching a set of data with multiple terms using Linq

    - by Cj Anderson
    I'm in the process of moving from ADO.NET to Linq. The application is a directory search program to look people up. The users are allowed to type the search criteria into a single textbox. They can separate each term with a space, or wrap a phrase in quotes such as "park place" to indicate that it is one term. Behind the scenes the data comes from a XML file that has about 90,000 records in it and is about 65 megs. I load the data into a DataTable and then use the .Select method with a SQL query to perform the searches. The query I pass is built from the search terms the user passed. I split the string from the textbox into an array using a regular expression that will split everything into a separate element that has a space in it. However if there are quotes around a phrase, that becomes it's own element in the array. I then end up with a single dimension array with x number of elements, which I iterate over to build a long query. I then build the search expression below: query = query & _ "((userid LIKE '" & tempstr & "%') OR " & _ "(nickname LIKE '" & tempstr & "%') OR " & _ "(lastname LIKE '" & tempstr & "%') OR " & _ "(firstname LIKE '" & tempstr & "%') OR " & _ "(department LIKE '" & tempstr & "%') OR " & _ "(telephoneNumber LIKE '" & tempstr & "%') OR " & _ "(email LIKE '" & tempstr & "%') OR " & _ "(Office LIKE '" & tempstr & "%'))" Each term will have a set of the above query. If there is more than one term, I put an AND in between, and build another query like above with the next term. I'm not sure how to do this in Linq. So far, I've got the XML file loading correctly. I'm able to search it with specific criteria, but I'm not sure how to best implement the search over multiple terms. 'this works but far too simple to get the job done Dim results = From c In m_DataSet...<Users> _ Where c.<userid>.Value = "XXXX" _ Select c The above code also doesn't use the LIKE operator either. So partial matches don't work. It looks like what I'd want to use is the .Startswith but that appears to be only in Linq2SQL. Any guidance would be appreciated. I'm new to Linq, so I might be missing a simple way to do this. The XML file looks like so: <?xml version="1.0" standalone="yes"?> <theusers> <Users> <userid>person1</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users> <Users> <userid>person2</userid> <nickname></nickname> <lastname></lastname> <firstname></firstname> <department></department> <telephoneNumber></telephoneNumber> <email></email> </Users>

    Read the article

  • Problem with XML parser

    - by zp26
    Hi, I have a problem with parsing XML. I have created a program which write a file xml in the project directory. The file XML are correct. (i checked). When i try to read this XML the program crash and return 1 status. I have controlled my 2 path and they are equals. Can you help me please? Thanks so much. #import "PositionIdentifierViewController.h" #import "WriterXML.h" @implementation PositionIdentifierViewController - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { NSString *stringa = [NSString stringWithFormat:@"%@",string]; textArea.text = [textArea.text stringByAppendingString:@"\n"]; textArea.text = [textArea.text stringByAppendingString:stringa]; } -(IBAction)startParsing { NSURL *xmlURL = [NSURL fileURLWithPath:path]; NSXMLParser *parser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; [parser setDelegate:self]; BOOL success = [parser parse]; if(success == YES){ // } [parser release]; } // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { [super viewDidLoad]; NSArray *tempPaths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [tempPaths objectAtIndex:0]; path = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; WriterXML *newWriter; newWriter = [[WriterXML alloc]init]; [newWriter saveXML:(NSString*)@"ciao":(float)10:(float)40:(float)70]; [newWriter saveXML:(NSString*)@"pippo":(float)20:(float)50:(float)80]; [newWriter saveXML:(NSString*)@"pluto":(float)30:(float)60:(float)90]; NSLog(path); } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end #import "WriterXML.h" @implementation WriterXML -(void)saveXML:(NSString*)name:(float)x:(float)y:(float)z{ NSArray *paths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [paths objectAtIndex:0]; NSString *filePath = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; NSFileHandle *myHandle; NSFileManager *fileManager = [NSFileManager defaultManager]; NSString *titoloXML = [NSString stringWithFormat:@"<?xml version=1.0 encoding=UTF-8 ?>"]; NSString *inizioTag = [NSString stringWithFormat:@"\n\n\n<position>"]; NSString *tagName = [NSString stringWithFormat:@"\n <name>%@</name>", name]; NSString *tagX = [NSString stringWithFormat:@"\n <x>%f</x>", x]; NSString *tagY = [NSString stringWithFormat:@"\n <y>%f</y>", y]; NSString *tagZ = [NSString stringWithFormat:@"\n <z>%f</z>", z]; NSString *fineTag= [NSString stringWithFormat:@"\n</position>"]; NSData* dataTitoloXML = [titoloXML dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataInizioTag = [inizioTag dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataName = [tagName dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataX = [tagX dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataY = [tagY dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataZ = [tagZ dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataFineTag = [fineTag dataUsingEncoding: NSASCIIStringEncoding]; if(![fileManager fileExistsAtPath:filePath]) [fileManager createFileAtPath:filePath contents:dataTitoloXML attributes:nil]; myHandle = [NSFileHandle fileHandleForUpdatingAtPath:filePath]; [myHandle seekToEndOfFile]; [myHandle writeData:dataInizioTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataName]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataX]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataY]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataZ]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataFineTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; NSLog(@"zp26 %@",filePath); } @end

    Read the article

  • C# Memoization of functions with arbitrary number of arguments

    - by Lirik
    I'm trying to create a memoization interface for functions with arbitrary number of arguments, but I'm failing miserably. The first thing I tried is to define an interface for a function which gets memoized automatically upon execution: class EMAFunction:IFunction { Dictionary<List<object>, List<object>> map; class EMAComparer : IEqualityComparer<List<object>> { private int _multiplier = 97; public bool Equals(List<object> a, List<object> b) { List<object> aVals = (List<object>)a[0]; int aPeriod = (int)a[1]; List<object> bVals = (List<object>)b[0]; int bPeriod = (int)b[1]; return (aVals.Count == bVals.Count) && (aPeriod == bPeriod); } public int GetHashCode(List<object> obj) { // Don't compute hash code on null object. if (obj == null) { return 0; } // Get length. int length = obj.Count; List<object> vals = (List<object>) obj[0]; int period = (int) obj[1]; return (_multiplier * vals.GetHashCode() * period.GetHashCode()) + length;; } } public EMAFunction() { NumParams = 2; Name = "EMA"; map = new Dictionary<List<object>, List<object>>(new EMAComparer()); } #region IFunction Members public int NumParams { get; set; } public string Name { get; set; } public object Execute(List<object> parameters) { if (parameters.Count != NumParams) throw new ArgumentException("The num params doesn't match!"); if (!map.ContainsKey(parameters)) { //map.Add(parameters, List<double> values = new List<double>(); List<object> asObj = (List<object>)parameters[0]; foreach (object val in asObj) { values.Add((double)val); } int period = (int)parameters[1]; asObj.Clear(); List<double> ema = TechFunctions.ExponentialMovingAverage(values, period); foreach (double val in ema) { asObj.Add(val); } map.Add(parameters, asObj); } return map[parameters]; } public void ClearMap() { map.Clear(); } #endregion } Here are my tests of the function: private void MemoizeTest() { DataSet dataSet = DataLoader.LoadData(DataLoader.DataSource.FROM_WEB, 1024); List<String> labels = dataSet.DataLabels; Stopwatch sw = new Stopwatch(); IFunction emaFunc = new EMAFunction(); List<object> parameters = new List<object>(); int numRuns = 1000; long sumTicks = 0; parameters.Add(dataSet.GetValues("open")); parameters.Add(12); // First call for(int i = 0; i < numRuns; ++i) { emaFunc.ClearMap();// remove any memoization mappings sw.Start(); emaFunc.Execute(parameters); sw.Stop(); sumTicks += sw.ElapsedTicks; } Console.WriteLine("Average ticks not-memoized " + (sumTicks/numRuns)); sumTicks = 0; // Repeat call for (int i = 0; i < numRuns; ++i) { sw.Start(); emaFunc.Execute(parameters); sw.Stop(); sumTicks += sw.ElapsedTicks; } Console.WriteLine("Average ticks memoized " + (sumTicks/numRuns)); } The performance is confusing me... I expected the memoized function to be faster, but it didn't work out that way: Average ticks not-memoized 106,182 Average ticks memoized 198,854 I tried doubling the data instances to 2048, but the results were about the same: Average ticks not-memoized 232,579 Average ticks memoized 446,280 I did notice that it was correctly finding the parameters in the map and it going directly to the map, but the performance was still slow... I'm either open for troubleshooting help with this example, or if you have a better solution to the problem then please let me know what it is.

    Read the article

  • Using a boost::fusion::map in boost::spirit::karma

    - by user1097105
    I am using boost spirit to parse some text files into a data structure and now I am beginning to generate text from this data structure (using spirit karma). One attempt at a data structure is a boost::fusion::map (as suggested in an answer to this question). But although I can use boost::spirit::qi::parse() and get data in it easily, when I tried to generate text from it using karma, I failed. Below is my attempt (look especially at the "map_data" type). After some reading and playing around with other fusion types, I found boost::fusion::vector and BOOST_FUSION_DEFINE_ASSOC_STRUCT. I succeeded to generate output with both of them, but they don't seem ideal: in vector you cannot access a member using a name (it is like a tuple) -- and in the other solution, I don't think I need both ways (member name and key type) to access the members. #include <iostream> #include <string> #include <boost/spirit/include/karma.hpp> #include <boost/fusion/include/map.hpp> #include <boost/fusion/include/make_map.hpp> #include <boost/fusion/include/vector.hpp> #include <boost/fusion/include/as_vector.hpp> #include <boost/fusion/include/transform.hpp> struct sb_key; struct id_key; using boost::fusion::pair; typedef boost::fusion::map < pair<sb_key, int> , pair<id_key, unsigned long> > map_data; typedef boost::fusion::vector < int, unsigned long > vector_data; #include <boost/fusion/include/define_assoc_struct.hpp> BOOST_FUSION_DEFINE_ASSOC_STRUCT( (), assocstruct_data, (int, a, sb_key) (unsigned long, b, id_key)) namespace karma = boost::spirit::karma; template <typename X> std::string to_string ( const X& data ) { std::string generated; std::back_insert_iterator<std::string> sink(generated); karma::generate_delimited ( sink, karma::int_ << karma::ulong_, karma::space, data ); return generated; } int main() { map_data d1(boost::fusion::make_map<sb_key, id_key>(234, 35314988526ul)); vector_data d2(boost::fusion::make_vector(234, 35314988526ul)); assocstruct_data d3(234,35314988526ul); std::cout << "map_data as_vector: " << boost::fusion::as_vector(d1) << std::endl; //std::cout << "map_data to_string: " << to_string(d1) << std::endl; //*FAIL No 1* std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d1) << boost::fusion::at_c<0>(d1) << std::endl << std::endl; std::cout << "vector_data: " << d2 << std::endl; std::cout << "vector_data to_string: " << to_string(d2) << std::endl << std::endl; std::cout << "assoc_struct as_vector: " << boost::fusion::as_vector(d3) << std::endl; std::cout << "assoc_struct to_string: " << to_string(d3) << std::endl; std::cout << "at_key (sb_key): " << boost::fusion::at_key<sb_key>(d3) << d3.a << boost::fusion::at_c<0>(d3) << std::endl; return 0; } Including the commented line gives lots of pages of compilation errors, among which notably something like: no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘double’ no known conversion for argument 1 from ‘boost::fusion::pair’ to ‘float’ Might it be that to_string needs the values of the map_data, and not the pairs? Though I am not good with templates, I tried to get a vector from a map using transform in the following way template <typename P> struct take_second { typename P::second_type operator() (P p) { return p.second; } }; // ... inside main() pair <char, int> ff(32); std::cout << "take_second (expect 32): " << take_second<pair<char,int>>()(ff) << std::endl; std::cout << "transform map_data and to_string: " << to_string(boost::fusion::transform(d1, take_second<>())); //*FAIL No 2* But I don't know what types am I supposed to give when instantiating take_second and anyway I think there must be an easier way to get (iterate over) the values of a map (is there?) If you answer this question, please also give your opinion on whether using an ASSOC_STRUCT or a map is better.

    Read the article

  • C++ destructor seems to be called 'early'

    - by suicideducky
    Please see the "edit" section for the updated information. Sorry for yet another C++ dtor question... However I can't seem to find one exactly like mine as all the others are assigning to STL containers (that will delete objects itself) whereas mine is to an array of pointers. So I have the following code fragment #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } }; template <class T> class Octree{ T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(){ for( int i=0; i<8; i++ ) children[i] = new T; } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Looking through the output I notice that the destructor is being called many times before I think it should (as Octree is still in scope), the end of the output also shows: del:0 del:0 del:1 del:2 del:3 Process returned -1073741819 (0xC0000005) execution time : 1.685 s Press any key to continue. For some reason the destructor is going through the same point in the loop twice (0) and then dying. All of this occures before the "nothing seems to have gone wrong" line which I expected before any dtor was called. Thanks in advance :) EDIT The code I posted has some things removed that I thought were unnecessary but after copying and compiling the code I pasted I no longer get the error. What I removed was other integer attributes of the code. Here is the origional: #include<iostream> class Block{ public: int x, y, z; int type; Block(){ x=1; y=2; z=3; type=-1; } Block(int xx, int yy, int zz, int ty){ x=xx; y=yy; z=zz; type=ty; } Block(int xx, int yy, int zz){ x=xx; y=yy; z=zz; type=0; } }; template <class T> class Octree{ int x, y, z; int size; T* children[8]; public: ~Octree(){ for( int i=0; i<8; i++){ std::cout << "del:" << i << std::endl; delete children[i]; } } Octree(int xx, int yy, int zz, int size){ x=xx; y=yy; z=zz; size=size; for( int i=0; i<8; i++ ) children[i] = new T; } Octree(){ Octree(0, 0, 0, 10); } // place newchild in array at [i] void set_child(int i, T* newchild){ children[i] = newchild; } // return child at [i] T* get_child(int i){ return children[i]; } // place newchild at [i] and return the old [i] T* swap_child(int i, T* newchild){ T* p = children[i]; children[i] = newchild; return p; } }; int main(){ Octree< Octree<Block> > here; std::cout << "nothing seems to have broken" << std::endl; } Also, as for the problems with set_child, get_child and swap_child leading to possible memory leaks this will be solved as a wrapper class will either use get before set or use swap to get the old child and write this out to disk before freeing the memory itself. I am glad that it is not my memory management failing but rather another error. I have not made a copy and/or assignment operator yet as I was just testing the block tree out, I will almost certainly make them all private very soon. This version spits out -1073741819. Thank you all for your suggestions and I apologise for highjacking my own thread :$

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do implement a breadth first traversal?

    - by not looking for answer
    //This is what I have. I thought pre-order was the same and mixed it up with depth first! import java.util.LinkedList; import java.util.Queue; public class Exercise25_1 { public static void main(String[] args) { BinaryTree tree = new BinaryTree(new Integer[] {10, 5, 15, 12, 4, 8 }); System.out.print("\nInorder: "); tree.inorder(); System.out.print("\nPreorder: "); tree.preorder(); System.out.print("\nPostorder: "); tree.postorder(); //call the breadth method to test it System.out.print("\nBreadthFirst:"); tree.breadth(); } } class BinaryTree { private TreeNode root; /** Create a default binary tree */ public BinaryTree() { } /** Create a binary tree from an array of objects */ public BinaryTree(Object[] objects) { for (int i = 0; i < objects.length; i++) { insert(objects[i]); } } /** Search element o in this binary tree */ public boolean search(Object o) { return search(o, root); } public boolean search(Object o, TreeNode root) { if (root == null) { return false; } if (root.element.equals(o)) { return true; } else { return search(o, root.left) || search(o, root.right); } } /** Return the number of nodes in this binary tree */ public int size() { return size(root); } public int size(TreeNode root) { if (root == null) { return 0; } else { return 1 + size(root.left) + size(root.right); } } /** Return the depth of this binary tree. Depth is the * number of the nodes in the longest path of the tree */ public int depth() { return depth(root); } public int depth(TreeNode root) { if (root == null) { return 0; } else { return 1 + Math.max(depth(root.left), depth(root.right)); } } /** Insert element o into the binary tree * Return true if the element is inserted successfully */ public boolean insert(Object o) { if (root == null) { root = new TreeNode(o); // Create a new root } else { // Locate the parent node TreeNode parent = null; TreeNode current = root; while (current != null) { if (((Comparable)o).compareTo(current.element) < 0) { parent = current; current = current.left; } else if (((Comparable)o).compareTo(current.element) > 0) { parent = current; current = current.right; } else { return false; // Duplicate node not inserted } } // Create the new node and attach it to the parent node if (((Comparable)o).compareTo(parent.element) < 0) { parent.left = new TreeNode(o); } else { parent.right = new TreeNode(o); } } return true; // Element inserted } public void breadth() { breadth(root); } // Implement this method to produce a breadth first // search traversal public void breadth(TreeNode root){ if (root == null) return; System.out.print(root.element + " "); breadth(root.left); breadth(root.right); } /** Inorder traversal */ public void inorder() { inorder(root); } /** Inorder traversal from a subtree */ private void inorder(TreeNode root) { if (root == null) { return; } inorder(root.left); System.out.print(root.element + " "); inorder(root.right); } /** Postorder traversal */ public void postorder() { postorder(root); } /** Postorder traversal from a subtree */ private void postorder(TreeNode root) { if (root == null) { return; } postorder(root.left); postorder(root.right); System.out.print(root.element + " "); } /** Preorder traversal */ public void preorder() { preorder(root); } /** Preorder traversal from a subtree */ private void preorder(TreeNode root) { if (root == null) { return; } System.out.print(root.element + " "); preorder(root.left); preorder(root.right); } /** Inner class tree node */ private class TreeNode { Object element; TreeNode left; TreeNode right; public TreeNode(Object o) { element = o; } } }

    Read the article

  • Getting parameter sent via html form and saving in my db

    - by Wesley
    I have error in my code i don't know to solve it please help me: My Servlet: package br.com.cad.servlet; import java.io.IOException; import java.io.PrintWriter; import java.util.Date; import java.text.ParseException; import java.text.SimpleDateFormat; import java.util.Calendar; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import br.com.cad.dao.Cadastro; import br.com.cad.basica.Contato; public class AddDados extends HttpServlet{ protected void service(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { PrintWriter out = response.getWriter(); String nome = request.getParameter("nome"); String sobrenome = request.getParameter("sobrenome"); String rg = request.getParameter("rg"); String cpf = request.getParameter("cpf"); String sexo = request.getParameter("sexo"); StringBuilder finalDate = new StringBuilder("DataNascimento1") .append("/"+request.getParameter("DataNascimento??2")) .append("/"+request.getParameter("DataNascimento3")); try { SimpleDateFormat sdf = new SimpleDateFormat("dd/MM/yyyy"); finalDate.toString(); } catch(ParseException e) { out.println("Erro de conversão da data"); return; } Contato contato = new Contato(); contato.setNome(nome); contato.setSobrenome(sobrenome); contato.setRg(rg); contato.setCpf(cpf); contato.setSexo(sexo); if ("Masculino".equals(contato.getSexo())) { contato.setSexo("M"); } else { contato.setSexo("F"); } contato.setDataNascimento1(dataNascimento1); //error here ????? contato.setDataNascimento2(dataNascimento2); //error here ????? contato.setDataNascimento3(dataNascimento3); //error here ????? Cadastro dao = new Cadastro(); dao.adiciona(contato); out.println("<html>"); out.println("<body>"); out.println("Contato " + contato.getNome() + " adicionado com sucesso"); out.println("</body>"); out.println("</html>"); } } My object dao package br.com.cad.dao; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.SQLException; import java.sql.Date; import br.com.cad.dao.ConnectDb; import br.com.cad.basica.Contato; public class Cadastro { private Connection connection; public Cadastro() { this.connection = new ConnectDb().getConnection(); } public void adiciona(Contato contato) { String sql = "INSERT INTO dados_cadastro(pf_nome, pf_ultimonome, pf_rg, pf_cpf, pf_sexo,pf_dt_nasc) VALUES(?,?,?,?,?,?,?,?)"; try { PreparedStatement stmt = connection.prepareStatement(sql); stmt.setString(1, contato.getNome()); stmt.setString(2, contato.getSobrenome()); stmt.setString(3, contato.getRg()); stmt.setString(4, contato.getCpf()); stmt.setString(5, contato.getSexo()); stmt.setDate(6, new Date( contato.getDataNascimento1().getTimeInMillis()) ); // i think there are error here i don't know to solve it ????? stmt.execute(); stmt.close(); System.out.println("Cadastro realizado com sucesso!."); } catch(SQLException sqlException) { throw new RuntimeException(sqlException); } } } My class cadastro package br.com.cad.basica; import java.util.Calendar; public class Contato { private Long id; private String nome; private String sobrenome; private String email; private String endereco; private Calendar dataNascimento1; private Calendar dataNascimento2; private Calendar dataNascimento3; private String rg; private String cpf; private String sexo; public Long getId() { return id; } public void setId(Long id) { this.id = id; } public String getNome() { return nome; } public void setNome(String nome) { this.nome = nome; } ...getters and setters I need to saving data in my mysql db, but i have some doubt about this code main how to get parameter send form html combobox( 1 for day, 2 for month, 3 for year of birth) i concatened with StringBuilder finalDate ... so i have some problem in my code please help me!!!

    Read the article

  • Transaction issue in java with hibernate - latest entries not pulled from database

    - by Gearóid
    Hi, I'm having what seems to be a transactional issue in my application. I'm using Java 1.6 and Hibernate 3.2.5. My application runs a monthly process where it creates billing entries for a every user in the database based on their monthly activity. These billing entries are then used to create Monthly Bill object. The process is: Get users who have activity in the past month Create the relevant billing entries for each user Get the set of billing entries that we've just created Create a Monthly Bill based on these entries Everything works fine until Step 3 above. The Billing Entries are correctly created (I can see them in the database if I add a breakpoint after the Billing Entry creation method), but they are not pulled out of the database. As a result, an incorrect Monthly Bill is generated. If I run the code again (without clearing out the database), new Billing Entries are created and Step 3 pulls out the entries created in the first run (but not the second run). This, to me, is very confusing. My code looks like the following: for (User user : usersWithActivities) { createBillingEntriesForUser(user.getId()); userBillingEntries = getLastMonthsBillingEntriesForUser(user.getId()); createXMLBillForUser(user.getId(), userBillingEntries); } The methods called look like the following: @Transactional public void createBillingEntriesForUser(Long id) { UserManager userManager = ManagerFactory.getUserManager(); User user = userManager.getUser(id); List<AccountEvent> events = getLastMonthsAccountEventsForUser(id); BillingEntry entry = new BillingEntry(); if (null != events) { for (AccountEvent event : events) { if (event.getEventType().equals(EventType.ENABLE)) { Calendar cal = Calendar.getInstance(); Date eventDate = event.getTimestamp(); cal.setTime(eventDate); double startDate = cal.get(Calendar.DATE); double numOfDaysInMonth = cal.getActualMaximum(Calendar.DAY_OF_MONTH); double numberOfDaysInUse = numOfDaysInMonth - startDate; double fractionToCharge = numberOfDaysInUse/numOfDaysInMonth; BigDecimal amount = BigDecimal.valueOf(fractionToCharge * Prices.MONTHLY_COST); amount.scale(); entry.setAmount(amount); entry.setUser(user); entry.setTimestamp(eventDate); userManager.saveOrUpdate(entry); } } } } @Transactional public Collection<BillingEntry> getLastMonthsBillingEntriesForUser(Long id) { if (log.isDebugEnabled()) log.debug("Getting all the billing entries for last month for user with ID " + id); //String queryString = "select billingEntry from BillingEntry as billingEntry where billingEntry>=:firstOfLastMonth and billingEntry.timestamp<:firstOfCurrentMonth and billingEntry.user=:user"; String queryString = "select be from BillingEntry as be join be.user as user where user.id=:id and be.timestamp>=:firstOfLastMonth and be.timestamp<:firstOfCurrentMonth"; //This parameter will be the start of the last month ie. start of billing cycle SearchParameter firstOfLastMonth = new SearchParameter(); firstOfLastMonth.setTemporalType(TemporalType.DATE); //this parameter holds the start of the CURRENT month - ie. end of billing cycle SearchParameter firstOfCurrentMonth = new SearchParameter(); firstOfCurrentMonth.setTemporalType(TemporalType.DATE); Query query = super.entityManager.createQuery(queryString); query.setParameter("firstOfCurrentMonth", getFirstOfCurrentMonth()); query.setParameter("firstOfLastMonth", getFirstOfLastMonth()); query.setParameter("id", id); List<BillingEntry> entries = query.getResultList(); return entries; } public MonthlyBill createXMLBillForUser(Long id, Collection<BillingEntry> billingEntries) { BillingHistoryManager manager = ManagerFactory.getBillingHistoryManager(); UserManager userManager = ManagerFactory.getUserManager(); MonthlyBill mb = new MonthlyBill(); User user = userManager.getUser(id); mb.setUser(user); mb.setTimestamp(new Date()); Set<BillingEntry> entries = new HashSet<BillingEntry>(); entries.addAll(billingEntries); String xml = createXmlForMonthlyBill(user, entries); mb.setXmlBill(xml); mb.setBillingEntries(entries); MonthlyBill bill = (MonthlyBill) manager.saveOrUpdate(mb); return bill; } Help with this issue would be greatly appreciated as its been wracking my brain for weeks now! Thanks in advance, Gearoid.

    Read the article

  • Pass string between two threads in java

    - by geeta
    I have to search a string in a file and write the matched lines to another file. I have a thread to read a file and a thread to write a file. I want to send the stringBuffer from read thread to write thread. Please help me to pass this. I amm getting null value passed. write thread: class OutputThread extends Thread{ /****************** Writes the line with search string to the output file *************/ Thread runner1,runner; File Out_File; public OutputThread() { } public OutputThread(Thread runner,File Out_File) { runner1 = new Thread(this,"writeThread"); // (1) Create a new thread. this.Out_File=Out_File; this.runner=runner; runner1.start(); // (2) Start the thread. } public void run() { try{ BufferedWriter bufferedWriter=new BufferedWriter(new FileWriter(Out_File,true)); System.out.println("inside write"); synchronized(runner){ System.out.println("inside wait"); runner.wait(); } System.out.println("outside wait"); // bufferedWriter.write(line.toString()); Buffer Buf = new Buffer(); bufferedWriter.write(Buf.buffers); System.out.println(Buf.buffers); bufferedWriter.flush(); } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } } Read Thraed: class FileThread extends Thread{ Thread runner; File dir; String search_string,stats; File Out_File,final_output; StringBuffer sb = new StringBuffer(); public FileThread() { } public FileThread(CountDownLatch latch,String threadName,File dir,String search_string,File Out_File,File final_output,String stats) { runner = new Thread(this, threadName); // (1) Create a new thread. this.dir=dir; this.search_string=search_string; this.Out_File=Out_File; this.stats=stats; this.final_output=final_output; this.latch=latch; runner.start(); // (2) Start the thread. } public void run() { try{ Enumeration entries; ZipFile zipFile; String source_file_name = dir.toString(); File Source_file = dir; String extension; OutputThread out = new OutputThread(runner,Out_File); int dotPos = source_file_name.lastIndexOf("."); extension = source_file_name.substring(dotPos+1); if(extension.equals("zip")) { zipFile = new ZipFile(source_file_name); entries = zipFile.entries(); while(entries.hasMoreElements()) { ZipEntry entry = (ZipEntry)entries.nextElement(); if(entry.isDirectory()) { (new File(entry.getName())).mkdir(); continue; } searchString(runner,entry.getName(),new BufferedInputStream(zipFile.getInputStream(entry)),Out_File,final_output,search_string,stats); } zipFile.close(); } else { searchString(runner,Source_file.toString(),new BufferedInputStream(new FileInputStream(Source_file)),Out_File,final_output,search_string,stats); } } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } /********* Reads the Input Files and Searches for the String ******************************/ public void searchString(Thread runner,String Source_File,BufferedInputStream in,File output_file,File final_output,String search,String stats) { int count = 0; int countw = 0; int countl=0; String s; String[] str; String newLine = System.getProperty("line.separator"); try { BufferedReader br2 = new BufferedReader(new InputStreamReader(in)); //OutputFile outfile = new OutputFile(); BufferedWriter bufferedWriter = new BufferedWriter(new FileWriter(output_file,true)); Buffer Buf = new Buffer(); //StringBuffer sb = new StringBuffer(); StringBuffer sb1 = new StringBuffer(); while((s = br2.readLine()) != null ) { str = s.split(search); count = str.length-1; countw += count; if(s.contains(search)){ countl++; sb.append(s); sb.append(newLine); } if(countl%100==0) { System.out.println("inside count"); Buf.setBuffers(sb.toString()); sb.delete(0,sb.length()); System.out.println("outside notify"); synchronized(runner) { runner.notify(); } //outfile.WriteFile(sb,bufferedWriter); //sb.delete(0,sb.length()); } } } synchronized(runner) { runner.notify(); } br2.close(); in.close(); if(countw == 0) { System.out.println("Input File : "+Source_File ); System.out.println("Word not found"); System.exit(0); } else { System.out.println("Input File : "+Source_File ); System.out.println("Matched word count : "+countw ); System.out.println("Lines with Search String : "+countl); System.out.println("Output File : "+output_file.toString()); System.out.println(); } } catch(Exception e){ System.out.println(e); e.printStackTrace(); } } }

    Read the article

  • AJAX call + JQuery Dialog Title changing dynamically

    - by Panther24
    I have an AJAX call which loads an Dialog page, now depending upon the content of the data returned on the AJAX call, I want to change the title of the Window, how do I do that. Here is the snippet of code: var divid = "brHistoryForm"; var url = "getRestoreFiles.action?profileName="+profileName; // Create xmlHttp var xmlHttp = AJAX(); // The code... xmlHttp.onreadystatechange=function(){ if(xmlHttp.readyState==4){ document.getElementById(divid).innerHTML=xmlHttp.responseText; } } xmlHttp.open("GET",url,true); xmlHttp.send(null); $('#brHistoryForm').dialog('open'); jQuery('#brHistoryForm').focus(); document.getElementById('pageTitle').innerHTML = "<h2>"+profileName+" - B&R History</h2>" Here 'pageTitle' is a div. When I run the above piece of code, it opens a dialog window, the action is redirected to a jsp page which is loaded inside the div. It works fine, but the title does not get set :(. I've tried to do the setting of the title in the redirected jsp page, it doesn't work either. Here is the code of that JSP page: <%@page contentType="text/html" pageEncoding="UTF-8"%> <!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd"> <%@ taglib prefix="s" uri="/struts-tags" %> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8"> <title>B&R History</title> </head> <body> <table style="width: 100%"> <tr> <td style="width: 40%"> <div id="pageTitle"> <h2>B&R History</h2> </div> </td> </tr> </table> <table id="diskTable" cellpadding="0" cellspacing="0" border="1" class="display"> <thead> <tr> <th>Select</th><th>Operation</th> <th>Source</th><th>Destination</th> <th>Status</th><th>Start Time</th><th>End Time</th> </tr> </thead> <tfoot></tfoot> <tbody> <s:iterator value="restoreFileList"> <tr> <td> <s:if test="%{status.equals('Finished')}"> <input onClick="loadRestoreForm('<s:property value="name"/>', '<s:property value="to_path"/>', '<s:property value="status"/>')" type="radio" name='chk' id="chk" value="<s:property value='id'/>,<s:property value="status"/>" > </s:if> <s:else> <input type="radio" name='chk' id="chk" value="<s:property value='id'/>,<s:property value="status"/>" disabled> </s:else> </td> <td> <s:if test="%{br_type == 0}"> Backup </s:if> <s:else> Restore </s:else> </td> <td><s:property value="from_path"/></td> <td><s:property value="to_path"/></td> <td><s:property value="status"/></td> <td><s:property value="start_time"/></td> <td><s:property value="end_time"/></td> </tr> </s:iterator> </tbody> </table> </body> </html> Any help would be appreciated.

    Read the article

< Previous Page | 161 162 163 164 165 166 167 168 169  | Next Page >