Search Results

Search found 13276 results on 532 pages for 'exception assistant'.

Page 165/532 | < Previous Page | 161 162 163 164 165 166 167 168 169 170 171 172  | Next Page >

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Updating to Spring 2.5.5 causes a javax.servlet.UnavailableException: org.springframework.web.struts

    - by Averroes
    I have been told to update some application from Spring 2.0.8 to Spring 2.5.5. This application is using Struts 1.2.7. Once I change the Spring.jar I get the following exception while loading in JBoss 4.0.5: 10:14:57,579 ERROR [[/PortalRRHH]] Servlet /PortalRRHH threw load() exception javax.servlet.UnavailableException: org.springframework.web.struts.DelegatingTilesRequestProcessor This is defined in the struts-config.xml this way: <controller locale="true"> <set-property property="processorClass" value="org.springframework.web.struts.DelegatingTilesRequestProcessor"/> </controller> I have no clue of what is happening since it works with the old version of Spring and the DelegatingTilesRequestProcessor is still available in Spring 2.5.5. I have no previous experience with Struts so if you need anything else to figure what the problem is please ask and I will update the question. Thanks.

    Read the article

  • Java multiple connections downloading file

    - by weulerjunior
    Hello friends, I was wanting to add multiple connections in the code below to be able to download files faster. Could someone help me? Thanks in advance. public void run() { RandomAccessFile file = null; InputStream stream = null; try { // Open connection to URL. HttpURLConnection connection = (HttpURLConnection) url.openConnection(); // Specify what portion of file to download. connection.setRequestProperty("Range", "bytes=" + downloaded + "-"); // Connect to server. connection.connect(); // Make sure response code is in the 200 range. if (connection.getResponseCode() / 100 != 2) { error(); } // Check for valid content length. int contentLength = connection.getContentLength(); if (contentLength < 1) { error(); } /* Set the size for this download if it hasn't been already set. */ if (size == -1) { size = contentLength; stateChanged(); } // Open file and seek to the end of it. file = new RandomAccessFile("C:\\"+getFileName(url), "rw"); file.seek(downloaded); stream = connection.getInputStream(); while (status == DOWNLOADING) { /* Size buffer according to how much of the file is left to download. */ byte buffer[]; if (size - downloaded > MAX_BUFFER_SIZE) { buffer = new byte[MAX_BUFFER_SIZE]; } else { buffer = new byte[size - downloaded]; } // Read from server into buffer. int read = stream.read(buffer); if (read == -1) { break; } // Write buffer to file. file.write(buffer, 0, read); downloaded += read; stateChanged(); } /* Change status to complete if this point was reached because downloading has finished. */ if (status == DOWNLOADING) { status = COMPLETE; stateChanged(); } } catch (Exception e) { error(); } finally { // Close file. if (file != null) { try { file.close(); } catch (Exception e) { } } // Close connection to server. if (stream != null) { try { stream.close(); } catch (Exception e) { } } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • A SelfHosted WCF Service over Basic HTTP Binding doesn't support more than 1000 concurrent requests

    - by Krishnan
    I have self hosted a WCF Service over BasicHttpBinding consumed by an ASMX Client. I'm simulating a concurrent user load of 1200 users. The service method takes a string parameter and returns a string. The data exchanged is less than 10KB. The processing time for a request is fixed at 2 seconds by having a Thread.Sleep(2000) statement. Nothing additional. I have removed all the DB Hits / business logic. The same piece of code runs fine for 1000 concurrent users. I get the following error when I bump up the number to 1200 users. System.Net.WebException: The underlying connection was closed: An unexpected error occurred on a receive. ---> System.IO.IOException: Unable to read data from the transport connection: An existing connection was forcibly closed by the remote host. ---> System.Net.Sockets.SocketException: An existing connection was forcibly closed by the remote host at System.Net.Sockets.Socket.Receive(Byte[] buffer, Int32 offset, Int32 size, SocketFlags socketFlags) at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) --- End of inner exception stack trace --- at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.PooledStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.Connection.SyncRead(HttpWebRequest request, Boolean userRetrievedStream, Boolean probeRead) --- End of inner exception stack trace --- at System.Web.Services.Protocols.WebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.HttpWebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at WCF.Throttling.Client.Service.Function2(String param) This exception is often reported on DataContract mismatch and large data exchange. But never when doing a load test. I have browsed enough and have tried most of the options which include, Enabled Trace & Message log on server side. But no errors logged. To overcome Port Exhaustion MaxUserPort is set to 65535, and TcpTimedWaitDelay 30 secs. MaxConcurrent Calls is set to 600, and MaxConcurrentInstances is set to 1200. The Open, Close, Send and Receive Timeouts are set to 10 Minutes. The HTTPWebRequest KeepAlive set to false. I have not been able to nail down the issue for the past two days. Any help would be appreciated. Thank you.

    Read the article

  • Django - I got TemplateSyntaxError when I try open the admin page. (http://DOMAIN_NAME/admin)

    - by user140827
    I use grappelly plugin. When I try open the admin page (/admin) I got TemplateSyntaxError. It says 'get_generic_relation_list' is invalid block tag. TemplateSyntaxError at /admin/ Invalid block tag: 'get_generic_relation_list', expected 'endblock' Request Method: GET Request URL: http://DOMAIN_NAME/admin/ Django Version: 1.4 Exception Type: TemplateSyntaxError Exception Value: Invalid block tag: 'get_generic_relation_list', expected 'endblock' Exception Location: /opt/python27/django/1.4/lib/python2.7/site-packages/django/template/base.py in invalid_block_tag, line 320 Python Executable: /opt/python27/django/1.4/bin/python Python Version: 2.7.0 Python Path: ['/home/vhosts/DOMAIN_NAME/httpdocs/media', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov/lib', '/home/vhosts/DOMAIN_NAME/httpdocs/', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private/new_malinnikov', '/home/vhosts/DOMAIN_NAME/private', '/opt/python27/django/1.4', '/home/vhosts/DOMAIN_NAME/httpdocs', '/opt/python27/django/1.4/lib/python2.7/site-packages/setuptools-0.6c12dev_r88846-py2.7.egg', '/opt/python27/django/1.4/lib/python2.7/site-packages/pip-0.8.1-py2.7.egg', '/opt/python27/django/1.4/lib/python27.zip', '/opt/python27/django/1.4/lib/python2.7', '/opt/python27/django/1.4/lib/python2.7/plat-linux2', '/opt/python27/django/1.4/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/lib-old', '/opt/python27/django/1.4/lib/python2.7/lib-dynload', '/opt/python27/lib/python2.7', '/opt/python27/lib/python2.7/plat-linux2', '/opt/python27/lib/python2.7/lib-tk', '/opt/python27/django/1.4/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/setuptools-0.6c11-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/flup-1.0.3.dev_20100525-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/virtualenv-1.5.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLAlchemy-0.6.4-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/SQLObject-0.14.1-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/FormEncode-1.2.3dev-py2.7.egg', '/opt/python27/lib/python2.7/site-packages/MySQL_python-1.2.3-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/psycopg2-2.2.2-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages/pysqlite-2.6.0-py2.7-linux-x86_64.egg', '/opt/python27/lib/python2.7/site-packages', '/opt/python27/lib/python2.7/site-packages/PIL'] Server time: ???, 7 ??? 2012 04:19:42 +0700 Error during template rendering In template /home/vhosts/DOMAIN_NAME/httpdocs/templates/grappelli/admin/base.html, error at line 28 Invalid block tag: 'get_generic_relation_list', expected 'endblock' 18 <!--[if lt IE 8]> 19 <script src="http://ie7-js.googlecode.com/svn/version/2.0(beta3)/IE8.js" type="text/javascript"></script> 20 <![endif]--> 21 {% block javascripts %} 22 <script type="text/javascript" src="{% admin_media_prefix %}jquery/jquery-1.3.2.min.js"></script> 23 <script type="text/javascript" src="{% admin_media_prefix %}js/admin/Bookmarks.js"></script> 24 <script type="text/javascript"> 25 // Admin URL 26 var ADMIN_URL = "{% get_admin_url %}"; 27 // Generic Relations 28 {% get_generic_relation_list %} 29 // Get Bookmarks 30 $(document).ready(function(){ 31 $.ajax({ 32 type: "GET", 33 url: '{% url grp_bookmark_get %}', 34 data: "path=" + escape(window.location.pathname + window.location.search), 35 dataType: "html", 36 success: function(data){ 37 $('ul#bookmarks').replaceWith(data); 38 }

    Read the article

  • jQuery/Ajax/javascript in FireFox Error when using $.post/$.get

    - by IsenGrim
    uncaught exception: [Exception... "Component returned failure code: 0x80004005 (NS_ERROR_FAILURE)" nsresult: "0x80004005 (NS_ERROR_FAILURE)" location: "JS frame :: http://localhost/scripts/jQuery.js :: anonymous :: line 808" data: no] Line 0 is the error i get when i bring up firebug. This only happens in firefox (and maybe other browsers) but the code works fine in IE8. I have codes like this in jquery: $("#Logout").live("click", function (e) { e.preventDefault(e); $.post("/logout.php", {}, function () { //--a bunch of animations--// window.location = "/login.php"; } }); I have no idea whats wrong as even the error message is not helpful at all.. inside logout.php: <?php session_start(); session_destroy(); ?> Also dont work if I used GET or inserted phantom data. Or is there a more elegant way to do this?

    Read the article

  • Stack trace in website project, when debug = false

    - by chandmk
    We have a website project. We are logging unhanded exceptions via a appdomain level exception handler. When we set debug= true in web.config, the exception log is showing the offending line numbers in the stack trace. But when we set debug = false, in web.config, log is not displaying the line numbers. We are not in a position to convert the website project in to webapplication project type at this time. Its legacy application and almost all the code is in aspx pages. We also need to leave the project in 'updatable' mode. i.e. We can't user pre-compile option. We are generating pdb files. Is there anyway to tell this kind of website projects to generate the pdb files, and show the line numbers in the stack trace?

    Read the article

  • java.io.IOException: Invalid argument

    - by Luixv
    Hi I have a web application running in cluster mode with a load balancer. It consists in two tomcats (T1, and T2) addressing only one DB. T2 is nfs mounted to T1. This is the only dofference between both nodes. I have a java method generating some files. If the request runs on T1 there is no problem but if the request is running on node 2 I get an exception as follows: java.io.IOException: Invalid argument at java.io.FileOutputStream.close0(Native Method) at java.io.FileOutputStream.close(FileOutputStream.java:279) The corresponding code is as follows: for (int i = 0; i < dataFileList.size(); i++) { outputFileName = outputFolder + fileNameList.get(i); FileOutputStream fileOut = new FileOutputStream(outputFileName); fileOut.write(dataFileList.get(i), 0, dataFileList.get(i).length); fileOut.flush(); fileOut.close(); } The exception appears at the fileOut.close() Any hint? Luis

    Read the article

  • Fluent NHibernate MappingException : could not instantiate id generator

    - by Mark Simpson
    I'm pottering around with Fluent NHibernate to try and get a simple app up and running. I'm running through this Fluent NHibernate Tutorial. Everything seems to be going fine and I've created the required classes etc. and it all builds, but when I run the test, I get an exception. Someone in the comments section of the tutorial has the same problem, but I can't find any good information on what's causing it. Any help appreciated. It's probably something trivial. Exception details: FluentNHTest.Tests.Mappings.CustomerMappingTests.ValidateMappings: FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- FluentNHibernate.Cfg.FluentConfigurationException : An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail. ---- NHibernate.MappingException : could not instantiate id generator ---- System.FormatException : Input string was not in a correct format.

    Read the article

  • StackOverflowError being caused by a TableModelListener

    - by me_here
    I'm not sure why this is recursing. jTable1.getModel().addTableModelListener(new TableModelListener() { public void tableChanged(TableModelEvent evt) { int sum = 0; int i=0; for (i =0 ; i<2; i++){ sum = sum + Integer.parseInt(jTable1.getValueAt(0, i).toString()); } jTable1.setValueAt(sum, 0, 2); } }); The exception is: (it keeps repeating) Exception in thread "AWT-EventQueue-0" java.lang.StackOverflowError at javax.swing.table.DefaultTableColumnModel.getColumn(DefaultTableColumnModel.java:277) at javax.swing.JTable.convertColumnIndexToModel(JTable.java:2553) at javax.swing.JTable.getValueAt(JTable.java:2695) at testprogram.guitest.TestTableModel$1.tableChanged(TestTableModel.java:63) at javax.swing.table.AbstractTableModel.fireTableChanged(AbstractTableModel.java:280) at javax.swing.table.AbstractTableModel.fireTableCellUpdated(AbstractTableModel.java:259) at javax.swing.table.DefaultTableModel.setValueAt(DefaultTableModel.java:650) at javax.swing.JTable.setValueAt(JTable.java:2719) Any help appreciated.

    Read the article

  • enterprise library configuration 4.0

    - by prince23
    hi, i am using enterprise libaray confiuration 4.0. and here i have set the file size as rollSizeKB="20" but once my file size reaches 9kb. a new file is created. what is te issue. why is it creating new file once it reaches 9KB. <add fileName="c:\Exception.log" footer="----------------------------------------" formatter="Text Formatter" header="----------------------------------------" rollFileExistsBehavior="Increment" rollInterval="None" rollSizeKB="20" timeStampPattern="yyyy-MM-dd" listenerDataType="Microsoft.Practices.EnterpriseLibrary.Logging.Configuration.RollingFlatFileTraceListenerData, Microsoft.Practices.EnterpriseLibrary.Logging, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35" traceOutputOptions="Timestamp" filter="All" type="Microsoft.Practices.EnterpriseLibrary.Logging.TraceListeners.RollingFlatFileTraceListener, Microsoft.Practices.EnterpriseLibrary.Logging, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35" name="Exception Policy" /> any help would be great thank you

    Read the article

  • Handle mysql restart in SQLAlchemy

    - by wRAR
    My Pylons app uses local MySQL server via SQLAlchemy and python-MySQLdb. When the server is restarted, open pooled connections are apparently closed, but the application doesn't know about this and apparently when it tries to use such connection it receives "MySQL server has gone away": File '/usr/lib/pymodules/python2.6/sqlalchemy/engine/default.py', line 277 in do_execute cursor.execute(statement, parameters) File '/usr/lib/pymodules/python2.6/MySQLdb/cursors.py', line 166 in execute self.errorhandler(self, exc, value) File '/usr/lib/pymodules/python2.6/MySQLdb/connections.py', line 35 in defaulterrorhandler raise errorclass, errorvalue OperationalError: (OperationalError) (2006, 'MySQL server has gone away') This exception is not caught anywhere so it bubbles up to the user. If I should handle this exception somewhere in my code, please show the place for such code in a Pylons WSGI app. Or maybe there is a solution in SA itself?

    Read the article

  • Class declaration bug

    - by aladine
    Please advise me what's wrong with this class declaration: ExchEngine.java package engine; public class ExchEngine { public ExchEngine() { } public static void main(String[] args) { ExchEngine engine=new ExchEngine() ; } } When I compile this file, I always get exception: java.lang.NoClassDefFoundError: test_engine/ExchEngine Caused by: java.lang.ClassNotFoundException: test_engine.ExchEngine at java.net.URLClassLoader$1.run(URLClassLoader.java:202) at java.security.AccessController.doPrivileged(Native Method) at java.net.URLClassLoader.findClass(URLClassLoader.java:190) at java.lang.ClassLoader.loadClass(ClassLoader.java:307) at sun.misc.Launcher$AppClassLoader.loadClass(Launcher.java:301) at java.lang.ClassLoader.loadClass(ClassLoader.java:248) Exception in thread "main" This seems very weird that ExchEngine.java is inside a package and it cannot run itself. Thanks for any help.

    Read the article

  • problem burning DVD using IMAPI2 in Windows XP using c#.net..

    - by zoya
    i have used IMAPI2 for buring CD/DVD in windows XP..but it is giving me unhandeled exception...it is written as:- System.InvalidCastException: Unable to cast COM object of type 'IMAPI2.Interop.MsftFileSystemImageClass' to interface type 'IMAPI2.Interop.MsftFileSystemImage'. This operation failed because the QueryInterface call on the COM component for the interface with IID '{7CFF842C-7E97-4807-8304-910DD8F7C051}' failed due to the following error: No such interface supported (Exception from HRESULT: 0x80004002 (E_NOINTERFACE)) can anyone plz help me out to solve this pbm.. i have updated the XP storage 1.0 as written in the code project.. but still im not able to solve this error.. this project is working fine in Vista and Windows7 but unable to work with XP.. is there any solution to burn DVD in XP by using IMAPI or any other component..??? i have taken the sample code from http://www.codeproject.com/KB/miscctrl/imapi2.aspx

    Read the article

  • XML validation in Java - why does this fail?

    - by jd
    hi, first time dealing with xml, so please be patient. the code below is probably evil in a million ways (I'd be very happy to hear about all of them), but the main problem is of course that it doesn't work :-) public class Test { private static final String JSDL_SCHEMA_URL = "http://schemas.ggf.org/jsdl/2005/11/jsdl"; private static final String JSDL_POSIX_APPLICATION_SCHEMA_URL = "http://schemas.ggf.org/jsdl/2005/11/jsdl-posix"; public static void main(String[] args) { System.out.println(Test.createJSDLDescription("/bin/echo", "hello world")); } private static String createJSDLDescription(String execName, String args) { Document jsdlJobDefinitionDocument = getJSDLJobDefinitionDocument(); String xmlString = null; // create the elements Element jobDescription = jsdlJobDefinitionDocument.createElement("JobDescription"); Element application = jsdlJobDefinitionDocument.createElement("Application"); Element posixApplication = jsdlJobDefinitionDocument.createElementNS(JSDL_POSIX_APPLICATION_SCHEMA_URL, "POSIXApplication"); Element executable = jsdlJobDefinitionDocument.createElement("Executable"); executable.setTextContent(execName); Element argument = jsdlJobDefinitionDocument.createElement("Argument"); argument.setTextContent(args); //join them into a tree posixApplication.appendChild(executable); posixApplication.appendChild(argument); application.appendChild(posixApplication); jobDescription.appendChild(application); jsdlJobDefinitionDocument.getDocumentElement().appendChild(jobDescription); DOMSource source = new DOMSource(jsdlJobDefinitionDocument); validateXML(source); try { Transformer transformer = TransformerFactory.newInstance().newTransformer(); transformer.setOutputProperty(OutputKeys.INDENT, "yes"); StreamResult result = new StreamResult(new StringWriter()); transformer.transform(source, result); xmlString = result.getWriter().toString(); } catch (Exception e) { e.printStackTrace(); } return xmlString; } private static Document getJSDLJobDefinitionDocument() { DocumentBuilderFactory factory = DocumentBuilderFactory.newInstance(); DocumentBuilder builder = null; try { builder = factory.newDocumentBuilder(); } catch (Exception e) { e.printStackTrace(); } DOMImplementation domImpl = builder.getDOMImplementation(); Document theDocument = domImpl.createDocument(JSDL_SCHEMA_URL, "JobDefinition", null); return theDocument; } private static void validateXML(DOMSource source) { try { URL schemaFile = new URL(JSDL_SCHEMA_URL); Sche maFactory schemaFactory = SchemaFactory.newInstance(XMLConstants.W3C_XML_SCHEMA_NS_URI); Schema schema = schemaFactory.newSchema(schemaFile); Validator validator = schema.newValidator(); DOMResult result = new DOMResult(); validator.validate(source, result); System.out.println("is valid"); } catch (Exception e) { e.printStackTrace(); } } } it spits out a somewhat odd message: org.xml.sax.SAXParseException: cvc-complex-type.2.4.a: Invalid content was found starting with element 'JobDescription'. One of '{"http://schemas.ggf.org/jsdl/2005/11/jsdl":JobDescription}' is expected. Where am I going wrong here? Thanks a lot

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • Visual Studio 2010 failed tests throw exceptions

    - by Dave Hanson
    In VisualStudio2010 Ultimate RC I cannot figure out how to suppress {"CollectionAssert.AreEqual failed. (Element at index 0 do not match.)"} from Microsoft.VisualStudio.TestTools.UnitTesting.AssertFailedException If i Ctrl+Alt+E I get the exception dialog; however that exception doesn't seem to be in there to be suppressed. Does anyone else have any experience with this? I don't remember having to suppress these Assert fails in studio 2008 when running unit tests. My tests would fail and I could just click on the TestResults to see which tests failed instead of fighting through these dialogs. For now I guess I'll just run my tests through the command window.

    Read the article

  • Does Google App Engine allow creation of files and folders on the server ?

    - by Frank
    I know Google App Engine offers free space, but I wonder if it's for storing data in it's database only or does it also allow me to create files and directories on the server side to store my data ? For instance can I use the following method to save file ? public static void saveFile(String File_Path,StringBuffer Str_Buf,boolean Append) { FileOutputStream fos=null; BufferedOutputStream bos=null; try { fos=new FileOutputStream(File_Path,Append); bos=new BufferedOutputStream(fos); for (int j=0;j<Str_Buf.length();j++) bos.write(Str_Buf.charAt(j)); } catch (Exception e) { e.printStackTrace(); } finally { try { if (bos!=null) { bos.close(); bos=null; } if (fos!=null) { fos.close(); fos=null; } } catch (Exception ex) { ex.printStackTrace(); } } } Frank

    Read the article

  • Hibernate constraint ConstraintViolationException. Is there an easy way to ignore duplicate entries?

    - by vincent
    Basically I've got the below schema and I'm inserting records if they don't exists. However when it comes to inserting a duplicate it throws and error as I would expect. My question is whether there is an easy way to make Hibernate to just ignore inserts which would in effect insert duplicates? CREATE TABLE IF NOT EXISTS `method` ( `id` bigint(20) NOT NULL AUTO_INCREMENT, `name` varchar(10) DEFAULT NULL, PRIMARY KEY (`id`), UNIQUE KEY `name` (`name`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=2 ; SEVERE: Duplicate entry 'GET' for key 'name' Exception in thread "pool-11-thread-4" org.hibernate.exception.ConstraintViolationException: could not insert:

    Read the article

  • webservice - unknown web method parameter name methodname

    - by ch3r1f
    I called a webservice for fetching items in fullcalendar. The method is never called and firebug gives this error: *"POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario 500 Internal Server Error 1.01s" "unknown web method parameter name methodname"* Here is the asmx.vb code: <System.Web.Script.Services.ScriptService()> _ <System.Web.Services.WebService(Namespace:="http://localhost/uva/")> _ <System.Web.Services.WebServiceBinding(ConformsTo:=WsiProfiles.BasicProfile1_1)> _ <ToolboxItem(False)> _ Public Class ServicioFullCalendar Inherits System.Web.Services.WebService <ScriptMethod(ResponseFormat:=ResponseFormat.Json)> _ <WebMethod(MessageName:="ObtieneEventos")> _ Public Shared Function GetEventosCalendario(ByVal startDate As String, ByVal endDate As String) As String Try Return CalendarioMensualDAO.Instance.getEventos(startDate, endDate) Catch ex As Exception Throw New Exception("FullCalendar:GetEventos: " & ex.Message) Finally End Try End Function The webservice is "loaded" from the fullcalendar as follows: events: "ServicioFullCalendar.asmx/GetEventosCalendario",

    Read the article

  • How to display specific data from a file

    - by user1067332
    My program is supposed to ask the user for firstname, lastname, and phone number till the users stops. Then when to display it asks for the first name and does a search in the text file to find all info with the same first name and display lastname and phones of the matches. import java.util.*; import java.io.*; import java.util.Scanner; public class WritePhoneList { public static void main(String[] args)throws IOException { BufferedWriter output = new BufferedWriter(new FileWriter(new File( "PhoneFile.txt"), true)); String name, lname, age; int pos,choice; try { do { Scanner input = new Scanner(System.in); System.out.print("Enter First name, last name, and phone number "); name = input.nextLine(); output.write(name); output.newLine(); System.out.print("Would you like to add another? yes(1)/no(2)"); choice = input.nextInt(); }while(choice == 1); output.close(); } catch(Exception e) { System.out.println("Message: " + e); } } } Here is the display code, when i search for a name, it finds a match but displays the last name and phone number of the same name 3 times, I want it to display all of the possible matches with the first name. import java.util.*; import java.io.*; import java.util.Scanner; public class DisplaySelectedNumbers { public static void main(String[] args)throws IOException { String name; String strLine; try { FileInputStream fstream = new FileInputStream("PhoneFile.txt"); // Get the object of DataInputStream DataInputStream in = new DataInputStream(fstream); BufferedReader br = new BufferedReader(new InputStreamReader(in)); Scanner input = new Scanner(System.in); System.out.print("Enter a first name"); name = input.nextLine(); strLine= br.readLine(); String[] line = strLine.split(" "); String part1 = line[0]; String part2 = line[1]; String part3 = line[2]; //Read File Line By Line while ((strLine= br.readLine()) != null) { if(name.equals(part1)) { // Print the content on the console System.out.print("\n" + part2 + " " + part3); } } }catch (Exception e) {//Catch exception if any System.out.println("Error: " + e.getMessage()); } } }

    Read the article

  • Cross-thread operation not valid: Control accessed from a thread other than the thread it was create

    - by SilverHorse
    I have a scenario. (Windows Forms, C#, .NET) There is a main form which hosts some user control. The user control does some heavy data operation, such that if I directly call the Usercontrol_Load method the UI become nonresponsive for the duration for load method execution. To overcome this I load data on different thread (trying to change existing code as little as I can) I used a background worker thread which will be loading the data and when done will notify the application that it has done its work. Now came a real problem. All the UI (main form and its child usercontrols) was created on the primary main thread. In the LOAD method of the usercontrol I'm fetching data based on the values of some control (like textbox) on userControl. The pseudocode would look like this: //CODE 1 UserContrl1_LOadDataMethod() { if(textbox1.text=="MyName") <<======this gives exception { //Load data corresponding to "MyName". //Populate a globale variable List<string> which will be binded to grid at some later stage. } } The Exception it gave was Cross-thread operation not valid: Control accessed from a thread other than the thread it was created on. To know more about this I did some googling and a suggestion came up like using the following code //CODE 2 UserContrl1_LOadDataMethod() { if(InvokeRequired) // Line #1 { this.Invoke(new MethodInvoker(UserContrl1_LOadDataMethod)); return; } if(textbox1.text=="MyName") //<<======Now it wont give exception** { //Load data correspondin to "MyName" //Populate a globale variable List<string> which will be binded to grid at some later stage } } BUT BUT BUT... it seems I'm back to square one. The Application again become nonresponsive. It seems to be due to the execution of line #1 if condition. The loading task is again done by the parent thread and not the third that I spawned. I don't know whether I perceived this right or wrong. I'm new to threading. How do I resolve this and also what is the effect of execution of Line#1 if block? The situation is this: I want to load data into a global variable based on the value of a control. I don't want to change the value of a control from the child thread. I'm not going to do it ever from a child thread. So only accessing the value so that the corresponding data can be fetched from the database.

    Read the article

  • WCF: what timeout property to use?

    - by Tom234
    I have a piece of code like so NetTcpBinding binding = new NetTcpBinding(SecurityMode.Transport); binding.Security.Message.ClientCredentialType = MessageCredentialType.Windows; binding.CloseTimeout = new TimeSpan(0, 0, 1); binding.OpenTimeout = new TimeSpan(0, 0, 1); binding.SendTimeout = new TimeSpan(0, 0, 1); binding.ReceiveTimeout = new TimeSpan(0, 0, 1); EndpointAddress endPoint = new EndpointAddress(new Uri(clientPath)); DuplexChannelFactory<Iservice> channel = new DuplexChannelFactory<Iservice>(new ClientCallBack(clientName), binding, endPoint); channel.Ping() When the endpoint doesn't exist it still waits 20seconds before throwing an EndpointNotFoundException. The weird thing is that when i changed the SendTimeout the exception message changed from The connection attempt lasted for a time span of 00:00:20 to ....01 but still took 20seconds to throw the exception! How can i change this timeout?

    Read the article

< Previous Page | 161 162 163 164 165 166 167 168 169 170 171 172  | Next Page >