Search Results

Search found 13276 results on 532 pages for 'exception assistant'.

Page 166/532 | < Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >

  • Does Google App Engine allow creation of files and folders on the server ?

    - by Frank
    I know Google App Engine offers free space, but I wonder if it's for storing data in it's database only or does it also allow me to create files and directories on the server side to store my data ? For instance can I use the following method to save file ? public static void saveFile(String File_Path,StringBuffer Str_Buf,boolean Append) { FileOutputStream fos=null; BufferedOutputStream bos=null; try { fos=new FileOutputStream(File_Path,Append); bos=new BufferedOutputStream(fos); for (int j=0;j<Str_Buf.length();j++) bos.write(Str_Buf.charAt(j)); } catch (Exception e) { e.printStackTrace(); } finally { try { if (bos!=null) { bos.close(); bos=null; } if (fos!=null) { fos.close(); fos=null; } } catch (Exception ex) { ex.printStackTrace(); } } } Frank

    Read the article

  • java.io.FileNotFoundException for valid URL

    - by Alexei
    Hello. I use library rome.dev.java.net to fetch RSS. Code is URL feedUrl = new URL("http://planet.rubyonrails.ru/xml/rss"); SyndFeedInput input = new SyndFeedInput(); SyndFeed feed = input.build(new XmlReader(feedUrl)); You can check that http://planet.rubyonrails.ru/xml/rss is valid URL and the page is shown in browser. But I get exception from my application java.io.FileNotFoundException: http://planet.rubyonrails.ru/xml/rss at sun.net.www.protocol.http.HttpURLConnection.getInputStream(HttpURLConnection.java:1311) at com.sun.syndication.io.XmlReader.<init>(XmlReader.java:237) at com.sun.syndication.io.XmlReader.<init>(XmlReader.java:213) at rssdaemonapp.ValidatorThread.run(ValidatorThread.java:32) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619) I don't use any proxy. I get this exception on my PC and on the production server and only for this URL, other URLs are working.

    Read the article

  • Operation can only be performed on cells that belong to a DataGridView control

    - by The Demigeek
    The following code throws an InvalidOperationException with the above message and I don't understand why. My code calls the following method when the user may have made changes to the datagridview's underlying data source. The goal is to update the display with any changed data, and preserve the sort column and order. private void ReloadDataGridBindingListFromDatabase() { DataGridView dgv = myDataGridViewControl; DataGridViewColumn sortedColumn = dgv.SortedColumn; SortOrder sortOrder = dgv.SortOrder; //do stuff here to refresh dgv.DataSource if (sortedColumn != null) { //this line throws an exception sortedColumn.HeaderCell.SortGlyphDirection = sortOrder; } //etc. } Clearly, sortedColumn.HeaderCell is a cell that belongs to a DataGridView control. So why am I getting this exception? Many thanks for your input.

    Read the article

  • problem withAsync SqlComman

    - by Alibm
    I have problem with Timeout, when I run a command through app, a timeout exception is thrown, but when I run i directly in sql there is no timeout exception! my SP take about 11 min when I run it directly. for solving this issue, I found below code here, but I doesn't work properly! Immediately after beginExecute, IAsyncResult.iscomplete become true !!!! where is the problem ? IAsyncResult result = command.BeginExecuteNonQuery(); int count = 0; while (!result.IsCompleted) { Console.WriteLine("Waiting ({0})", count++); System.Threading.Thread.Sleep(1000); } Console.WriteLine("Command complete. Affected {0} rows.", command.EndExecuteNonQuery(result)); regards

    Read the article

  • JavaScript try/catch: errors or exceptions?

    - by Josh
    OK. I may be splitting hairs here, but my code isn't consistent and I'd like to make it so. But before I do, I want to make sure I'm going the right way. In practice this doesn't matter, but this has been bothering me for a while so I figured I'd ask my peers... Every time I use a try... catch statement, in the catch block I always log a message to my internal console. However my log messages are not consistent. They either look like: catch(err) { DFTools.console.log("someMethod caught an error: ",err.message); ... or: catch(ex) { DFTools.console.log("someMethod caught an exception: ",ex.message); ... Obviously the code functions properly either way but it's starting to bother me that I sometimes refer to "errors" and sometimes to "exceptions". Like I said, maybe I'm splitting hairs but which is the proper terminology? "Exception", or "Error"?

    Read the article

  • PHP Nested classes work... sort of?

    - by SeanJA
    So, if you try to do a nested class like this: //nestedtest.php class nestedTest{ function test(){ class E extends Exception{} throw new E; } } You will get an error Fatal error: Class declarations may not be nested in [...] but if you have a class in a separate file like so: //nestedtest2.php class nestedTest2{ function test(){ include('e.php'); throw new E; } } //e.php class E Extends Exception{} So, why does the second hacky way of doing it work, but the non-hacky way of doing it does not work?

    Read the article

  • Fleunt NHibernate not working outside of nunit test fixtures

    - by thorkia
    Okay, here is my problem... I created a Data Layer using the RTM Fluent Nhibernate. My create session code looks like this: _session = Fluently.Configure(). Database(SQLiteConfiguration.Standard.UsingFile("Data.s3db")) .Mappings( m => { m.FluentMappings.AddFromAssemblyOf<ProductMap>(); m.FluentMappings.AddFromAssemblyOf<ProductLogMap>(); }) .ExposeConfiguration(BuildSchema) .BuildSessionFactory(); When I reference the module in a test project, then create a test fixture that looks something like this: [Test] public void CanAddProduct() { var product = new Product {Code = "9", Name = "Test 9"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); using (ISession session = OrmHelper.OpenSession()) { var fromDb = session.Get<Product>(product.Id); Assert.IsNotNull(fromDb); Assert.AreNotSame(fromDb, product); Assert.AreEqual(fromDb.Id, product.Id); } My tests pass. When I open up the created SQLite DB, the new Product with Code 9 is in it. the tables for Product and ProductLog are there. Now, when I create a new console application, and reference the same library, do something like this: Product product = new Product() {Code = "10", Name = "Hello"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); Console.WriteLine(product.Id); Console.ReadLine(); It doesn't work. I actually get pretty nasty exception chain. To save you lots of head aches, here is the summary: Top Level exception: An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail.\r\n\r\n The PotentialReasons collection is empty The Inner exception: The IDbCommand and IDbConnection implementation in the assembly System.Data.SQLite could not be found. Ensure that the assembly System.Data.SQLite is located in the application directory or in the Global Assembly Cache. If the assembly is in the GAC, use element in the application configuration file to specify the full name of the assembly. Both the unit test library and the console application reference the exact same version of System.Data.SQLite. Both projects have the exact same DLLs in the debug folder. I even tried copying SQLite DB the unit test library created into the debug directory of the console app, and removed the build schema lines and it still fails If anyone can help me figure out why this won't work outside of my unit tests it would be greatly appreciated. This crazy bug has me at a stand still.

    Read the article

  • UnknownHostException for server java

    - by nilesh
    I am not able to connect to an remote known server through Java code; the exception while connecting is java.net.NoRouteToHostException: No route to host. But strangely, I am able to connect to same server through ssh. Details: Simple Java client when tries to establish connection with Java standalone server, while conneting the exception occurs at following statement: Socket socket = new Socket(ServerIP ServerPort); The port needed is open on server so that externally request can come in. Again the following is returns false InetAddress.getByName(SERVER_IP).isReachable(1000) The Server is running on Fedora, Java 5. FYI: Java cannot resolve DNS address from AIX: UnknownHostException is almost same to my question, but somehow this is not AIX related; moreover I feel the issue to be more of Network or firewall issue. Please guide me.

    Read the article

  • Is it OK to open a DB4o file for query, insert, update multiple times?

    - by Khnle
    This is the way I am thinking of using DB4o. When I need to query, I would open the file, read and close: using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { List<Pilot> pilots = db.Query<Pilot>().ToList<Pilot>(); } finally { try { db.Close(); } catch (Exception) { }; } } At some later time, when I need to insert, then using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { Pilot pilot1 = new Pilot("Michael Schumacher", 100); db.Store(pilot1); } finally { try { db.Close(); } catch (Exception) { }; } } In this way, I thought I will keep the file more tidy by only having it open when needed, and have it closed most of the time. But I keep getting InvalidCastException Unable to cast object of type 'Db4objects.Db4o.Reflect.Generic.GenericObject' to type 'Pilot' What's the correct way to use DB4o?

    Read the article

  • Grails deploy on Tomcat6

    - by Jack
    Hello, while trying to deploy a Grails application into tomcat6 I ran into some problems: I used the grails war command to build up a war, then copied it to var/lib/tomcat6/webapps and tried to restart the container. I had to change default Tomcat policy to skip security exceptions, since I couldn't access environment variable (like grails.env), then tried again but it gives me an exception related to instantiating something, but it's not clear where should I try to fix the error, according to tomcat6 logs the problem is: SEVERE: Exception sending context initialized event to listener instance of class org.codehaus.groovy.grails.web.context.GrailsC$ org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'pluginManager' defined in ServletContext$ at java.lang.Thread.run(Thread.java:619) Caused by: org.codehaus.groovy.grails.exceptions.NewInstanceCreationException: Could not create a new instance of class [Hiberna$ ... 1 more Caused by: java.lang.NoClassDefFoundError: org.hibernate.cfg.Environment It seems like it's unable to load org.hibernate.cfg.Environment class. I checked the applicationContext.xml and it refers to grails.xml to search for plugins, in this last file I actually have HibernateGrailsPlugin. Where should I look to find if the plugin is present?

    Read the article

  • Can anybody help me out with this error.?

    - by kumar
    Error during serialization or deserialization using the JSON JavaScriptSerializer. The length of the string exceeds the value set on the maxJsonLength property. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.InvalidOperationException: Error during serialization or deserialization using the JSON JavaScriptSerializer. The length of the string exceeds the value set on the maxJsonLength property. in jquery gird on button click i am displaying something like 28000 rows? I know some of them are sujjested to define the JsonmaxLength in web config file.. but its not working for me? can anybody tell me about this? thanks

    Read the article

  • Mysql: ROLLBACK for multiple queries

    - by Raj
    Hi I have more than three MySql queiries in a PHP script triggered by scheduled task. If a query catch an error, script throw an exception and rollback that Mysql query. It works fine. However if first query works fine, but not 2nd query, throw an exception, it rollback 2nd one but not 1st query. I am using begin_trans(), commit and rollback() for individual queries because Sometimes i need to rollback one query, sometimes all queries. Is there any way to rollback one query or all queries? Thanks in advance UPDATE: I got it working, there was no problem with in begin_trans(), commit and rollback(), the database connection config was different for one query from other queries, crazy code without any comments!!!

    Read the article

  • help me "dry" out this .net XML serialization code

    - by Sarah Vessels
    I have a base collection class and a child collection class, each of which are serializable. In a test, I discovered that simply having the child class's ReadXml method call base.ReadXml resulted in an InvalidCastException later on. First, here's the class structure: Base Class // Collection of Row objects [Serializable] [XmlRoot("Rows")] public class Rows : IList<Row>, ICollection<Row>, IEnumerable<Row>, IEquatable<Rows>, IXmlSerializable { public Collection<Row> Collection { get; protected set; } public void ReadXml(XmlReader reader) { reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new Row(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } } Derived Class // Acts as a collection of SpecificRow objects, which inherit from Row. Uses the same // Collection<Row> that Rows defines which is fine since SpecificRow : Row. [Serializable] [XmlRoot("MySpecificRowList")] public class SpecificRows : Rows, IXmlSerializable { public new void ReadXml(XmlReader reader) { // Trying to just do base.ReadXml(reader) causes a cast exception later reader.ReadToFollowing(XmlNodeName); do { using (XmlReader rowReader = reader.ReadSubtree()) { var row = new SpecificRow(); row.ReadXml(rowReader); Collection.Add(row); } } while (reader.ReadToNextSibling(XmlNodeName)); } public new Row this[int index] { // The cast in this getter is what causes InvalidCastException if I try // to call base.ReadXml from this class's ReadXml get { return (Row)Collection[index]; } set { Collection[index] = value; } } } And here's the code that causes a runtime InvalidCastException if I do not use the version of ReadXml shown in SpecificRows above (i.e., I get the exception if I just call base.ReadXml from within SpecificRows.ReadXml): TextReader reader = new StringReader(serializedResultStr); SpecificRows deserializedResults = (SpecificRows)xs.Deserialize(reader); SpecificRow = deserializedResults[0]; // this throws InvalidCastException So, the code above all compiles and runs exception-free, but it bugs me that Rows.ReadXml and SpecificRows.ReadXml are essentially the same code. The value of XmlNodeName and the new Row()/new SpecificRow() are the differences. How would you suggest I extract out all the common functionality of both versions of ReadXml? Would it be silly to create some generic class just for one method? Sorry for the lengthy code samples, I just wanted to provide the reason I can't simply call base.ReadXml from within SpecificRows.

    Read the article

  • ASP.NET Connection time out after being idle for a while

    - by yazz
    My ASP.NET website while trying to connect to the database for first time after a period of inactivity throws an time out exception. I understand the connections in the connection pool get terminated after some idle time for some reason (Firewall or Oracle settings) and the pool or app doesn't have a clue about it. Is there any way to validate the connection beforehand so that the first try doesn't throw an exception? I don't have much control over the DB or Firewall settings. So I have to deal with this is my application.(would prefer if there is any web.config settings) I am using: ASP.NET 2.0. Oracle server 11g, Microsoft Enterprise Library DAAB to do all my DB operations. I did some search on this topic but didnt find any solid solution for this yet :(

    Read the article

  • Findbugs warning: Equals method should not assume anything about the type of its argument

    - by Uri
    When running FindBugs on my project, I got a few instances of the error described above. Namely, my overriding versions of equals cast the RHS object into the same type as the object in which the overriding version is defined. However, I'm not sure whether a better design is possible, since AFAIK Java does not allow variance in method parameters, so it is not possible to define any other type for the equals parameter. Am I doing something very wrong, or is FindBugs too eager? A different way to phrase this question is: what is the correct behavior if the object passed to equals is not the same type as an LHS: Is this a false, or should there be an exception? For example: public boolean equals(Object rhs) { MyType rhsMyType = (MyType)rhs; // Should throw exception if(this.field1().equals(rhsMyType.field1())... // Or whatever }

    Read the article

  • Can't Instantiate Windsor Custom Component Activator

    - by jeffn825
    Hi, I'm getting an exception calling Resolve: KernelException: Could not instantiate custom activator Inner Exception: {"Constructor on type 'MyProj.MyAdapter`1[[MyProj.MyBusinessObject, MyAsm, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null]]' not found."} There's definitely a public parameterless constructor there (and I've verified this using reflection at runtime)...so I figure the problem might have to do with the fact that it's generic? I've tried getting the component model object and setting RequiresGenericArguments to true, but that hasn't gotten me anywhere. Any help would be much appreciated! Thanks.

    Read the article

  • jQuery: Use of undefined constant data assumed 'data'

    - by morpheous
    I am trying to use jQuery to make a synchronous AJAX post to a server, and get a JSON response back. I want to set a javascript variable msg upon successful return This is what my code looks like: $(document).ready(function(){ $('#test').click(function(){ alert('called!'); jQuery.ajax({ async: false, type: 'POST', url: 'http://www.example.com', data: 'id1=1&id2=2,&id3=3', dataType: 'json', success: function(data){ msg = data.msg; }, error: function(xrq, status, et){alert('foobar\'d!');} }); }); [Edit] I was accidentally mixing PHP and Javascript in my previous xode (now corrected). However, I now get this even more cryptic error message: uncaught exception: [Exception... "Component returned failure code: 0x80070057 (NS_ERROR_ILLEGAL_VALUE) [nsIXMLHttpRequest.open]" nsresult: "0x80070057 (NS_ERROR_ILLEGAL_VALUE)" location: "JS frame :: http://ajax.googleapis.com/ajax/libs/jquery/1.3.2/jquery.min.js :: anonymous :: line 19" data: no] What the ... ?

    Read the article

  • Update MySQL table from jsp

    - by vishnu
    I have these in a jsp file. But these values are not updated in the mysql table. May be it is not commiting. How can i solve this ? String passc1 = request.getParameter("passc1"); String accid = request.getParameter("accid"); int i = 0; String sql = " update customertb " + " set passwd = ?" + " where acc_no = ?;"; try { PreparedStatement ps = con.prepareStatement(sql); ps.setString(1, passc1); ps.setString(2, accid); i = ps.executeUpdate(); } catch (Exception e) { // do something with Exception here. Maybe just throw it up again } finally { con.close(); }

    Read the article

  • Issues with LINQ (to Entity) [adding records]

    - by Mario
    I am using LINQ to Entity in a project, where I pull a bunch of data (from the database) and organize it into a bunch of objects and save those to the database. I have not had problems writing to the db before using LINQ to Entity, but I have run into a snag with this particular one. Here's the error I get (this is the "InnerException", the exception itself is useless!): New transaction is not allowed because there are other threads running in the session. I have seen that before, when I was trying to save my changes inside a loop. In this case, the loop finishes, and it tries to make that call, only to give me the exception. Here's the current code: try { //finalResult is a list of the keys to match on for the records being pulled foreach (int i in finalResult) { var queryEff = (from eff in dbMRI.MemberEligibility where eff.Member_Key == i && eff.EffDate >= DateTime.Now select eff.EffDate).Min(); if (queryEff != null) { //Add a record to the Process table Process prRecord = new Process(); prRecord.GroupData = qa; prRecord.Member_Key = i; prRecord.ProcessDate = DateTime.Now; prRecord.RecordType = "F"; prRecord.UsernameMarkedBy = "Autocard"; prRecord.GroupsId = qa.GroupsID; prRecord.Quantity = 2; prRecord.EffectiveDate = queryEff; dbMRI.AddObject("Process", prRecord); } } dbMRI.SaveChanges(); //<-- Crashes here foreach (int i in finalResult) { var queryProc = from pro in dbMRI.Process where pro.Member_Key == i && pro.UsernameMarkedBy == "Autocard" select pro; foreach (var qp in queryProc) { Audit aud = new Audit(); aud.Member_Key = i; aud.ProcessId = qp.ProcessId; aud.MarkDate = DateTime.Now; aud.MarkedByUsername = "Autocard"; aud.GroupData = qa; dbMRI.AddObject("Audit", aud); } } dbMRI.SaveChanges(); //<-- AND here (if the first one is commented out) } catch (Exception e) { //Do Something here } Basically, I need it to insert a record, get the identity for that inserted record and insert a record into another table with the identity from the first record. Given some other constraints, it is not possible to create a FK relationship between the two (I've tried, but some other parts of the app won't allow it, AND my DBA team for whatever reason hates FK's, but that's for a different topic :)) Any ideas what might be causing this? Thank!

    Read the article

  • Opening a Silverlight project causes APPCRASH is Visual Studio 2008

    - by Ed Woodcock
    Hi guys I've got to add a Silverlight project to a solution for a deployment procedure (it's a pre-build dependency for the main project). I've installed Silverlight tools v3, silverlight itself and the silverlight sdk 3, and am using Visual Studio 2008 with ReSharper and the DevArt oracle database tools. Every time I go to open the relevant silverlight .csproj file VS crashes with the following error message: Problem Event Name: APPCRASH Application Name: devenv.exe Application Version: 9.0.30729.1 Application Timestamp: 488f2b50 Fault Module Name: StackHash_20af Fault Module Version: 6.0.6001.18000 Fault Module Timestamp: 4791a7a6 Exception Code: c0000374 Exception Offset: 000b015d This also happens if I try to create a new silverlight project from scratch. Does anyone have any suggestions?

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >