Search Results

Search found 9058 results on 363 pages for 'length'.

Page 166/363 | < Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >

  • JS and Jquery problem

    - by Sonny
    hi i got the problem the script.js gives me <div id="gracze"> <div id="10" class="char" style="z-index: 19; top: 592px; left: 608px; "></div> <div id="14" class="char" style="z-index: 25; top: 784px; left: 608px; "></div> </div> instead <div id="gracze"> <div id="4" class="char" ... ></div> <div id="10" class="char" style="z-index: 19; top: 592px; left: 608px; "></div> <div id="14" class="char" style="z-index: 25; top: 784px; left: 608px; "></div> </div> get_players.php 4/62/6 10/19/19 14/19/25 script.js function get_players() { $.ajax({ type: "POST", url: "get_players.php", dataType: "html", success: function(data) { var str = data; var chars = str.split("<br />"); var lol = chars.length; for(var i = lol; i--; ) { chars[i] = chars[i].split('/'); var o = document.getElementById(chars[i][0]); var aimt = i; if (!o) { if (aimt!=chars.length-1 && aimt != 0) { $('#gracze').html('<div id="'+chars[aimt][0]+'" class="char"></div>'+$('#gracze').html()); $('#'+chars[aimt][0]).css("top", chars[aimt][2]*32-16+"px"); $('#'+chars[aimt][0]).css("left", chars[aimt][1]*32+"px"); $('#'+chars[aimt][0]).css("z-index", chars[aimt][1]*32); } } else { $('#'+chars[aimt][0]).animate({ "top": chars[aimt][2]*32-16+"px", "left": chars[aimt][1]*32+"px" }, { duration: 275}); //$('#'+chars[aimt][0]).css("top", chars[aimt][1]*32-16+"px"); //$('#'+chars[aimt][0]).css("left", chars[aimt][2]*32+"px"); $('#'+chars[aimt][0]).css("z-index", chars[aimt][2]); } } }}); setTimeout("get_players();", 1000); } I think it's because of for(var i = lol; i--; ) {

    Read the article

  • How to find same-value rectangular areas of a given size in a matrix most efficiently?

    - by neo
    My problem is very simple but I haven't found an efficient implementation yet. Suppose there is a matrix A like this: 0 0 0 0 0 0 0 4 4 2 2 2 0 0 4 4 2 2 2 0 0 0 0 2 2 2 1 1 0 0 0 0 0 1 1 Now I want to find all starting positions of rectangular areas in this matrix which have a given size. An area is a subset of A where all numbers are the same. Let's say width=2 and height=3. There are 3 areas which have this size: 2 2 2 2 0 0 2 2 2 2 0 0 2 2 2 2 0 0 The result of the function call would be a list of starting positions (x,y starting with 0) of those areas. List((2,1),(3,1),(5,0)) The following is my current implementation. "Areas" are called "surfaces" here. case class Dimension2D(width: Int, height: Int) case class Position2D(x: Int, y: Int) def findFlatSurfaces(matrix: Array[Array[Int]], surfaceSize: Dimension2D): List[Position2D] = { val matrixWidth = matrix.length val matrixHeight = matrix(0).length var resultPositions: List[Position2D] = Nil for (y <- 0 to matrixHeight - surfaceSize.height) { var x = 0 while (x <= matrixWidth - surfaceSize.width) { val topLeft = matrix(x)(y) val topRight = matrix(x + surfaceSize.width - 1)(y) val bottomLeft = matrix(x)(y + surfaceSize.height - 1) val bottomRight = matrix(x + surfaceSize.width - 1)(y + surfaceSize.height - 1) // investigate further if corners are equal if (topLeft == bottomLeft && topLeft == topRight && topLeft == bottomRight) { breakable { for (sx <- x until x + surfaceSize.width; sy <- y until y + surfaceSize.height) { if (matrix(sx)(sy) != topLeft) { x = if (x == sx) sx + 1 else sx break } } // found one! resultPositions ::= Position2D(x, y) x += 1 } } else if (topRight != bottomRight) { // can skip x a bit as there won't be a valid match in current row in this area x += surfaceSize.width } else { x += 1 } } } return resultPositions } I already tried to include some optimizations in it but I am sure that there are far better solutions. Is there a matlab function existing for it which I could port? I'm also wondering whether this problem has its own name as I didn't exactly know what to google for. Thanks for thinking about it! I'm excited to see your proposals or solutions :)

    Read the article

  • c# Delegate and Dispatcher problem

    - by Tan
    Hi i get this error when trying this ERROR method name expected. How should i do to correct the problem thanks for help delegate void DelegateFillList(DeliveryDoc[] deliveryDocs); private void FillListViewAssignment(DeliveryDoc[] docs) { if(lvMyAssignments.Dispatcher.CheckAccess()) { lvMyAssignments.ItemsSource = docs; lvAllOngoingAssignments.ItemsSource = docs; if(m_tempDeliveryDocs != null) { txtblockHandOverCount.Text = m_tempDeliveryDocs.Length.ToString(); } } else { lvMyAssignments.Dispatcher.BeginInvoke(new DelegateFillList(FillListViewAssignment(docs)), null); } }

    Read the article

  • Java: most efficient way to defensively copy an int[]?

    - by Jason S
    I have an interface DataSeries with a method int[] getRawData(); For various reasons (primarily because I'm using this with MATLAB, and MATLAB handles int[] well) I need to return an array rather than a List. I don't want my implementing classes to return the int[] array because it is mutable. What is the most efficient way to copy an int[] array (sizes in the 1000-1000000 length range) ? Is it clone()?

    Read the article

  • Question on jpa joined table inheritance

    - by soontobeared
    Hi, The 'DiscriminatorColumn' annotation isn't creating any column in my parent entity. Where am I going wrong ? Here's my code @Entity @Inheritance(strategy=InheritanceType.JOINED) @DiscriminatorColumn(name="TYPE", discriminatorType=DiscriminatorType.STRING,length=20) public class WorkUnit extends BaseEntityClass implements Serializable{ @Entity @DiscriminatorValue(value="G") @Table(name="Group_") @PrimaryKeyJoinColumn public class Group extends WorkUnit implements Serializable{

    Read the article

  • Can't get jQuery to get focus on cloned input fields

    - by Rebel1Moon
    I have a page that needs to create dynamic form fields as often as the user needs, and I am trying to use Ajax to tie it in to my database for faster form entry and to prevent user typos. So, I have put my Ajax returned data into popup div, the user selects, then the form field is filled in. The problem comes on the cloned fields. They don't seem to want to bring up the popup div when focused. I am thinking it is something to do with when they get created/added to the DOM. Here is my JS that creates the clones: $(document).ready(function() { var regex = /^(.*)(\d)+$/i; var cloneIndex = $(".clonedInput").length; $("button.clone").live("click", function(){ $(this).parents(".clonedInput").clone() .appendTo("#course_container") .attr("id", "clonedInput" + cloneIndex) .find("*").each(function() { var id = this.id || ""; var match = id.match(regex) || []; if (match.length == 3) { this.id = match[1] + (cloneIndex); } }); cloneIndex++; numClones=cloneIndex-1; //alert("numClones "+numClones); }); Here is where I expect to be able to get focus on the correct cloned field and call the popup. The baker_equiv0 id is original code, whereas baker_equiv1 is the first clone. $('#baker_equiv0').focus(function() { \\ THIS CODE WORKS $('.popup').fadeIn(500); $('#results').empty(); // document.enter_data.baker_equiv1.value="test"; THIS LINE WORKS //alert("numClones "+numClones); }); $('#baker_equiv1').focus(function() { // THIS DOESN'T EVER FIRE alert("numClones "+numClones); $('.popup').fadeIn(500); $('#results').empty(); }); Here is the HTML with the form: <label for="baker_equiv" class="">Baker Equivalent: <span class="requiredField">*</span></label> <input type="text" class="cinputsa" name="baker_equiv[]" id="baker_equiv0" size="8" ONKEYUP="get_equiv(this.value);"> If I put this in the HTML code above, it works fine: onfocus="alert(this.id)" I'd also be interested in how to adjust the JS code to work based on the id array created rather than having to copy code for each potential set of fields clones, i.e., baker_equiv[] rather than baker_equiv0, baker_equiv1, etc. Thanks all!

    Read the article

  • What's the simplest way to extract the last section of an IP address?

    - by Jon Cage
    I have an IP address which I want to grab the last chunk of as an integer. So from "192.168.1.150" I'd get 150. This is the code I'd concocted (I'm using C++/CLI), but somehow it feels rather clunky: String^ ipString = "192.168.1.150"; int lastDot = ipString->LastIndexOf('.'); int lastSection = int::Parse(ipString->Substring(lastDot, ipString->Length-lastDot)); Is there a simpler way of doing this?

    Read the article

  • Ajax gets nothing back from the php.

    - by ShaMun
    Jquery i dont have alert and firefox i dont have anything in return. The code was working before, database query have successfull records also. What i am missing??? Jquery ajax. $.ajax({ type : "POST", url : "include/add_edit_del.php?model=teksten_display", data : "oper=search&ids=" + _id , dataType: "json", success : function(msg){ alert(msg); } }); PHP case 'teksten_display': $id = $_REQUEST['ids']; $res = $_dclass-_query_sql( "select a,b,id,wat,c,d from tb1 where id='" . $id . "'" ); $_rows = array(); while ( $rows = mysql_fetch_array ($res) ) { $_rows = $rows; } //header('Cache-Control: no-cache, must-revalidate'); //header('Expires: Mon, 26 Jul 1997 05:00:00 GMT'); header('Content-type: application/json'); echo utf8_encode( json_encode($_rows) ) ; //echo json_encode($_rows); //var_dump($_rows); //print_r ($res); break; Firefox response/request header Date Sat, 24 Apr 2010 22:34:55 GMT Server Apache/2.2.3 (CentOS) X-Powered-By PHP/5.1.6 Expires Thu, 19 Nov 1981 08:52:00 GMT Cache-Control no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma no-cache Content-Length 0 Connection close Content-Type application/json Host www.xxxx.be User-Agent Mozilla/5.0 (X11; U; Linux i686; en-US; rv:1.9.1.9) Gecko/20100330 Fedora/3.5.9-2.fc12 Firefox/3.5.9 Accept application/json, text/javascript, */* Accept-Language en-us,en;q=0.5 Accept-Encoding gzip,deflate Accept-Charset ISO-8859-1,utf-8;q=0.7,*;q=0.7 Keep-Alive 300 Connection keep-alive Content-Type application/x-www-form-urlencoded; charset=UTF-8 X-Requested-With XMLHttpRequest Referer http://www.xxxx.be/xxxxx Content-Length 17 Cookie csdb=2; codb=5; csdbb=1; codca=1.4; csdca=3; PHPSESSID=benunvkpecqh3pmd8oep5b55t7; CAKEPHP=3t7hrlc89emvg1hfsc45gs2bl2

    Read the article

  • How can I make Google Maps icon to always appear in the center of map - when clicked?

    - by JHM_67
    For simplicity sake, lets use the XML example on Econym's site. http://econym.org.uk/gmap/example_map3.htm Once clicked, I would like icon balloon to be displayed in the middle of the map. What might I need to add to Mike's code to get this to work? I apologize for asking a lot.. Thanks in advance. <script type="text/javascript"> //<![CDATA[ if (GBrowserIsCompatible()) { side_bar var side_bar_html = ""; var gmarkers = []; function createMarker(point,name,html) { var marker = new GMarker(point); GEvent.addListener(marker, "click", function() { marker.openInfoWindowHtml(html); }); gmarkers.push(marker); side_bar_html += '<a href="javascript:myclick(' + (gmarkers.length-1) + ')">' + name + '<\/a><br>'; return marker; } function myclick(i) { GEvent.trigger(gmarkers[i], "click"); } var map = new GMap2(document.getElementById("map")); map.addControl(new GLargeMapControl()); map.addControl(new GMapTypeControl()); map.setCenter(new GLatLng( 43.907787,-79.359741), 9); GDownloadUrl("example.xml", function(doc) { var xmlDoc = GXml.parse(doc); var markers = xmlDoc.documentElement.getElementsByTagName("marker"); for (var i = 0; i < markers.length; i++) { // obtain the attribues of each marker var lat = parseFloat(markers[i].getAttribute("lat")); var lng = parseFloat(markers[i].getAttribute("lng")); var point = new GLatLng(lat,lng); var html = markers[i].getAttribute("html"); var label = markers[i].getAttribute("label"); var marker = createMarker(point,label,html); map.addOverlay(marker); } document.getElementById("side_bar").innerHTML = side_bar_html; }); } else { alert("Sorry, the Google Maps API is not compatible with this browser"); } //]]> </script>

    Read the article

  • JavaFx MediaPlayer via HTTPS

    - by LMA
    I'm trying to make applet-videoplayer, that takes video files from PHP script via https. If source of data is httpS ://domain.com/1.flv - it works httpS ://domain.com/view.php - it doesn't work HTTP ://domain.com/view.php - it works again. In php I make HTTP header, that contains Content-type: video/x-flv Last-Modified: Wed, 14 Apr 2010 14:04:34 GMT Accept-Ranges: bytes Content-Length: 24693477 What else should I add in header to make it work? If I use not mediaPlayer, but MediaBox from samples, it writes "Loading", and keeps "rolling" locading image

    Read the article

  • 1) PasswordResets emails user when requesting password reset

    - by Surge Pedroza
    I've been trying to add a password reset for users that forget their password. The users clicks on forgot password? on sign up page. Then the user types their email and clicks reset password, which creates a token and sends an email with a link to reset their password. For the most part, it was working well, and then it suddenly stopped working. When a user clicks password reset, it brings up the error message: Password cant be blank, password is too short(6 min) Ran into this error in video 275 How I Test. on 11:20 Failure/Error: click_button "Reset Password" ActiveRecord::RecordInvalid: Validation failed: Password can't be blank, Password is too short (minimum is 6 characters), Password confirmation can't be blank # ./app/models/user.rb:30:in send_password_reset' # ./app/controllers/password_resets_controller.rb:7:increate' # (eval):2:in click_button' # ./spec/requests/password_resets_spec.rb:9:inblock (2 levels) in ' Finished in 13.66 seconds 95 examples, 1 failure This is some of the code being used. user.rb # == Schema Information # # Table name: users # # id :integer not null, primary key # name :string(255) # email :string(255) # created_at :datetime not null # updated_at :datetime not null # class User < ActiveRecord::Base attr_accessible :name, :email, :password, :password_confirmation has_secure_password before_save { |user| user.email = email.downcase } before_save :create_remember_token validates :name, presence: true, length: { maximum: 50 } VALID_EMAIL_REGEX = /\A[\w+\-.]+@[a-z\d\-.]+\.[a-z]+\z/i validates :email, presence: true, format: { with: VALID_EMAIL_REGEX }, uniqueness: { case_sensitive: false } validates :password, presence: true, length: { minimum: 6 } validates :password_confirmation, presence: true def send_password_reset generate_token(:password_reset_token) self.password_reset_sent_at = Time.zone.now save! UserMailer.password_reset(self).deliver end def generate_token(column) begin self[column] = SecureRandom.urlsafe_base64 end while User.exists?(column => self[column]) end def self.search(search) if search find(:all, :conditions => ['name LIKE ?', "%#{search}%"]) else find(:all) end end private def create_remember_token self.remember_token = SecureRandom.urlsafe_base64 end end password_resets_controller.rb class PasswordResetsController < ApplicationController def new end def create user = User.find_by_email(params[:email]) user.send_password_reset redirect_to root_url, :notice => "Email sent with password reset instructions." end def edit @user = User.find_by_password_reset_token!(params[:id]) end end new.html.erb <h1>Reset Password</h1> <%= form_tag password_resets_path, :method => :post do %> <div class="field"> <%= label_tag :email %> <%= text_field_tag :email, params[:email] %> </div> <div class="actions"><%= submit_tag "Reset Password" %></div> <% end %>

    Read the article

  • HTML format using Java mail in android

    - by TheDevMan
    I am trying to implement an HTML format mail using the Java mail in android. I would like to get results like this: When I look at the html format sent from lookout in my GMAIL. I don't see any link, but just has this format: [image: Lookout_logo] [image: Signal_flare_icon] Your battery level is really low, so we located your device with Signal Flare. I was trying the following: Properties props = System.getProperties(); props.put("mail.smtp.starttls.enable", "true"); // added this line props.put("mail.smtp.host", host); props.put("mail.smtp.user", from); props.put("mail.smtp.password", pass); props.put("mail.smtp.port", "587"); props.put("mail.smtp.auth", "true"); javax.mail.Session session = javax.mail.Session.getDefaultInstance(props, null); MimeMessage message = new MimeMessage(session); message.setFrom(new InternetAddress(from)); InternetAddress[] toAddress = new InternetAddress[to.length]; // To get the array of addresses for( int i=0; i < to.length; i++ ) { // changed from a while loop toAddress[i] = new InternetAddress(to[i]); } message.setRecipients(Message.RecipientType.BCC, toAddress); message.setSubject(sub); //message.setText(body); body = "<!DOCTYPE html><html><body><img src=\"http://en.wikipedia.org/wiki/Krka_National_Park#mediaviewer/File:Krk_waterfalls.jpg\">"; message.setContent(body, "text/html; charset=utf-8"); Transport transport = session.getTransport("smtp"); transport.connect(host, from, pass); transport.sendMessage(message, message.getAllRecipients()); transport.close(); When I look at the html format sent with the above code. I get the following: <!DOCTYPE html><html><body><img src="http://en.wikipedia.org/wiki/Krka_National_Park#mediaviewer/File:Krk_waterfalls.jpg> How to make sure the user will not be able to see any html code or URL link like the mail sent by LOOKOUT? Thanks!

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Deleting document attachments in CouchDb

    - by henrik_lundgren
    In CouchDb's documentation, the described method of deleting document attachments is to send a DELETE call to the attachment's url. However, I have noticed that if you edit the document and remove the attachment stub from the _attachment field, it will not be accessible anymore. If i remove foo.txt from the document below and save to CouchDb it will be gone the next time I access the document: { "_id":"attachment_doc", "_rev":1589456116, "_attachments": { "foo.txt": { "stub":true, "content_type":"text/plain", "length":29 } } } Is the attachment actually deleted on disk or is just the reference to it deleted?

    Read the article

  • Arguments to JavaScript Anonymous Function

    - by Phonethics
    for (var i = 0; i < somearray.length; i++) { myclass.foo({'arg1':somearray[i][0]}, function() { console.log(somearray[i][0]); }); } How do I pass somearray or one of its indexes into the anonymous function ? somearray is already in the global scope, but I still get somearray[i] is undefined

    Read the article

  • Extract dates from filename(C#3.0)

    - by Newbie
    I have a situation where I need to extract dates from the file names whose general pattern is [filename_]YYYYMMDD[.fileExtension] e.g. "xxx_20100326.xls" or x2v_20100326.csv The below program does the work //Number of charecter in the substring is set to 8 //since the length of YYYYMMDD is 8 public static string ExtractDatesFromFileNames(string fileName) { return fileName.Substring(fileName.IndexOf("_") + 1, 8); } Is there any better option of achieving the same? I am basically looking for standard practice. I am using C#3.0 and dotnet framework 3.5 Thanks

    Read the article

  • Weird constants

    - by Quassnoi
    I've seen these in real code: #define SCREEN_DIMENSIONS 2 #define THREE_THOUSAND_FIVE_HUNDRED_TWENTY_TWO 3522 What is the weirdest constant you've ever seen? P. S. And of course my favorite in JScript: bool b; switch (b.ToString().length) { case 4: // true ... break; case 5: // false ... break; )

    Read the article

  • string and z-depth animation, as3

    - by VideoDnd
    How do I pass this string to my children? formatCount(fcount) is the value I'm trying to pass to children timer is the value the children are recieving now Timer that loops through an array of displayObjects var timer:Timer = new Timer(100); var count:int = 0; var fcount:int = 0; timer.addEventListener(TimerEvent.TIMER, countdown); function countdown(event:TimerEvent) { count++; fcount=int(count*count/1000); //myText.text = formatCount(fcount); //LOOPS THROUGH MY LIST ITEMS 'see array at bottom' var currentFrame:int = timer.currentCount % frames.length; for (var i:int = 0; i < frames.length; ++i) { frames[i].visible = (i == currentFrame); } } timer.start(); //SUBSTRING AND ZERO PLACEHOLDER function formatCount(i:int):String { var fraction:int = i % 100; var whole:int = i / 100; return ("0000000" + whole).substr(-7, 7) + "." + (fraction < 10 ? "0" + fraction : fraction); } //PASS MATH TO SPRITE HANDLER function spriteHandler(e:Event):void { numbers.setTime(formatCount(fcount)); } //LOST ARGUMENT==>GOES TO NUMBERSVIEW //var numbers:NumbersView; var numbers:*; //MY ARRAY 'list of numbers, one-to-zero' var frames:Array = [new Frame1(),new Frame2(),new Frame3(), new Frame4(),new Frame5(),new Frame6(),new Frame7(),new Frame8(),new Frame9(), new Frame0()]; for each (var frame:Sprite in frames) { addChild(frame); } Example of NumbersView 'increment and place display objects across the stage' function NumbersView() { _listItems = new Array(); previousNums = new Array(); var item:NumberImage; for (var i:Number = 0; i <= 9; i++) { item = new NumberImage(); addChild(item); item.x = i * item.width; _listItems.push(item); } }

    Read the article

  • Xml with spaces as InnerText

    - by David Rutten
    I'm parsing Xml data which has entries like this: <item name="UserText" type_name="gh_string" type_code="10"> </item> I'm supposed to read the 6 spaces as a String, but both the InnerText and InnerXml values of the System.Xml.XmlNode are zero length Strings. Is there any way I can get at this whitespace data in existing files and what do I need to do in the future to prevent this sort of screw up?

    Read the article

  • Why the generated key size is not constant?

    - by Tom Brito
    The following code prints randomly 634, 635, 636, each time I run it. Why its not constant? public static void main(String[] args) throws Exception { KeyPairGenerator keyPairGen = KeyPairGenerator.getInstance("RSA", "BC"); keyPairGen.initialize(1024); RsaKeyPair keyPair = new RsaKeyPair(keyPairGen.generateKeyPair()); System.out.println(keyPair.getPrivate().getEncoded().length); }

    Read the article

< Previous Page | 162 163 164 165 166 167 168 169 170 171 172 173  | Next Page >