Search Results

Search found 14689 results on 588 pages for 'executable format'.

Page 169/588 | < Previous Page | 165 166 167 168 169 170 171 172 173 174 175 176  | Next Page >

  • Unreachable code detected by using const variables

    - by Anton Roth
    I have following code: private const FlyCapture2Managed.PixelFormat f7PF = FlyCapture2Managed.PixelFormat.PixelFormatMono16; public PGRCamera(ExamForm input, bool red, int flags, int drawWidth, int drawHeight) { if (f7PF == FlyCapture2Managed.PixelFormat.PixelFormatMono8) { bpp = 8; // unreachable warning } else if (f7PF == FlyCapture2Managed.PixelFormat.PixelFormatMono16){ bpp = 16; } else { MessageBox.Show("Camera misconfigured"); // unreachable warning } } I understand that this code is unreachable, but I don't want that message to appear, since it's a configuration on compilation which just needs a change in the constant to test different settings, and the bits per pixel (bpp) change depending on the pixel format. Is there a good way to have just one variable being constant, deriving the other from it, but not resulting in an unreachable code warning? Note that I need both values, on start of the camera it needs to be configured to the proper Pixel Format, and my image understanding code needs to know how many bits the image is in. So, is there a good workaround, or do I just live with this warning?

    Read the article

  • Webservice won't accept JSON requests

    - by V-Man
    Hi, The main issue is that I cannot run a webservice that accepts requests in JSON format. I keep getting a 500 Server error stating that the "request format is invalid." My ASP.NET AJAX extensions are installed. My server is running Plesk Control Panel 8.6 which is undoubtedly causing these problems. The default handler for this specified extension is shown in the web.config like so: For my applications webservice to handle JSON it needs to have this reference: <add name="ScriptHandlerFactory" verb="*" path="*.asmx" preCondition="integratedMode" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> Plesk is not allowing the request to be handled properly. I need to know the correct http directive(s) to put into the web.config to properly handle JSON webservices. I tried posting to the Plesk forum two days ago but no response yet. Any insight would be great =)

    Read the article

  • Drupal filter_form form input

    - by ernie
    This drupal form snippet will give me a textarea with user able to change filter to full html/wysiwyg mode. My Questions: How can I default to to full html mode? function MY_MODULE_admin() { $form = array(); $form['format'] = filter_form($form->format); // MY_MODULE - ** Image 1 ** $form['MY_MODULE_image_1'] = array( '#type' => 'textarea', '#title' => t('Image 1'), '#default_value' => variable_get('setup_image_1', 'image_1.jpg'), '#description' => "Current value =" .variable_get('setup_image_1', 'image_1.jpg'), '#required' => TRUE, );

    Read the article

  • How to escape simple SQL queries in C# for SqlServer

    - by sri
    I use an API that expects a SQL string. I take a user input, escape it and pass it along to the API. The user input is quiet simple. It asks for column values. Like so: string name = userInput.Value; Then I construct a SQL query: string sql = string.Format("SELECT * FROM SOME_TABLE WHERE Name = '{0}'", name.replace("'", "''")); Is this safe enough? If it isn't, is there a simple library function that make column values safe: string sql = string.Format("SELECT * FROM SOME_TABLE WHERE Name = '{0}'", SqlSafeColumnValue(name)); The API uses SQLServer as the database. Thanks.

    Read the article

  • mySql table returning JSON that needs formatting for a iPhone UITableview

    - by Michael Robinson
    I have a php query the returns the following JSON format from a table. [{"memberid":"18", "useridFK":"30", "loginName":"Johnson", "name":"Frank", "age":"23", "place":"School", }, It needs the following format: [{"memberid":"18" { "useridFK":"30", "loginName":"Johnson", "name":"Frank", "age":"23", "place":"School",} }, I can figure out where/how to convert this, Where would I create the formatting following: (1) In the php return? (2) the JSON instructions for deserialization? or (3) Some kinb of Obj-C coding instruction? My end use is a simple Drill Down table using the NSObject, so when I select "memberid" row, I'll get the child/detail list on the next UITableview. My Data.plist will look like the following: Root: Dictionary V Rows: Array V Item 0: Dictionary Title: String 18 V Children Array V Item 0 Dictionary Title String 30 etc. Thanks in advance, this site rocks.

    Read the article

  • Exporting SQL Server table to CSV issue commas, tabs and quotes

    - by cyberpine
    After we export to flat file CSV, columns with commas, quotes and tabs cause problems in Excel. The vendor needs to read the file in Excel to make manual changes and then needs it in a flat file format CSV format to load using PL/SQL into an Oracle table. I can remove those characters from the table in SQL Server, but is there a smarter way? Does it make sense to save to CSV when done in Excel and will that cause problems when attempting to load the file into Oracle anyway? Also, we need the first row to have column names.. any SQL way to generate all the files in one swoop (the the tiles in the first row) rather than using export to flat file?

    Read the article

  • How to do client callback for each item in a foreach statement using c#?

    - by Mike108
    I want to show each item Id that is doing now dynamically in a foreach statement. How to do some kind of client callback to show the item Id in a foreach statement? <asp:Label ID="Label1" runat="server" Text="Label"></asp:Label> <asp:Button ID="Button1" runat="server" onclick="Button1_Click" Text="Button" /> . protected void Button1_Click(object sender, EventArgs e) { List<int> list = new List<int>() { 1,2,3,4,5 }; foreach (var item in list) { Label1.Text = string.Format("I'm doing item {0} now.", item.ToString()); Page.RegisterStartupScript("", string.Format("<script>alert('doing item {0} now')</script>", item.ToString())); Thread.Sleep(1 * 1000); } }

    Read the article

  • Can I use ANTLR for both two-way parsing/generating?

    - by Mike Q
    Hi all, I need to both parse incoming messages and generate outgoing messages in EDIFACT format (basically a structured delimited format). I would like to have a Java model that will be generated by parsing a message. Then I would like to use the same model to create an instance and generate a message. The first half is fine, I've used ANTLR before to go from raw - Java objects. But I've never done the reverse, or if I have it's been custom. Does ANTLR support generating using a grammar or is it really just a parse-only tool?

    Read the article

  • Direct3D 11 effect files deprecated?

    - by Toji
    I've been playing around with Direct3D 11 a little bit lately and have been frustrated by the lack of documentation on the basics of the API (such as simple geometry rendering). One of the points of confusion brought on by the sparse documentation is the (apparent) move away from the use of effects for shaders. In D3D11 all of the effect (.fx) support has been removed from the D3DX libraries and buried away in a hard to find (sparsely documented, of course) shared source library. None of the included examples use it, preferring instead to compile HLSL files directly. All of this says to me that Microsoft is trying to get people to stop using the effect file format. Is that true? Is there any documentation of any kind that states that? I'm fine doing it either way, but for years now they've been promoting the .fx format so it seems odd that they would suddenly decide to drop it.

    Read the article

  • How to have localized style when writing cell with xlwt

    - by lfagundes
    I'm writing an Excel spreadsheet with Python's xlwt and I need numbers to be formatted using "." as thousands separator, as it is in brazilian portuguese language. I have tried: style.num_format_str = r'#,##0' And it sets the thousands separator as ','. If I try setting num_format_str to '#.##0', I'll get number formatted as 1234.000 instead of 1.234. And if I open document in OpenOffice and format cells, I can set the language of the cell to "Portuguese (Brazil)" and then OpenOffice will show the format code as being "#.##0", but I don't find a way to set the cell's language to brazilian portuguese. Any ideas?

    Read the article

  • Manipulating pixels using only toDataURL

    - by Chris
    The problem I have is this: I need to be able to dynamically tint an image using Javascript, but I cannot access pixel data via the canvas. I can, however, store the dataURL (or any other text-based data format) and include that with the code, manipulate that data, and then create an image object using that dataURL. My question is, how can I access the RGBA value of each pixel, given only the dataURL. I assume I need to decode the base64 url, but into what format in order to manipulate on the pixel level? And then would be it be as trivial as re-encoding it as base64, slapping it in a url, and the passing to an image? Thanks.

    Read the article

  • Win7 finding location of installed program

    - by JubJub
    Usually on windows XP if I wanted to know the location of an installed program I would just click 'Properties' and it would show where the executable is located. On windows 7 I do the same thing and I get this: How can I find out where programs are located based on the shortcut? I did however notice that for some programs it does show a shortcut under the 'Target', but not in the case with iTunes for example.

    Read the article

  • How to conditionally execute a jquery validation?

    - by Pandiya Chendur
    I am validating form using jquery validation plugin...... rules: { Name: "required", MobileNo: { required: true, minlength: 10, remote: '<%=Url.Action("getClientMobNo", "Clients") %>' }, Address: "required" }, messages: { Name: "please provide a client name", MobileNo: { required: "Please provide a mobile phone no", rangelength: jQuery.format("Enter at least {0} characters"), remote: jQuery.format("This MobileNo is already in use") }, Address: "please provide client address" }, This works pretty well on add form validation but i use the same form for edit here they can use the same mobile no,but my plugin validates that mobileno saying there is already a mobileno... But how to execute remote attribute based on a condition, MobileNo: { required: true, minlength: 10, if($("#HfId").val() == ""){ remote: '<%=Url.Action("getClientMobNo", "Clients") %>' } }, Is this a valid jquery conditional validation statement.... How to skip remote attribute based on a condition....

    Read the article

  • transition of x-axis results in overflow

    - by peter
    First of all, no: this question is not about the (yet) ugly transition of the lines (I might open another one for that, though..). I'm displaying data in line charts and the user can select the time horizon. The x-axis then correspondingly transitions so as to fit to the changed time horizon. In attached image, e.g., the time horizon was 1 week and then I switched to 4 weeks. The number of ticks on the x-axis increases from 7 to 28, correspondingly. Question: How can I prevent the x-axis animation to display outside the svg container? As you can see, the additional dates fly in from the left and they are being animated far far outside the container. Any ideas? Right now, the transition works probably in the most simple way it could: // format for x-axis var xAxis = d3.svg.axis() .scale(x) .orient("bottom") .tickFormat(d3.time.format("%d.%m")) .ticks(d3.time.days, 1) .tickSubdivide(0); // Update x-axis svg.select(".x") .transition() .duration(500) .call(xAxis);

    Read the article

  • How to make Date locale-independent? (GMT timezone newbie question)

    - by folone
    I have a db, that stores dates in OleDateTime format, in GMT timezone. I've implemented a class, extending Date in java to represent that in classic date format. But my class is locale-dependent (I'm in GMT+2). Therefore, it converts the date in the db as date - 2 hours. How do I make it convert the date correctly? I want my class to be locale-independent, always using GMT timezone. Actually, the question is: class MyOleDateTime extends Date { static { Locale.setDefault(WhatGoesHere?) } // ... some constructors // ... some methods }

    Read the article

  • Android PixelFormat per device

    - by Tobias Domhan
    analogous to this thread: stackoverflow.com/questions/2093594/opengl-extensions-available-on-different-android-devices I would like to collect the different PixelFormats the android devices use. To find out you must do the following: Parameters camParams = camera.getParameters(); int format = camParams.getPreviewFormat(); Now you got to find the number in the following list: developer.android.com/reference/android/graphics/PixelFormat.html#A_8 How to generally open the camera is described here: developer.android.com/resources/samples/ApiDemos/src/com/example/android/apis/graphics/CameraPreview.html I'll have a start: device: T-mobile G1 / HTC Dream android: 1.6 (cyanogen mod) format: YCbCr_420_SP so what formats do your android phones use? thanks in advance :D

    Read the article

  • Best tool to check and ensure PDF/A compatibility under Linux

    - by Sven Lilienthal
    I am working on an online portal, where researchers can upload their research papers. One requirement is, that all PDFs are stored in PDF/A-format. As I can't rely on the users to generate PDF/A conforming documents, I need a tool to check and convert standard PDFs into PDF/A format. What is the best tool you know of? Price Quality Speed Available APIs Open-source tools would be prefered, but a search revealed none. iText can create PDF/a, but converting isn't easy to do, as you have to read every page and copy it to a new document, losing all bookmarks and annotations in this process. (At least as far as I know, if you know of an easy solution, let me know). APIs should be available for either PHP, Java or a command-line-tool should be provided. Please do not list either GUI-only or Online-only solutions.

    Read the article

  • Why the current working directory changes when use the Open file dialog in XP?

    - by RRUZ
    I have found an strange behavior when use the open file dialog in c#. If use this code in Windows XP the current working directory changes to the path of the selected file, however if you run this code in windows 7 the current working directory does not change. private void button1_Click(object sender, EventArgs e) { MessageBox.Show(string.Format("Current Directory {0}",Directory.GetCurrentDirectory()), "My Application",MessageBoxButtons.OK, MessageBoxIcon.Asterisk); DialogResult result = openFileDialog1.ShowDialog(); // Show the dialog and get result. if (result == DialogResult.OK) { } MessageBox.Show(string.Format("Current Directory {0}", Directory.GetCurrentDirectory()), "My Application", MessageBoxButtons.OK, MessageBoxIcon.Asterisk); } Anybody know the reason for this behavior? Why the current directoiry changes in XP and not in windows 7?

    Read the article

  • Random access gzip stream

    - by jkff
    I'd like to be able to do random access into a gzipped file. I can afford to do some preprocessing on it (say, build some kind of index), provided that the result of the preprocessing is much smaller than the file itself. Any advice? My thoughts were: Hack on an existing gzip implementation and serialize its decompressor state every, say, 1 megabyte of compressed data. Then to do random access, deserialize the decompressor state and read from the megabyte boundary. This seems hard, especially since I'm working with Java and I couldn't find a pure-java gzip implementation :( Re-compress the file in chunks of 1Mb and do same as above. This has the disadvantage of doubling the required disk space. Write a simple parser of the gzip format that doesn't do any decompressing and only detects and indexes block boundaries (if there even are any blocks: I haven't yet read the gzip format description)

    Read the article

  • How to convert raw_input() into a directory?

    - by Azeworai
    Hi everyone, I just picked up IronPython and I've been trying to get this IronPython script going but I'm stuck at trying to get a Path input from raw_input to be a directory path. The first block of code is the broken one that I'm working on. import System from System import * from System.IO import * from System.Diagnostics import * inputDirectory = raw_input("Enter Input Directory's full path [eg. c:\\vid\\]: ") print ("In: "+inputDirectory) outputDirectory = inputDirectory +"ipod\\" print ("Out: "+outputDirectory) #create the default output directory for s in DirectoryInfo(inputDirectory).GetFiles("*.avi"): print s.FullName arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, outputDirectory + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() The following code block is what I have working at the moment. import System from System import * from System.IO import * from System.Diagnostics import * for s in DirectoryInfo("F:\\Tomorrow\\").GetFiles("*.avi"): arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, "F:\\Tomorrow\\ipod\\" + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() PS: Credit for the above working code goes to Joseph at jcooney.net

    Read the article

  • Is it possible to temporarily disable Python's string interpolation?

    - by dangerouslyfacetious
    I have a python logger set up, using python's logging module. I want to store the string I'm using with the logging Formatter object in a configuration file using the ConfigParser module. The format string is stored in a dictionary of settings in a separate file that handles the reading and writing of the config file. The problem I have is that python still tries to format the file and falls over when it reads all the logging-module-specific formatting flags. { "log_level":logging.debug, "log_name":"C:\\Temp\\logfile.log", "format_string": "%(asctime)s %(levelname)s: %(module)s, line %(lineno)d - %(message)s" } My question is simple: how can I disable the formatting functionality here while keeping it elsewhere. My initial reaction was copious use of the backslash to escape the various percent symbols, but that of course permanently breaks the formatting such that it wont work even when I need it to. Also, general pointers on good settings-file practices would be nice. This is the first time I've done anything significant with ConfigParser (or logging for that matter). Thanks in advance, Dominic

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 165 166 167 168 169 170 171 172 173 174 175 176  | Next Page >