Search Results

Search found 5968 results on 239 pages for 'generator expression'.

Page 171/239 | < Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >

  • Is this a correct porting of java.util.Random in objectiveC

    - by dipu
    I have ported the code inside java.util.Random class in objectivec. I want to have an identical random number generator so that it synchs with the server app running on java. Now is this a safe porting and if not is there a way to mimic AtomicLong as it is found in java? Please see my code below. static long long multiplier = 0x5DEECE66DL; static long addend = 0xBL; static long long mask = (0x1000000000000001L << 48) - 1; -(void) initWithSeed:(long long) seed1 { [self setRandomSeed: 0L];// = new AtomicLong(0L); [self setSeed: seed1]; } -(int) next:(int)bits { long long oldseed, nextseed; long long seed1 = [self.randomSeed longLongValue]; //AtomicLong //do { oldseed = seed1; nextseed = (oldseed * multiplier + addend) & mask; //} while (!seed.compareAndSet(oldseed, nextseed)); [self setRandomSeed: [NSNumber numberWithLongLong:nextseed]]; ///int ret = (int)(nextseed >>> (48 - bits)); int ret = (unsigned int)(nextseed >> (48 - bits)); return ret; } -(void) setSeed:(long long) seed1 { seed1 = (seed1 ^ multiplier) & mask; [self setRandomSeed: [NSNumber numberWithLongLong:seed1]]; }

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • In OpenRasta is it possible to Pattern match multiple key/value pairs?

    - by Scott Littlewood
    Is it possible in OpenRasta to have a Uri pattern that allows for an array of values of the same key to be submitted and mapped to a handler method accepting an array of the query parameters. Example: Return all the contacts named Dave Smith from a collection. HTTP GET /contacts?filterBy=first&filterValue=Dave&filterBy=last&filterValue=Smith With a configuration of: What syntax would be best for the Uri string pattern matching? (Suggestions welcome) ResourceSpace.Has.ResourcesOfType<List<ContactResource>>() .AtUri("/contacts") .And.AtUri("/contacts?filterBy[]={filterBy}[]&filterValue[]={fv}[]") // Option 1 .And.AtUri("/contacts?filterBy={filterBy}[]&fv={fv}[]") // Option 2 Would map to a Handler method of: public object Get(params Filter[] filters) { /* create a Linq Expression based on the filters using dynamic linq query the repository using the Linq */ return Query.All<Contact>().Where(c => c.First == "Dave" && c.Last == "Smith").ToResource() } where Filter is defined by public class Filter { public string FilterBy { get; set; } public string FilterValue { get; set; } }

    Read the article

  • Entity Framework 4 overwrite Equals and GetHashCode of an own class property

    - by Zhok
    Hi, I’m using Visual Studio 2010 with .NET 4 and Entity Framework 4. I’m working with POCO Classes and not the EF4 Generator. I need to overwrite the Equals() and GetHashCode() Method but that doesn’t really work. Thought it’s something everybody does but I don’t find anything about the problem Online. When I write my own Classes and Equals Method, I use Equals() of property’s, witch need to be loaded by EF to be filled. Like this: public class Item { public virtual int Id { get; set; } public virtual String Name { get; set; } public virtual List<UserItem> UserItems { get; set; } public virtual ItemType ItemType { get; set; } public override bool Equals(object obj) { Item item = obj as Item; if (obj == null) { return false; } return item.Name.Equals(this.Name) && item.ItemType.Equals(this.ItemType); } public override int GetHashCode() { return this.Name.GetHashCode() ^ this.ItemType.GetHashCode(); } } That Code doesn’t work, the problems are in Equals and GetHashCode where I try to get HashCode or Equal from “ItemType” . Every time I get a NullRefernceException if I try to get data by Linq2Entites. A dirty way to fix it, is to capture the NullReferenceException and return false (by Equals) and return base.GetHashCode() (by GethashCode) but I hope there is a better way to fix this problem. I’ve wrote a little test project, with SQL Script for the DB and POCO Domain, EDMX File and Console Test Main Method. You can download it here: Download

    Read the article

  • Double-Escaped Unicode Javascript Issue

    - by Jeffrey Winter
    I am having a problem displaying a Javascript string with embedded Unicode character escape sequences (\uXXXX) where the initial "\" character is itself escaped as "&#92;" What do I need to do to transform the string so that it properly evaluates the escape sequences and produces output with the correct Unicode character? For example, I am dealing with input such as: "this is a &#92;u201ctest&#92;u201d"; attempting to decode the "&#92;" using a regex expression, e.g.: var out = text.replace('/&#92;/g','\'); results in the output text: "this is a \u201ctest\u201d"; that is, the Unicode escape sequences are displayed as actual escape sequences, not the double quote characters I would like.

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • i have code below where i need to develop the xsl-fo file using loop

    - by karthick
    <?xml version="1.0" encoding="iso-8859-1"?> <!--<!DOCTYPE svg PUBLIC "-//W3C//DTD SVG 1.1//EN" "http://www.w3.org/Graphics/SVG/1.1/DTD/svg11.dtd">--> <!-- Generator: Arbortext IsoDraw 7.0 --> <?xml-stylesheet type="text/xsl" href="file:///C:/Documents%20and%20Settings/Admin/Desktop/Info%20Tech/task--2/taskbaba.xsl"?> <svg width="100%" height="100%" viewBox="0 0 214.819 278.002"> <g id="Catalog"> <text transform="matrix(0.984 0 0 0.93 183.515 265.271)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174"/> <text transform="matrix(0.994 0 0 0.93 7.235 265.3)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174">087156-8-</text> <text transform="matrix(0.995 0 0 0.93 21.708 265.357)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174" font-weight="bold">AB</text> <text x="103.292" y="265.298" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174">P. 1/1</text> <g id="IC_TextBlock.1"> <g> <text transform="matrix(0.994 0 0 0.93 192.812 8.076)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="4.586" font-weight="bold">Fittings</text> <text transform="matrix(0.994 0 0 0.93 188.492 13.323)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="4.586" font-weight="bold">Raccords</text> <text transform="matrix(0.994 0 0 0.93 183.431 18.571)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="4.586" font-weight="bold">Conexiones</text> </g> </g> </svg>

    Read the article

  • .net real time stream processing - needed huge and fast RAM buffer

    - by mack369
    The application I'm developing communicates with an digital audio device, which is capable of sending 24 different voice streams at the same time. The device is connected via USB, using FTDI device (serial port emulator) and D2XX Drivers (basic COM driver is to slow to handle transfer of 4.5Mbit). Basically the application consist of 3 threads: Main thread - GUI, control, ect. Bus reader - in this thread data is continuously read from the device and saved to a file buffer (there is no logic in this thread) Data interpreter - this thread reads the data from file buffer, converts to samples, does simple sample processing and saves the samples to separate wav files. The reason why I used file buffer is that I wanted to be sure that I won't loose any samples. The application doesn't use recording all the time, so I've chosen this solution because it was safe. The application works fine, except that buffered wave file generator is pretty slow. For 24 parallel records of 1 minute, it takes about 4 minutes to complete the recording. I'm pretty sure that eliminating the use of hard drive in this process will increase the speed much. The second problem is that the file buffer is really heavy for long records and I can't clean this up until the end of data processing (it would slow down the process even more). For RAM buffer I need at lest 1GB to make it work properly. What is the best way to allocate such a big amount of memory in .NET? I'm going to use this memory in 2 threads so a fast synchronization mechanism needed. I'm thinking about a cycle buffer: one big array, the Bus Reader saves the data, the Data Interpreter reads it. What do you think about it? [edit] Now for buffering I'm using classes BinaryReader and BinaryWriter based on a file.

    Read the article

  • Getting an odd error, MSSQL Query using `WITH` clause

    - by Aren B
    The following query: WITH CteProductLookup(ProductId, oid) AS ( SELECT p.ProductID, p.oid FROM [dbo].[ME_CatalogProducts] p ) SELECT rel.Name as RelationshipName, pl.ProductId as FromProductId, pl2.ProductId as ToProductId FROM ( [dbo].[ME_CatalogRelationships] rel INNER JOIN CteProductLookup pl ON pl.oid = rel.from_oid ) INNER JOIN CteProductLookup pl2 ON pl2.oid = rel.to_oid WHERE rel.Name = 'BundleItem' AND pl.ProductId = 'MX12345'; Is generating this error: Msg 319, Level 15, State 1, Line 5 Incorrect syntax near the keyword 'with'. If this statement is a common table expression, an xmlnamespaces clause or a change tracking context clause, the previous statement must be terminated with a semicolon. On execution only. There are no errors/warnings in the sql statement in the managment studio. Any ideas?

    Read the article

  • count of distinct acyclic paths from A[a,b] to A[c,d]?

    - by Sorush Rabiee
    I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • problem with null column

    - by Iulian
    One column in my database (of type double) has some null values. I am executing a sored procedure to get the data in my app wipDBTableAdapters.XLSFacturiTableAdapter TAFacturi = new wipDBTableAdapters.XLSFacturiTableAdapter(); var dtfacturi = TAFacturi.GetData(CodProiect); Then i try to do something like this: if (dtfacturi[i].CANTITATE == null) { //do something } this is giving a warning : The result of the expression is always 'false' since a value of type 'double' is never equal to 'null' of type 'double? However when i run my code i get the following exception: StrongTypingException The value for column 'CANTITATE' in table 'XLSFacturi' is DBNull. How am I supposed to resolve this ?

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • Get latest sql rows based on latest date and per user

    - by Umair
    I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • How to convert an arbitrary object to String with JSTL? (calling toString())

    - by hstoerr
    Is there any way to call toString() on an object with the JSTL? (I need the String representation of an enum as index in a map in a JSP EL expression.) I hoped something like ${''+object} would work like in java, but JSTL isn't that nice, and there does not seem to be any function that does it. Clarification: I have a variable somemap that maps Strings to Strings, and I have a variable someenum that is an enumeration. I'd like to do something like ${somemap[someenum.toString()]}. (Of course .toString() does not work, but what does?)

    Read the article

  • How do I access the CodeDomProvider from a class inheriting from Microsoft.VisualStudio.TextTemplating.VSHost.BaseCodeGeneratorWithSite?

    - by Charlie
    Does anyone know how to get a CodeDomProvider in the new Microsoft.VisualStudio.TextTemplating.VSHost.BaseCodeGeneratorWithSite from the Visual Studio 2010 SDK? I used to get access to it just by in mere inheritance of the class Microsoft.CustomTool.BaseCodeGeneratorWithSite, but now with this new class it is not there. I see a GlobalServiceProvider and a SiteServiceProvider but I can't find any example on how to use them. Microsoft.VisualStudio.TextTemplating.VSHost.BaseCodeGeneratorWithSite: http://msdn.microsoft.com/en-us/library/bb932625.aspx I was to do this: public class Generator : Microsoft.VisualStudio.TextTemplating.VSHost.BaseCodeGeneratorWithSite { public override string GetDefaultExtension() { // GetDefaultExtension IS ALSO NOT ACCESSIBLE... return this.InputFilePath.Substring(this.InputFilePath.LastIndexOf(".")) + ".designer" + base.GetDefaultExtension(); } // This method is being called every time the attached xml is saved. protected override byte[] GenerateCode(string inputFileName, string inputFileContent) { try { // Try to generate the wrapper file. return GenerateSourceCode(inputFileName); } catch (Exception ex) { // In case of a faliure - print the exception // as a comment in the source code. return GenerateExceptionCode(ex); } } public byte[] GenerateSourceCode(string inputFileName) { Dictionary<string, CodeCompileUnit> oCodeUnits; // THIS IS WHERE CodeProvider IS NOT ACCESSIBLE CodeDomProvider oCodeDomProvider = this.CodeProvider; string[] aCode = new MyCustomAPI.GenerateCode(inputFileName, ref oCodeDomProvider); return Encoding.ASCII.GetBytes(String.Join(@" ", aCode)); } private byte[] GenerateExceptionCode(Exception ex) { CodeCompileUnit oCode = new CodeCompileUnit(); CodeNamespace oNamespace = new CodeNamespace("System"); oNamespace.Comments.Add(new CodeCommentStatement(MyCustomAPI.Print(ex))); oCode.Namespaces.Add(oNamespace); string sCode = null; using (StringWriter oSW = new StringWriter()) { using (IndentedTextWriter oITW = new IndentedTextWriter(oSW)) { this.CodeProvider.GenerateCodeFromCompileUnit(oCode, oITW, null); sCode = oSW.ToString(); } } return Encoding.ASCII.GetBytes(sCode ); } } Thanks for your help!

    Read the article

  • Replace text in string with delimeters using Regex

    - by user1057735
    I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • x86 Assembly Question about outputting

    - by jdea
    My code looks like this _declspec(naked) void f(unsigned int input,unsigned int *output) { __asm{ push dword ptr[esp+4] call factorial pop ecx mov [output], eax //copy result ret } } __declspec(naked) unsigned int factorial(unsigned int n) { __asm{ push esi mov esi, dword ptr [esp+8] cmp esi, 1 jg RECURSE mov eax, 1 jmp END RECURSE: dec esi push esi call factorial pop esi inc esi mul esi END: pop esi ret } } Its a factorial function and I'm trying to output the answer after it recursively calculates the number that was passed in But what I get returned as an output is the same large number I keep getting Not sure about what is wrong with my output, by I also see this error CXX0030: Error: expression cannot be evaluated Thanks!

    Read the article

< Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >