Search Results

Search found 5968 results on 239 pages for 'generator expression'.

Page 171/239 | < Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >

  • Why won't binding to a child object property with rdlc Report work in vs2010?

    - by andrej351
    A while ago someone asked how to bind to a child object's property in a rdlc report. Question here. The solution was to use an expression like this: =Fields!ChildObject.Value.SomeProperty I have recently tried to upgrade to version 10 of the reporting libraries (Microsoft.ReportViewer.WebForms and Microsoft.ReportViewer.Common) and for some reason this does not work anymore. I have got the report rendering and displaying all data fine except any which uses this technique. Instead of the property value i get the text: "#Error" Why doesn't this work anymore? Anybody know how to to this in the new version?

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • Double-Escaped Unicode Javascript Issue

    - by Jeffrey Winter
    I am having a problem displaying a Javascript string with embedded Unicode character escape sequences (\uXXXX) where the initial "\" character is itself escaped as "&#92;" What do I need to do to transform the string so that it properly evaluates the escape sequences and produces output with the correct Unicode character? For example, I am dealing with input such as: "this is a &#92;u201ctest&#92;u201d"; attempting to decode the "&#92;" using a regex expression, e.g.: var out = text.replace('/&#92;/g','\'); results in the output text: "this is a \u201ctest\u201d"; that is, the Unicode escape sequences are displayed as actual escape sequences, not the double quote characters I would like.

    Read the article

  • Applying the Hibernate filter attribute to a Bag with a many-to-many relationship

    - by David P
    Consider the following Hibernate mapping file: <hibernate-mapping ...> <class name="ContentPackage" table="contentPackages"> <id name="Id" column="id" type="int"><generator class="native" /></id> ... <bag name="Clips" table="contentAudVidLinks"> <key column="fk_contentPackageId"></key> <many-to-many class="Clip" column="fk_AudVidId"></many-to-many> <filter name="effectiveDate" condition=":asOfDate BETWEEN startDate and endDate" /> </bag> </class> </hibernate-mapping> When I run the following command: _session.EnableFilter("effectiveDate").SetParameter("asOfDate", DateTime.Today); IList<ContentPackage> items = _session.CreateCriteria(typeof(ContentPackage)) .Add(Restrictions.Eq("Id", id)) .List<ContentPackage>(); The resulting SQL has the WHERE clause on the intermediate mapping table (contentAudVidLinks), rather than the "Clips" table even though I have added the filter attribute to the Bag of Clips. What am I doing wrong?

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • In OpenRasta is it possible to Pattern match multiple key/value pairs?

    - by Scott Littlewood
    Is it possible in OpenRasta to have a Uri pattern that allows for an array of values of the same key to be submitted and mapped to a handler method accepting an array of the query parameters. Example: Return all the contacts named Dave Smith from a collection. HTTP GET /contacts?filterBy=first&filterValue=Dave&filterBy=last&filterValue=Smith With a configuration of: What syntax would be best for the Uri string pattern matching? (Suggestions welcome) ResourceSpace.Has.ResourcesOfType<List<ContactResource>>() .AtUri("/contacts") .And.AtUri("/contacts?filterBy[]={filterBy}[]&filterValue[]={fv}[]") // Option 1 .And.AtUri("/contacts?filterBy={filterBy}[]&fv={fv}[]") // Option 2 Would map to a Handler method of: public object Get(params Filter[] filters) { /* create a Linq Expression based on the filters using dynamic linq query the repository using the Linq */ return Query.All<Contact>().Where(c => c.First == "Dave" && c.Last == "Smith").ToResource() } where Filter is defined by public class Filter { public string FilterBy { get; set; } public string FilterValue { get; set; } }

    Read the article

  • i have code below where i need to develop the xsl-fo file using loop

    - by karthick
    <?xml version="1.0" encoding="iso-8859-1"?> <!--<!DOCTYPE svg PUBLIC "-//W3C//DTD SVG 1.1//EN" "http://www.w3.org/Graphics/SVG/1.1/DTD/svg11.dtd">--> <!-- Generator: Arbortext IsoDraw 7.0 --> <?xml-stylesheet type="text/xsl" href="file:///C:/Documents%20and%20Settings/Admin/Desktop/Info%20Tech/task--2/taskbaba.xsl"?> <svg width="100%" height="100%" viewBox="0 0 214.819 278.002"> <g id="Catalog"> <text transform="matrix(0.984 0 0 0.93 183.515 265.271)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174"/> <text transform="matrix(0.994 0 0 0.93 7.235 265.3)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174">087156-8-</text> <text transform="matrix(0.995 0 0 0.93 21.708 265.357)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174" font-weight="bold">AB</text> <text x="103.292" y="265.298" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="3.174">P. 1/1</text> <g id="IC_TextBlock.1"> <g> <text transform="matrix(0.994 0 0 0.93 192.812 8.076)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="4.586" font-weight="bold">Fittings</text> <text transform="matrix(0.994 0 0 0.93 188.492 13.323)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="4.586" font-weight="bold">Raccords</text> <text transform="matrix(0.994 0 0 0.93 183.431 18.571)" stroke="none" fill="#000000" font-family="'Helvetica'" font-size="4.586" font-weight="bold">Conexiones</text> </g> </g> </svg>

    Read the article

  • count of distinct acyclic paths from A[a,b] to A[c,d]?

    - by Sorush Rabiee
    I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

    Read the article

  • C# Byte[] to Url Friendly String

    - by LorenVS
    Hello, I'm working on a quick captcha generator for a simple site I'm putting together, and I'm hoping to pass an encrypted key in the url of the page. I could probably do this as a query string parameter easy enough, but I'm hoping not too (just because nothing else runs off the query string)... My encryption code produces a byte[], which is then transformed using Convert.ToBase64String(byte[]) into a string. This string, however, is still not quite url friendly, as it can contain things like '/' and '='. Does anyone know of a better function in the .NET framework to convert a byte array to a url friendly string? I know all about System.Web.HttpUtility.UrlEncode() and its equivalents, however, they only work properly with query string parameters. If I url encode an '=' inside of the path, my web server brings back a 400 Bad Request error. Anyways, not a critical issue, but hoping someone can give me a nice solution **EDIT: Just to be absolutely sure exactly what I'm doing with the string, I figured I would supply a little more information. The byte[] that results from my encryption algorithm should be fed through some sort of algorithm to make it into a url friendly string. After this, it becomes the content of an XElement, which is then used as the source document for an XSLT transformation, and is used as a part of the href attribute for an anchor. I don't believe the xslt transformation is causing the issues, since what is coming through on the path appears to be an encoded query string parameter, but causes the HTTP 400 I've also tried HttpUtility.UrlPathEncode() on a base64 string, but that doesn't seem to do the trick either (I still end up with '/'s in my url)**

    Read the article

  • .net real time stream processing - needed huge and fast RAM buffer

    - by mack369
    The application I'm developing communicates with an digital audio device, which is capable of sending 24 different voice streams at the same time. The device is connected via USB, using FTDI device (serial port emulator) and D2XX Drivers (basic COM driver is to slow to handle transfer of 4.5Mbit). Basically the application consist of 3 threads: Main thread - GUI, control, ect. Bus reader - in this thread data is continuously read from the device and saved to a file buffer (there is no logic in this thread) Data interpreter - this thread reads the data from file buffer, converts to samples, does simple sample processing and saves the samples to separate wav files. The reason why I used file buffer is that I wanted to be sure that I won't loose any samples. The application doesn't use recording all the time, so I've chosen this solution because it was safe. The application works fine, except that buffered wave file generator is pretty slow. For 24 parallel records of 1 minute, it takes about 4 minutes to complete the recording. I'm pretty sure that eliminating the use of hard drive in this process will increase the speed much. The second problem is that the file buffer is really heavy for long records and I can't clean this up until the end of data processing (it would slow down the process even more). For RAM buffer I need at lest 1GB to make it work properly. What is the best way to allocate such a big amount of memory in .NET? I'm going to use this memory in 2 threads so a fast synchronization mechanism needed. I'm thinking about a cycle buffer: one big array, the Bus Reader saves the data, the Data Interpreter reads it. What do you think about it? [edit] Now for buffering I'm using classes BinaryReader and BinaryWriter based on a file.

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Getting an odd error, MSSQL Query using `WITH` clause

    - by Aren B
    The following query: WITH CteProductLookup(ProductId, oid) AS ( SELECT p.ProductID, p.oid FROM [dbo].[ME_CatalogProducts] p ) SELECT rel.Name as RelationshipName, pl.ProductId as FromProductId, pl2.ProductId as ToProductId FROM ( [dbo].[ME_CatalogRelationships] rel INNER JOIN CteProductLookup pl ON pl.oid = rel.from_oid ) INNER JOIN CteProductLookup pl2 ON pl2.oid = rel.to_oid WHERE rel.Name = 'BundleItem' AND pl.ProductId = 'MX12345'; Is generating this error: Msg 319, Level 15, State 1, Line 5 Incorrect syntax near the keyword 'with'. If this statement is a common table expression, an xmlnamespaces clause or a change tracking context clause, the previous statement must be terminated with a semicolon. On execution only. There are no errors/warnings in the sql statement in the managment studio. Any ideas?

    Read the article

  • Entity Framework 4 overwrite Equals and GetHashCode of an own class property

    - by Zhok
    Hi, I’m using Visual Studio 2010 with .NET 4 and Entity Framework 4. I’m working with POCO Classes and not the EF4 Generator. I need to overwrite the Equals() and GetHashCode() Method but that doesn’t really work. Thought it’s something everybody does but I don’t find anything about the problem Online. When I write my own Classes and Equals Method, I use Equals() of property’s, witch need to be loaded by EF to be filled. Like this: public class Item { public virtual int Id { get; set; } public virtual String Name { get; set; } public virtual List<UserItem> UserItems { get; set; } public virtual ItemType ItemType { get; set; } public override bool Equals(object obj) { Item item = obj as Item; if (obj == null) { return false; } return item.Name.Equals(this.Name) && item.ItemType.Equals(this.ItemType); } public override int GetHashCode() { return this.Name.GetHashCode() ^ this.ItemType.GetHashCode(); } } That Code doesn’t work, the problems are in Equals and GetHashCode where I try to get HashCode or Equal from “ItemType” . Every time I get a NullRefernceException if I try to get data by Linq2Entites. A dirty way to fix it, is to capture the NullReferenceException and return false (by Equals) and return base.GetHashCode() (by GethashCode) but I hope there is a better way to fix this problem. I’ve wrote a little test project, with SQL Script for the DB and POCO Domain, EDMX File and Console Test Main Method. You can download it here: Download

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

    - by Shahar Evron
    I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • Using DateDiff in Entity Framwork on a SQL CE database

    - by deverop
    I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

    Read the article

  • Symfony: How to hide form fields from display and then set values for them in the action class

    - by Tom
    I am fairly new to symfony and I have 2 fields relating to my table "Pages"; created_by and updated_by. These are related to the users table (sfGuardUser) as foreign keys. I want these to be hidden from the edit/new forms so I have set up the generator.yml file to not display these fields: form: display: General: [name, template_id] Meta: [meta_title, meta_description, meta_keywords] Now I need to set the fields on the save. I have been searching for how to do this all day and tried a hundred methods. The method I have got working is this, in the actions class: protected function processForm(sfWebRequest $request, sfForm $form) { $form_params = $request->getParameter($form->getName()); $form_params['updated_by'] = $this->getUser()->getGuardUser()->getId(); if ($form->getObject()->isNew()) $form_params['created_by'] = $this->getUser()->getGuardUser()->getId(); $form->bind($form_params, $request->getFiles($form->getName())); So this works. But I get the feeling that ideally I shouldnt be modifying the web request, but instead modifying the form/object directly. However I havent had any success with things like: $form->getObject()->setUpdatedBy($this->getUser()->getGuardUser()); If anyone could offer any advice on the best ways about solving this type of problem I would be very grateful. Thanks, Tom

    Read the article

  • Create xml file to be used in wordpress post import

    - by adedoy
    Alright here is the thing, I have this site that was once wordpress but have been converted into 70+ static pages, the admin is deleted and the whole site is static(which means every page is in index.html), I want to create a script that makes an xml so that I will just have to import it in the new wordpress install. So far, I am able to create an XML but it only imports one post. The data source is the URL of a page and I use jquery $get to filter only to gather the post of a given archive. //html <input type="text" class="full_path"> <input type="button" value="Get Data" class="getdata"> //script $('.getdata').click(function(){ $.get($('.full_path').val(), function(data) { post = $(data).find('div [style*="width:530px;"]'); $('.result').html(post.html()); }); });//get Data Through AJAX I send the cleaned data into a php below that creates the XML: $file = 'newpost.xml'; $post_data = $_REQUEST['post_data']; // Open the file to get existing content $current = file_get_contents($file); // Append a new post to the file $catStr = ''; if(isset($post_data['categories']) && count($post_data['categories']) > 0){ foreach($post_data['categories'] as $category) { $catStr .= '<category domain="category" nicename="'.$category.'"><![CDATA['.$category.']]></category>'; } } $tagStr = ''; if(isset($post_data['tags']) && count($post_data['tags']) > 0){ foreach($post_data['tags'] as $tag) { $tagStr = '<category domain="post_tag" nicename="'.$tag.'"><![CDATA['.$tag.']]></category>'; } } $post_name = str_replace(' ','-',$post_data["title"]); $post_name = str_replace(array('"','/',':','.',',','[',']','“','”'),'',strtolower($post_name)); $post_date = '2011-4-0'.rand(1, 29).''.rand(1, 12).':'.rand(1, 59).':'.rand(1, 59); $pubTime = rand(1, 12).':'.rand(1, 59).':'.rand(1, 59).' +0000'; $post = ' <item> <title>'.$post_data["title"].'</title> <link>'.$post_data["link"].'</link> <pubDate>'.$post_data["date"].' '.$pubTime.'</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/saunders/?p=1</guid> <description></description> <content:encoded><![CDATA['.$post_data["content"].']]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>'.$post_date.'</wp:post_date> <wp:post_date_gmt>'.$post_date.'</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>'.$post_name.'</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> '.$catStr.' '.$tagStr.' <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> '; // Write the contents back to the file with the appended post file_put_contents($file, $current.$post); After being appended I add the code below to complete the xml rss tag </channel> </rss> If I look and compare the xml file of one that is exported from a wordpress site, I see little difference. Please HELP!! here is a sample of a generated xml: <?xml version="1.0" encoding="UTF-8" ?> <rss version="2.0" xmlns:excerpt="http://wordpress.org/export/1.2/excerpt/" xmlns:content="http://purl.org/rss/1.0/modules/content/" xmlns:wfw="http://wellformedweb.org/CommentAPI/" xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:wp="http://wordpress.org/export/1.2/" > <channel> <title>lols why</title> <link>http://localhost/lols</link> <description>Just another WordPress site</description> <pubDate>Wed, 03 Oct 2012 04:24:04 +0000</pubDate> <language>en-US</language> <wp:wxr_version>1.2</wp:wxr_version> <wp:base_site_url>http://localhost/lols</wp:base_site_url> <wp:base_blog_url>http://localhost/lols</wp:base_blog_url> <wp:author><wp:author_id>1</wp:author_id><wp:author_login>adedoy</wp:author_login><wp:author_email>[email protected]</wp:author_email><wp:author_display_name><![CDATA[adedoy]]></wp:author_display_name><wp:author_first_name><![CDATA[]]></wp:author_first_name><wp:author_last_name><![CDATA[]]></wp:author_last_name></wp:author> <generator>http://wordpress.org/?v=3.4.1</generator> <item> <title>Sample lift?</title> <link>../../breast-lift/delaware-breast-surgery-do-i-need-a-breast-lift/</link> <pubDate>Wed, 03 Oct 2012 9:29:16 +0000</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/lols/?p=1</guid> <description></description> <content:encoded><![CDATA[<p>sample</p>]]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>2011-4-0132:45:4</wp:post_date> <wp:post_date_gmt>2011-4-0132:45:4</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>sample-lift?</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> <category domain="category" nicename="Sample Lift"><![CDATA[Sample Lift]]></category><category domain="category" nicename="Sample Procedures"><![CDATA[Yeah Procedures]]></category> <category domain="post_tag" nicename="delaware"><![CDATA[delaware]]></category> <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> <item> <title>lalalalalala</title> <link>../../administrative-tips-for-surgery/delaware-cosmetic-surgery-a-better-experience/</link> <pubDate>Wed, 03 Oct 2012 3:20:43 +0000</pubDate> <dc:creator>admin</dc:creator> <guid isPermaLink="false">http://localhost/lols/?p=1</guid> <description></description> <content:encoded><![CDATA[ lalalalalala ]]></content:encoded> <excerpt:encoded><![CDATA[]]></excerpt:encoded> <wp:post_id>1</wp:post_id> <wp:post_date>2011-4-0124:39:30</wp:post_date> <wp:post_date_gmt>2011-4-0124:39:30</wp:post_date_gmt> <wp:comment_status>open</wp:comment_status> <wp:ping_status>open</wp:ping_status> <wp:post_name>lalalalalala</wp:post_name> <wp:status>publish</wp:status> <wp:post_parent>0</wp:post_parent> <wp:menu_order>0</wp:menu_order> <wp:post_type>post</wp:post_type> <wp:post_password></wp:post_password> <wp:is_sticky>0</wp:is_sticky> <category domain="category" nicename="lalalalalala"><![CDATA[lalalalalala]]></category> <category domain="post_tag" nicename="oink"><![CDATA[oink]]></category> <wp:postmeta> <wp:meta_key>_edit_last</wp:meta_key> <wp:meta_value><![CDATA[1]]></wp:meta_value> </wp:postmeta> </item> </channel> </rss> Please tell me what am I missing....

    Read the article

< Previous Page | 167 168 169 170 171 172 173 174 175 176 177 178  | Next Page >