Search Results

Search found 15289 results on 612 pages for 'exception throw'.

Page 172/612 | < Previous Page | 168 169 170 171 172 173 174 175 176 177 178 179  | Next Page >

  • Help needed to resolve RMI RemoteException

    - by Gabriel Parenza
    Hello friends, Any idea why do I get RemoteException while trying to invoke methods on Unix machine from Windows. I am inside the network and dont think this is because of firewall problem as I can do "telnet" from Windows to Unix box after starting the RMI server at the unix box. I also could not understand why is it going to local loopback IP? Stack Trace:: RemoteException occured, details java.rmi.ConnectException: Connection refused to host: 127.0.0.1; nested exception is: java.net.ConnectException: Connection refused: connect java.rmi.ConnectException: Connection refused to host: 127.0.0.1; nested exception is: java.net.ConnectException: Connection refused: connect Many thanks in advance.

    Read the article

  • Play wave file using AudioFormat in java

    - by angelina
    Dear all, I m getting following exception while running my code on linux operating system.This code works fine on windows operating system.below is the exception and code used. java.lang.IllegalArgumentException: No line matching interface Clip supporting format PCM_SIGNED unknown sample rate, 16 bit, stereo, 4 bytes/frame, big-endian is supported. AudioFormat format = sourceaudio.getFormat(); format = new AudioFormat( AudioFormat.Encoding.PCM_SIGNED, format.getSampleRate(), format.getSampleSizeInBits() * 2, format.getChannels(), format.getFrameSize() * 2, format.getFrameRate(), true); AudioFileFormat.Type targettype = AudioFileFormat.Type.WAVE; AudioInputStream targetaudiostream = AudioSystem.getAudioInputStream(format, sourceaudio); sourceaudio.close(); targetaudiostream.close(); System.out.println("55555555"); URL url = new URL("http://localhost:8084/newvideo/PCMfile.wav"); Clip clip = AudioSystem.getClip(); AudioInputStream ais = AudioSystem.getAudioInputStream(url); clip.open(ais); System.out.println("seconds: " + (clip.getMicrosecondLength() / 1000000));

    Read the article

  • Update MySQL table from jsp

    - by vishnu
    I have these in a jsp file. But these values are not updated in the mysql table. May be it is not commiting. How can i solve this ? String passc1 = request.getParameter("passc1"); String accid = request.getParameter("accid"); int i = 0; String sql = " update customertb " + " set passwd = ?" + " where acc_no = ?;"; try { PreparedStatement ps = con.prepareStatement(sql); ps.setString(1, passc1); ps.setString(2, accid); i = ps.executeUpdate(); } catch (Exception e) { // do something with Exception here. Maybe just throw it up again } finally { con.close(); }

    Read the article

  • Java RMI : connection refused

    - by mihsathe
    I have written following code for the client of RMI. But getting java.rmi.ConnectException: Connection refused to host: localhost; nested exception is: java.net.ConnectException: Connection refused: connect code : import java.rmi.*; import java.net.*; import java.rmi.registry.*; class client { public static void main(String [] ars) { Iface serv; Registry r; String serveraddr = ars[0]; String serverport = ars[1]; String text = "Hey jude"; System.out.println("Sending" + text); try{ r = LocateRegistry.getRegistry( serveraddr, (new Integer(serverport)).intValue() ); serv = (Iface) r.lookup("rmi://server"); serv.receive(text); } catch(Exception e){ System.out.println(e); } } }

    Read the article

  • ELMAH - Using custom error pages to collecting user feedback

    - by vdh_ant
    Hey guys I'm looking at using ELMAH for the first time but have a requirement that needs to be met that I'm not sure how to go about achieving... Basically, I am going to configure ELMAH to work under asp.net MVC and get it to log errors to the database when they occur. On top of this I be using customErrors to direct the user to a friendly message page when an error occurs. Fairly standard stuff... The requirement is that on this custom error page I have a form which enables to user to provide extra information if they wish. Now the problem arises due to the fact that at this point the error is already logged and I need to associate the loged error with the users feedback. Normally, if I was using my own custom implementation, after I log the error I would pass through the ID of the error to the custom error page so that an association can be made. But because of the way that ELMAH works, I don't think the same is quite possible. Hence I was wondering how people thought that one might go about doing this.... Cheers UPDATE: My solution to the problem is as follows: public class UserCurrentConextUsingWebContext : IUserCurrentConext { private const string _StoredExceptionName = "System.StoredException."; private const string _StoredExceptionIdName = "System.StoredExceptionId."; public virtual string UniqueAddress { get { return HttpContext.Current.Request.UserHostAddress; } } public Exception StoredException { get { return HttpContext.Current.Application[_StoredExceptionName + this.UniqueAddress] as Exception; } set { HttpContext.Current.Application[_StoredExceptionName + this.UniqueAddress] = value; } } public string StoredExceptionId { get { return HttpContext.Current.Application[_StoredExceptionIdName + this.UniqueAddress] as string; } set { HttpContext.Current.Application[_StoredExceptionIdName + this.UniqueAddress] = value; } } } Then when the error occurs, I have something like this in my Global.asax: public void ErrorLog_Logged(object sender, ErrorLoggedEventArgs args) { var item = new UserCurrentConextUsingWebContext(); item.StoredException = args.Entry.Error.Exception; item.StoredExceptionId = args.Entry.Id; } Then where ever you are later you can pull out the details by var item = new UserCurrentConextUsingWebContext(); var error = item.StoredException; var errorId = item.StoredExceptionId; item.StoredException = null; item.StoredExceptionId = null; Note this isn't 100% perfect as its possible for the same IP to have multiple requests to have errors at the same time. But the likely hood of that happening is remote. And this solution is independent of the session, which in our case is important, also some errors can cause sessions to be terminated, etc. Hence why this approach has worked nicely for us.

    Read the article

  • struts validation problem in IE

    - by user265201
    I am using Struts 2.1.8 and facing validation problem in IE. I am getting the following error An exception occurred: Error. Error message: Invalid argument. I tried out to figure out the cause and found the following. My generated javascript code is: field = form.elements['district.name']; var error = "Enter only alphabets for district"; if (continueValidation && field.value != null && !field.value.match("^[a-zA-Z ]*$")) { addError(field, error); errors = true; } I tried to mock up by putting the same code in a function and calling it in onclick event. The method addError() throws the exception and the reason is field variable. If I change it to field[0], it works fine. How to fix this error?

    Read the article

  • Blob object not working properly even though the class is seralized

    - by GustlyWind
    I have class which is seralized and does convert a very large amount of data object to blob to save it to database.In the same class there is decode method to convert blob to the actual object.Following is the code for encode and decode of the object. private byte[] encode(ScheduledReport schedSTDReport) { byte[] bytes = null; try { ByteArrayOutputStream bos = new ByteArrayOutputStream(); ObjectOutputStream oos = new ObjectOutputStream(bos); oos.writeObject(schedSTDReport); oos.flush(); oos.close(); bos.close(); //byte [] data = bos.toByteArray(); //ByteArrayOutputStream baos = new ByteArrayOutputStream(); //GZIPOutputStream out = new GZIPOutputStream(baos); //XMLEncoder encoder = new XMLEncoder(out); //encoder.writeObject(schedSTDReport); //encoder.close(); bytes = bos.toByteArray(); //GZIPOutputStream out = new GZIPOutputStream(bos); //out.write(bytes); //bytes = bos.toByteArray(); } catch (Exception e) { _log.error("Exception caught while encoding/zipping Scheduled STDReport", e); } decode(bytes); return bytes; } /* * Decode the report definition blob back to the * ScheduledReport object. */ private ScheduledReport decode(byte[] bytes) { ByteArrayInputStream bais = new ByteArrayInputStream(bytes); ScheduledReport sSTDR = null; try { ObjectInputStream ois = new ObjectInputStream(bais); //GZIPInputStream in = new GZIPInputStream(bais); //XMLDecoder decoder = new XMLDecoder(in); sSTDR = (ScheduledReport)ois.readObject();//decoder.readObject(); //decoder.close(); } catch (Exception e) { _log.error("IOException caught while decoding/unzipping Scheduled STDReport", e); } return sSTDR; } The problem here is whenver I change something else in this class means any other method,a new class version is created and so the new version the class is unable to decode the originally encoded blob object. The object which I am passing for encode is also seralized object but this problem exists. Any ideas thanks

    Read the article

  • How to add an XML parameter to a stored procedure in C#?

    - by salvationishere
    I am developing a C# web application in VS 2008 which interacts with my Adventureworks database in my SQL Server 2008. Now I am trying to add new records to one of the tables which has an XML column in it. How do I do this? This is the error I'm getting: System.Data.SqlClient.SqlException was caught Message="XML Validation: Text node is not allowed at this location, the type was defined with element only content or with simple content. Location: /" Source=".Net SqlClient Data Provider" ErrorCode=-2146232060 Class=16 LineNumber=22 Number=6909 Procedure="AppendDataC" Server="." State=1 StackTrace: at System.Data.SqlClient.SqlConnection.OnError(SqlException exception, Boolean breakConnection) at System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) at System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) at System.Data.SqlClient.TdsParser.Run(RunBehavior runBehavior, SqlCommand cmdHandler, SqlDataReader dataStream, BulkCopySimpleResultSet bulkCopyHandler, TdsParserStateObject stateObj) at System.Data.SqlClient.SqlCommand.FinishExecuteReader(SqlDataReader ds, RunBehavior runBehavior, String resetOptionsString) at System.Data.SqlClient.SqlCommand.RunExecuteReaderTds(CommandBehavior cmdBehavior, RunBehavior runBehavior, Boolean returnStream, Boolean async) at System.Data.SqlClient.SqlCommand.RunExecuteReader(CommandBehavior cmdBehavior, RunBehavior runBehavior, Boolean returnStream, String method, DbAsyncResult result) at System.Data.SqlClient.SqlCommand.InternalExecuteNonQuery(DbAsyncResult result, String methodName, Boolean sendToPipe) at System.Data.SqlClient.SqlCommand.ExecuteNonQuery() at ADONET_namespace.ADONET_methods.AppendDataC(DataRow d, Hashtable ht) in C:\Documents and Settings\Admin\My Documents\Visual Studio 2008\Projects\AddFileToSQL\AddFileToSQL\ADONET methods.cs:line 212 InnerException: And this is a portion of my code in C#: try { SqlConnection conn2 = new SqlConnection(connString); SqlCommand cmd = conn2.CreateCommand(); cmd.CommandText = "dbo.AppendDataC"; cmd.CommandType = CommandType.StoredProcedure; cmd.Connection = conn2; ... sqlParam10.SqlDbType = SqlDbType.VarChar; SqlParameter sqlParam11 = cmd.Parameters.AddWithValue("@" + ht["@col11"], d[10]); sqlParam11.SqlDbType = SqlDbType.VarChar; SqlParameter sqlParam12 = cmd.Parameters.AddWithValue("@" + ht["@col12"], d[11]); sqlParam12.SqlDbType = SqlDbType.Xml; ... conn2.Open(); cmd.ExecuteNonQuery(); //This is the line it fails on and then jumps //to the Catch statement conn2.Close(); errorMsg = "The Person.Contact table was successfully updated!"; } catch (Exception ex) { Right now in my text input MDF file I have the XML parameter as: '<Products><id>3</id><id>6</id><id>15</id></Products>' Is this valid format for XML?

    Read the article

  • How to add ACTIVE DIRECTORY user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • WCF Fails when using impersonation over 2 machine boundaries (3 machines)

    - by MrTortoise
    These scenarios work in their pieces. Its when i put it all together that it breaks. I have a WCF service using netTCP that uses impersonation to get the callers ID (role based security will be used at this level) on top of this is a WCF service using basicHTTP with TransportCredientialOnly which also uses impersonation I then have a client front end that connects to the basicHttp. the aim of the game is to return the clients username from the netTCP service at the bottom - so ultimatley i can use role based security here. each service is on a different machine - and each service works when you remove any calls they make to other services when you run a client for them both locally and remotley. IE the problem only manifests when you jump accross more than one machine boundary. IE the setup breaks when i connect each part together - but they work fine on their own. I also specify [OperationBehavior(Impersonation = ImpersonationOption.Required)] in the method and have IIS setup to only allow windows authentication (actually i have ananymous enabled still, but disabling makes no difference) This impersonation works fine in the scenario where i have a netTCP Service on Machine A with a client with a basicHttp service on machine B with a clinet for the basicHttp service also on machine B ... however if i move that client to any machine C i get the following error: The exception is 'The socket connection was aborted. This could be caused by an error processing your message or a receive timeout being exceeded by the remote host, or an underlying network resource issue. Local socket timeout was '00:10:00'' the inner message is 'An existing connection was forcibly closed by the remote host' Am beginning to think this is more a network issue than config ... but then im grasping at straws ... the config files are as follows (heading from the client down to the netTCP layer) <?xml version="1.0" encoding="utf-8" ?> <configuration> <system.serviceModel> <bindings> <basicHttpBinding> <binding name="basicHttpBindingEndpoint" closeTimeout="00:02:00" openTimeout="00:02:00" receiveTimeout="00:10:00" sendTimeout="00:02:00" allowCookies="false" bypassProxyOnLocal="false" hostNameComparisonMode="StrongWildcard" maxBufferSize="65536" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" messageEncoding="Text" textEncoding="utf-8" transferMode="Buffered" useDefaultWebProxy="true"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Windows" proxyCredentialType="None" realm="" /> <message clientCredentialType="UserName" algorithmSuite="Default" /> </security> </binding> </basicHttpBinding> </bindings> <client> <endpoint address="http://panrelease01/WCFTopWindowsTest/Service1.svc" binding="basicHttpBinding" bindingConfiguration="basicHttpBindingEndpoint" contract="ServiceReference1.IService1" name="basicHttpBindingEndpoint" behaviorConfiguration="ImpersonationBehaviour" /> </client> <behaviors> <endpointBehaviors> <behavior name="ImpersonationBehaviour"> <clientCredentials> <windows allowedImpersonationLevel="Impersonation"/> </clientCredentials> </behavior> </endpointBehaviors> </behaviors> </system.serviceModel> </configuration> the service for the client (basicHttp service and the client for the netTCP service) <?xml version="1.0" encoding="UTF-8"?> <configuration> <system.web> <compilation debug="true" targetFramework="4.0" /> </system.web> <system.serviceModel> <bindings> <netTcpBinding> <binding name="netTcpBindingEndpoint" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" transactionFlow="false" transferMode="Buffered" transactionProtocol="OleTransactions" hostNameComparisonMode="StrongWildcard" listenBacklog="10" maxBufferPoolSize="524288" maxBufferSize="65536" maxConnections="10" maxReceivedMessageSize="65536"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <reliableSession ordered="true" inactivityTimeout="00:10:00" enabled="false" /> <security mode="Transport"> <transport clientCredentialType="Windows" protectionLevel="EncryptAndSign" /> <message clientCredentialType="Windows" /> </security> </binding> </netTcpBinding> <basicHttpBinding> <binding name="basicHttpWindows"> <security mode="TransportCredentialOnly"> <transport clientCredentialType="Windows"></transport> </security> </binding> </basicHttpBinding> </bindings> <client> <endpoint address="net.tcp://5d2x23j.panint.com/netTCPwindows/Service1.svc" binding="netTcpBinding" bindingConfiguration="netTcpBindingEndpoint" contract="ServiceReference1.IService1" name="netTcpBindingEndpoint" behaviorConfiguration="ImpersonationBehaviour"> <identity> <dns value="localhost" /> </identity> </endpoint> </client> <behaviors> <endpointBehaviors> <behavior name="ImpersonationBehaviour"> <clientCredentials> <windows allowedImpersonationLevel="Impersonation" allowNtlm="true"/> </clientCredentials> </behavior> </endpointBehaviors> <serviceBehaviors> <behavior name="WCFTopWindowsTest.basicHttpWindowsBehaviour"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="true" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="true" /> </behavior> </serviceBehaviors> </behaviors> <services> <service name="WCFTopWindowsTest.Service1" behaviorConfiguration="WCFTopWindowsTest.basicHttpWindowsBehaviour"> <endpoint address="" binding="basicHttpBinding" bindingConfiguration="basicHttpWindows" name ="basicHttpBindingEndpoint" contract ="WCFTopWindowsTest.IService1"> </endpoint> </service> </services> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> </system.serviceModel> <system.webServer> <modules runAllManagedModulesForAllRequests="true" /> <directoryBrowse enabled="true" /> </system.webServer> </configuration> then finally the service for the netTCP layer <?xml version="1.0" encoding="UTF-8"?> <configuration> <system.web> <authentication mode="Windows"></authentication> <authorization> <allow roles="*"/> </authorization> <compilation debug="true" targetFramework="4.0" /> <identity impersonate="true" /> </system.web> <system.serviceModel> <bindings> <netTcpBinding> <binding name="netTCPwindows"> <security mode="Transport"> <transport clientCredentialType="Windows"></transport> </security> </binding> </netTcpBinding> </bindings> <services> <service behaviorConfiguration="netTCPwindows.netTCPwindowsBehaviour" name="netTCPwindows.Service1"> <endpoint address="" bindingConfiguration="netTCPwindows" binding="netTcpBinding" name="netTcpBindingEndpoint" contract="netTCPwindows.IService1"> <identity> <dns value="localhost" /> </identity> </endpoint> <endpoint address="mextcp" binding="mexTcpBinding" contract="IMetadataExchange"/> <host> <baseAddresses> <add baseAddress="net.tcp://localhost:8721/test2" /> </baseAddresses> </host> </service> </services> <behaviors> <serviceBehaviors> <behavior name="netTCPwindows.netTCPwindowsBehaviour"> <!-- To avoid disclosing metadata information, set the value below to false and remove the metadata endpoint above before deployment --> <serviceMetadata httpGetEnabled="false" /> <!-- To receive exception details in faults for debugging purposes, set the value below to true. Set to false before deployment to avoid disclosing exception information --> <serviceDebug includeExceptionDetailInFaults="true" /> </behavior> </serviceBehaviors> </behaviors> <serviceHostingEnvironment multipleSiteBindingsEnabled="true" /> </system.serviceModel> <system.webServer> <modules runAllManagedModulesForAllRequests="true" /> <directoryBrowse enabled="true" /> </system.webServer> </configuration>

    Read the article

  • Memory in Eclipse

    - by user247866
    I'm getting the java.lang.OutOfMemoryError exception in Eclipse. I know that Eclipse by default uses heap size of 256M. I'm trying to increase it but nothing happens. For example: eclipse -vmargs -Xmx16g -XX:PermSize=2g -XX:MaxPermSize=2g I also tried different settings, using only the -Xmx option, using different cases of g, G, m, M, different memory sizes, but nothing helps. Does not matter which params I specify, the heap exception is thrown at the same time, so I assume there's something I'm doing wrong that Eclipse ignores the -Xmx parameter. I'm using a 32GB RAM machine and trying to execute something very simple such as: double[][] a = new double[15000][15000]; It only works when I reduce the array size to something around 10000 on 10000. I'm working on Linux and using the top command I can see how much memory the Java process is consuming; it's less than 2%. Thanks!

    Read the article

  • What are the essential COM componenets required for burning DVD in c#.net in Windows XP?

    - by shruti
    im trying to burn DVD/CD through frontend C#.net code... i have used IMAPI2 for buring CD/DVD in windows XP..but it is giving me unhandeled exception... as:- System.InvalidCastException: Unable to cast COM object of type 'IMAPI2.Interop.MsftFileSystemImageClass' to interface type 'IMAPI2.Interop.MsftFileSystemImage'. This operation failed because the QueryInterface call on the COM component for the interface with IID '{7CFF842C-7E97-4807-8304-910DD8F7C051}' failed due to the following error: No such interface supported (Exception from HRESULT: 0x80004002 (E_NOINTERFACE)) can anyone plz help me out to solve this pbm...im not able to solve this error.. this project is working fine in Windows7 but unable to work with XP...???

    Read the article

  • Graphics.FromHwnd(IntPtr.Zero) returns null, why?

    - by Martin Moser
    I'm currently investigating a problem with a 3rd party component (DevExpress) in my application. My issue is quite similar to this one DevExpress KB article. I get the same exception with more less the same stacktrace. So I used .NET Reflector to find out, what may be null in this scenario, and the only object which is a candiate to be null is Graphics. This is created with Graphics.FromHwnd(IntPtr.Zero). Because I don't have a broad knowledge about GDI, I would like to know if somebody can tell me possible scenarios when this may return null... I tried to reproduce it in a scenario where windows is out of GDI handle's, but then I'm getting a "out of handles" - exception at least once, which is not the case in the issue I'm investigating tia, Martin

    Read the article

  • NHibernate ManyToMany Relationship Cascading AllDeleteOrphan StackOverflowException

    - by Chris
    I have two objects that have a ManyToMany relationship with one another through a mapping table. Though, when I try to save it, I get a stack overflow exception. The following is the code for the mappings: //EventMapping.cs HasManyToMany(x => x.Performers).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("EventId").ChildKeyColumn("PerformerId"); //PerformerMapping.cs HasManyToMany<Event>(x => x.Events).Table("EventPerformer").Inverse().Cascade.AllDeleteOrphan().LazyLoad().ParentKeyColumn("PerformerId").ChildKeyColumn("EventId"); When I change the performermapping.cs to Cascade.None() I get rid of the exception but then my Event Object doesn't have the performer I associate with it. //In a unit test, paraphrased event.Performers.Add(performer); //Event eventRepository.Save<Event>(event); eventResult = eventRepository.GetById<Event>(event.id); //Event eventResult.Performers[0]; //is null, should have performer in it How should I be writing this properly? Thanks

    Read the article

  • SQL Server (2005) Linked Server Issue

    - by David.Chu.ca
    I have SQL Server 2005 with several linked server defined. One of them is a connection to an Oracle server and another one is an ODBC bridge to another server on a remote machine (ODBC server). Recently I tried to use the linked server to Oracle to update data with two large size tables by using several joints. The update query took too long time and finally there was exception thrown: Update O set value = l.value FROM OracleServer..schema.largesizeTable O Join localLargeSizeTable l on .... The problem is that after the exception, I realized that another linked server to ODBC was not working any more. I had to restart SQL server to get the ODBC linked server back. It looks that the linked server pool could be crashed if any of them failed(not like sandbox in Chrome for each tab and no impact on other tabs or Chrome application at all). I am not sure if my assumption is correct or not. Is this a known issue of SQL server 2005?

    Read the article

  • Do minidump files contain the timestamp of the crash?

    - by Roger Lipscombe
    The MiscInfoStream in a minidump file contains the process create time. I'd like to find out how long the process has been running for before the crash. Does a minidump file contain the exception timestamp anywhere? WinDbg on this dump file displays the following, which implies that it's in there somewhere... Debug session time: Tue Dec 29 15:49:20.000 2009 (GMT+0) System Uptime: not available Process Uptime: 0 days 0:33:03.000 Note that today's Mar 15, so this is almost certainly the timestamp of the crash. I'd like a programmatic way to retrieve that value and the "Process Uptime" value. I found the MINIDUMP_MISC_INFO_3 structure, which contains some timezone information, but it doesn't seem to contain the exception time.

    Read the article

  • Techniques to avoid DeadlineExceededException in GAE/J?

    - by Tahir Akram
    I am developing an Twitter4J web application in Google App Engine/Java. I need to show two lists. One is Twitter friends and other is followers. With photo and screen name. It is working fine for people who have 20-30 followers and friends. But it gave me DeadlineExceededException when I try a user who has 150+ followers and friends. GAE throws this exception if web request take time more than 30 seconds. So what techniques I can adopt to avoid this exception. Should I generate two AJAX calls for each of my list. After page loads. So that every call will have its own 30 secs limit? Or what else you think? I am gone make it. Please help.

    Read the article

  • Request header is too large

    - by stck777
    I found serveral IllegalStateException Exception in the logs: [#|2009-01-28T14:10:16.050+0100|SEVERE|sun-appserver2.1|javax.enterprise.system.container.web|_ThreadID=26;_ThreadName=httpSSLWorkerThread-80-53;_RequestID=871b8812-7bc5-4ed7-85f1-ea48f760b51e;|WEB0777: Unblocking keep-alive exception java.lang.IllegalStateException: PWC4662: Request header is too large at org.apache.coyote.http11.InternalInputBuffer.fill(InternalInputBuffer.java:740) at org.apache.coyote.http11.InternalInputBuffer.parseHeader(InternalInputBuffer.java:657) at org.apache.coyote.http11.InternalInputBuffer.parseHeaders(InternalInputBuffer.java:543) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.parseRequest(DefaultProcessorTask.java:712) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.doProcess(DefaultProcessorTask.java:577) at com.sun.enterprise.web.connector.grizzly.DefaultProcessorTask.process(DefaultProcessorTask.java:831) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.executeProcessorTask(DefaultReadTask.java:341) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:263) at com.sun.enterprise.web.connector.grizzly.DefaultReadTask.doTask(DefaultReadTask.java:214) at com.sun.enterprise.web.portunif.PortUnificationPipeline$PUTask.doTask(PortUnificationPipeline.java:380) at com.sun.enterprise.web.connector.grizzly.TaskBase.run(TaskBase.java:265) at com.sun.enterprise.web.connector.grizzly.ssl.SSLWorkerThread.run(SSLWorkerThread.java:106) |#] Does anybody know configuration changes to fix this?

    Read the article

  • LINQ-to-entities - Null reference

    - by BlueRaja
    I could swear this was working the other day: var resultSet = (from o in _entities.Table1 where o.Table2.Table3.SomeColumn == SomeProperty select o ).First(); SelectedItem = resultSet.Table2.SomeOtherColumn; I am getting a null reference exception on the last line: resultSet.Table2 is null. Not only am I sure that all the foreign keys and whatnot have the correct values, but I don't see how Table2 could be null, since o.Table2.Table3.SomeColumn == SomeProperty. resultSet is being returned with all its properties set to the correct values, with the exception that Table2 is null.

    Read the article

  • Cannot execute a program. The command being executed "dqiitg0c.cmdline"

    - by Laxman
    i have used impersonation in this application. whenever this error occurs i required to restart the IIS.. please guide me to solve this issue. Error: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline". Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Runtime.InteropServices.ExternalException: Cannot execute a program. The command being executed was "C:\Windows\Microsoft.NET\Framework64\v2.0.50727\csc.exe" /noconfig /fullpaths @"C:\Windows\Microsoft.NET\Framework64\v2.0.50727\Temporary ASP.NET Files\root\c825d188\1fae8a71\dqiitg0c.cmdline".

    Read the article

  • A generic error occurred in GDI+.

    - by Pinu
    A generic error occurred in GDI+ [ExternalException (0x80004005): A generic error occurred in GDI+.] System.Drawing.Image.Save(Stream stream, ImageCodecInfo encoder, EncoderParameters encoderParams) +615257 I have a webpage in which a pdf is converted to png, and using the response.outputstream it is displayed. when i run this on my local machine is works fine. but when i run the same code on server is throws this exception. my question is , where i could look in for error. as there is no inner exception or any other information provided. only clue is that it's happening on Image.Save , but the same code works perfectly fine on my local machine , then y is it not working on production???

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • A SelfHosted WCF Service over Basic HTTP Binding doesn't support more than 1000 concurrent requests

    - by Krishnan
    I have self hosted a WCF Service over BasicHttpBinding consumed by an ASMX Client. I'm simulating a concurrent user load of 1200 users. The service method takes a string parameter and returns a string. The data exchanged is less than 10KB. The processing time for a request is fixed at 2 seconds by having a Thread.Sleep(2000) statement. Nothing additional. I have removed all the DB Hits / business logic. The same piece of code runs fine for 1000 concurrent users. I get the following error when I bump up the number to 1200 users. System.Net.WebException: The underlying connection was closed: An unexpected error occurred on a receive. ---> System.IO.IOException: Unable to read data from the transport connection: An existing connection was forcibly closed by the remote host. ---> System.Net.Sockets.SocketException: An existing connection was forcibly closed by the remote host at System.Net.Sockets.Socket.Receive(Byte[] buffer, Int32 offset, Int32 size, SocketFlags socketFlags) at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) --- End of inner exception stack trace --- at System.Net.Sockets.NetworkStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.PooledStream.Read(Byte[] buffer, Int32 offset, Int32 size) at System.Net.Connection.SyncRead(HttpWebRequest request, Boolean userRetrievedStream, Boolean probeRead) --- End of inner exception stack trace --- at System.Web.Services.Protocols.WebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.HttpWebClientProtocol.GetWebResponse(WebRequest request) at System.Web.Services.Protocols.SoapHttpClientProtocol.Invoke(String methodName, Object[] parameters) at WCF.Throttling.Client.Service.Function2(String param) This exception is often reported on DataContract mismatch and large data exchange. But never when doing a load test. I have browsed enough and have tried most of the options which include, Enabled Trace & Message log on server side. But no errors logged. To overcome Port Exhaustion MaxUserPort is set to 65535, and TcpTimedWaitDelay 30 secs. MaxConcurrent Calls is set to 600, and MaxConcurrentInstances is set to 1200. The Open, Close, Send and Receive Timeouts are set to 10 Minutes. The HTTPWebRequest KeepAlive set to false. I have not been able to nail down the issue for the past two days. Any help would be appreciated. Thank you.

    Read the article

  • Android serialization: ImageView

    - by embo
    I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

    Read the article

< Previous Page | 168 169 170 171 172 173 174 175 176 177 178 179  | Next Page >