Search Results

Search found 90197 results on 3608 pages for 'data type conversion'.

Page 181/3608 | < Previous Page | 177 178 179 180 181 182 183 184 185 186 187 188  | Next Page >

  • How to embed word doc as background picture of an Access report using .EMF or equivalent ?

    - by iDevlop
    My company's standard paper has logo, address and all the details in the right margin with a vertical blue line. I have that as a word template. I want to have the same thing as the background of my Invoices report. I managed to do that 5 years ago by saving to EMF format (vector format, prints out nicely) and putting the file as the background of the report. Now my company is moving, and I need to change the address on my invoices, but I can't find out how I did to convert the word doc to EMF. Any suggestion ? By EMF or another process, but I want to avoid BMP, which is huge and does not print nicely. Thanks !

    Read the article

  • How to achieve redundancy across data centers?

    - by BrandonBT
    I have a LAMP server with a lot of hardware redundancy built in. I am not worried about the server becoming unavailable. What I am worried about, however, are potential network issues in the data center the server is in. What I would like to have is another server in another data center for redundancy. Load balancing is less of a concern. With that said, I am relatively clueless on two points: How to have two servers in two geographically separate data centers that have exactly the same data, in terms of both files and MySQL databases. How to ensure that all traffic coming into one data center are automatically transferred to the other database in the case of a network or server failure at the first data center. Any guidance on how to accomplish the above two problems would be greatly appreciated.

    Read the article

  • Batch converting video from avc1 to xvid

    - by Tommy Brunn
    I need a way to batch convert 720p video files from avc1 to xvid in Ubuntu 10.04. I'm not terribly concerned about file size, but I do wish to retain the picture quality as much as possible. I believe the audio is encoded as aac, which is fine for my purposes. What would be the best and easiest way to do this? I've tried using Handbrake. During my first attempt, I had it using ffmpeg to convert to MPEG-4, but that just gave me a super-low quality video at twice the file size. Trying h.264 now, so we'll see how that works out. But just in case it doesn't pan out so well, what other ways do you recommend? I was thinking I'd write a bash script to reencode the files one by one, but the problem is that I have very little knowledge about codecs and containers and whatnot - so I wouldn't know what parameters I would pass ffmpeg/mencoder.

    Read the article

  • how to know if a video file can be played on a dvd player

    - by user23950
    Is there an application that can emulate a dvd player? I've converted a .mp4 video using allok video converter. And choose the output format to be xVid(.avi)<--that is exactly what is written on the application. I don't want to waste a blank dvd and try if it really can be played. So if you have tried this before please tell me if it works. And I have tried burning .avi files and it works because they are genuine avi files which I did not convert

    Read the article

  • Flatten Word document

    - by user126389
    I have a document with some precise formatting, created in Word. This doc was converted to PDF for distribution. Now the original is lost, and reconverting to Word using a PDF to word add-on from Microsoft results in many text boxes in the new DOC file. How can I 'flatten' this to remove the text boxes and retain most of the formatting in order to update the contents? Recreating the original formatting would take a long time.

    Read the article

  • ffmpeg - creating DNxHD MFX files with alphas

    - by Hugh
    I'm struggling with something in FFMpeg at the moment... I'm trying to make DNxHD 1080p/24, 36Mb/s MXF files from a sequence of PNG files. My current command-line is: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mxf -pix_fmt rgb32 -b 36Mb /tmp/temp.mxf To which ffmpeg gives me the output: Input #0, image2, from '/tmp/temp.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mxf, to '/tmp/temp.mxf': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 [mxf @ 0x1005800]unsupported video frame rate Could not write header for output file #0 (incorrect codec parameters ?) There are a few things in here that concern me: The output stream is insisting on being yuv422p, which doesn't support alpha. 24fps is an unsupported video frame rate? I've tried 23.976 too, and get the same thing. I then tried the same thing, but writing to a quicktime (still DNxHD, though) with: ffmpeg -y -f image2 -i /tmp/temp.%04d.png -s 1920x1080 -r 24 -vcodec dnxhd -f mov -pix_fmt rgb32 -b 36Mb /tmp/temp.mov This gives me the output: Input #0, image2, from '/tmp/1274263259.28098.%04d.png': Duration: 00:00:01.60, start: 0.000000, bitrate: N/A Stream #0.0: Video: png, rgb32, 1920x1080, 25 tbr, 25 tbn, 25 tbc Output #0, mov, to '/tmp/1274263259.28098.mov': Stream #0.0: Video: dnxhd, yuv422p, 1920x1080, q=2-31, 36000 kb/s, 90k tbn, 24 tbc Stream mapping: Stream #0.0 -> #0.0 Press [q] to stop encoding frame= 39 fps= 9 q=1.0 Lsize= 7177kB time=1.62 bitrate=36180.8kbits/s video:7176kB audio:0kB global headers:0kB muxing overhead 0.013636% Which obviously works, to a certain extent, but still has the issue of being yuv422p, and therefore losing the alpha. If I'm going to QuickTime, then I can get what I need using Shake, but my main aim here is to be able to generate .mxf files. Any thoughts? Thanks

    Read the article

  • Recovering damaged external hard disk by installing internally

    - by nfarshchi
    I had a 1TB Western Digital (My book series) 3.5" USB3. One day, the SATA to USB3 converter board was damaged and has not worked since. I decided to open the cover and use the HDD as an internal HDD. When I attached the HDD to my PC and booted up in Windows, it asked me which type of ????? I want to use "MBR or GBR" (I dont remember the exact question) I chose MBR and Windows gave me a 1TB empty Hard drive. I tried to recover with recover my files and some other recovery programs but no success. Some one told me that you should choosed GBR instead of MBR . How can I do that now? Another guy told me that the SATA to USB3 converter board is coded to save data on HDD and you can not use them internally without losing data, and I should find another SATA to USB3 board (exact same). It is impossible to find because they are not produced any more. Please help me to find a solution to bring back my data. UPDATE I have 1TB WD "Mybook" USB 3. the board that convert sata to usb3 was damaged. so when the HDD was in the box computer did not recognize it. I opened the box and remove HDD to use it internal. after connecting to my PC windows showed me one massage that I had two choice MBR or GPT I choosed MBR one and windows gave me 1TB empty new volume. I tried many recovery software to recover my data but no success. I brought it to one expert recovery company and they told me the converter board (SATA to USB3) make some encryption on data and with out that board you cannot recover any thing. so I bought another empty WD box and put the HDD inside but even after that also there is no file. I tried to recover again in this state but no success. so I have some unanswered question. does this converted boards make any password or encryption? if yes how can I solve it? does using many recovery programs affected my data? any suggestion or solution for bring back my data? I had use recovery programs such as : recover my files , EaseUS data recovery, easy recovery, test disk, Ontrack easy recovery . Note: when I was using test disk it asked me to choose which partition table I want to use. as it was I choose NTFS, does this made any change on data?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • How to convert a power point pdf to a pdf that is easy to read on kindle?

    - by SpaceTrucker
    I have several power point presentations as pdfs. I would like to read them on the original kindle in landscape format. When I read the original on the kindle then a single slide won't fit on the kindles display. I thought the easiest way to convert the pdf was to repring it with a pdf printer. However I don't know the paper size to use. I already tried using Calibre as suggested by this question. However the output is not usable because of formatting issues. So what paper size should I use for the pdf printer to reprint them in landscape format or are there any other tools I could use for that task?

    Read the article

  • Convert file from VOC to MP3

    - by Thomas
    I would like to convert a sound file (from a digital voice recorder) with the extension .voc to an .mp3 file or some other common sound files. I am on Windows 7 64 bit. I have tried the program voc2wav but it gives me an error message saying that the program isn't 64 bit. The program has to be free and able to run without installing. (The voice recorder did come with a program that I could install, but I would like to avoid that).

    Read the article

  • Importer or converter for ClarisWorks cwk format?

    - by Justin Dearing
    I have several ClarisWorks documents (*.CWK) that I'd like to import into a more modern format like Microsoft Word or Open Office. It seems Star Office can apparently open cwk files, but the product is discontinued and cannot be downloaded any more. There has been a feature request to add a cwk importer to OpenOffice since 2002, so I doubt that OpenOffice will support cwk files any time soon. Are there any utilities that can open a cwk file besides ClarisWorks itself?

    Read the article

  • creating video from set of images on windows with java language [on hold]

    - by Atif
    I am stuck in making video from set of images, i am using ffmpeg tool on windows platform with java language, for single image it is converting into mp4 but for the set of images it gets failed, i have converted single % to double % with doube quotes but unsuccessful ffmpeg -r 1/5 -i "D:\novoworkspace\MGram\src\biz\novosol\mgram\main\img%%04d.jpg" -c:v libx264 -r 30 -pix_fmt yuv420p D:\novoworkspace\MGram\src\biz\novosol\mgram\main\video.mp4 Above is the exact command i tried from the command line as well from the java language with getRuntime() method. Environment is widows please suggest is it possibe under windows or I have to use some alternative Thanks Atif

    Read the article

  • Is there a good, free way to fix broken/corrupt .wmv files?

    - by chbtn
    I've recovered some files from an hdd that weren't supposed to be deleted in the first place, but they have seeking problems/crash the players. Since they have the right size, I'm thinking it might be a problem of corrupt index/header, so I'm trying to find a way to fix them. It's easy to find examples on how to fix corrupt .avi files with mencoder, but .wmv seems trickier. Also, I realize there might not be a way to fix these files, but I figure I might as well as try. As far as players go, I've tried opening it with vlc/mplayer/windows media player. I can use anything on Windows XP/7 and Ubuntu, as long as it's free. Since the files are 200mb+ and there are quite a few, I don't think trial software would work.

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

  • How to run a command from anywhere in Mac OS X

    - by pabloruiz55
    I need to use a command for converting my images to pvrtc. It is located in /Developer/Platforms/iPhoneOS.platform/Developer/usr/bin/texturetool. Right now I have to be inside that folder to be able to use the command. How can I set it up so I can run this command from anywhere? Thanks

    Read the article

  • How to convert a 1 page PDF to a 2 page per sheet PDF?

    - by mokasin
    I would like to print a PDF so that on the front of the first page are the first two pages, on the back the 3rd and 4th and so on. ----------------- ----------------- | | | | | | | | | | | | | 1 | 2 | | 3 | 4 | . . . | | | | | | |_______|_______| |_______|_______| page 1 - front page 1 - front Because my printer using Linux fails to support manual duplex printing I'd thought, maybe I could edit the pdf in a according way. But how?

    Read the article

  • How can I reorder parts of a video file

    - by sandeep
    I have download a mkv movie file which gave me 3 files suffixed .001, .002, and .003. When i join them together with different tools like winrar, 7zip, hjsplit, concatenated file shows only last 40 min/1.22 hrs of the total length of the movie. If I play all the (.001, .002, .003) parts with vlc player, I can see that .003 is the first part of the video and .001 is the last part. Can anyone tell me how can join this parts of movie with correct position or how I can convert .003 file into .001 file.

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

< Previous Page | 177 178 179 180 181 182 183 184 185 186 187 188  | Next Page >