Search Results

Search found 12376 results on 496 pages for 'active pattern'.

Page 187/496 | < Previous Page | 183 184 185 186 187 188 189 190 191 192 193 194  | Next Page >

  • Method hiding with interfaces

    - by fearofawhackplanet
    interface IFoo { int MyReadOnlyVar { get; } } class Foo : IFoo { int MyReadOnlyVar { get; set; } } public IFoo GetFoo() { return new Foo { MyReadOnlyVar = 1 }; } Is the above an acceptable way of implementing a readonly/immutable object? The immutability of IFoo can be broken with a temporary cast to Foo. In general (non-critical) cases, is hiding functionality through interfaces a common pattern? Or is it considered lazy coding? Or even an anti-pattern?

    Read the article

  • Using attr_accessible in a join model with has_many :through relationship

    - by Paulo Oliveira
    I have a USER that creates a COMPANY and become an EMPLOYEE in the process. The employees table has an :user_id and a :company_id. class User has_many :employees has_many :companies, :through => :employees class Employee belongs_to :user belongs_to :company attr_accessible :active class Company has_many :employees has_many :users, :through => employees Pretty basic. But here's the thing, the resource EMPLOYEE has other attributes than its foreign keys, like the boolean :active. I would like to use attr_accessible, but this causes some problems. The attribute :user_id is set right, but :company_id is nil. @user.companies << Company.new(...) Employee id:1 user_id:1 company_id:nil So my question is: if :user_id is set right, despite it is not an attr_accessible, why :company_id isn't set right just the same? It shouldn't be an attr_accessible. I'm using Rails 3.0.8, and have also tested with 3.0.7.

    Read the article

  • Python: using a regular expression to match one line of HTML

    - by skylarking
    This simple Python method I put together just checks to see if Tomcat is running on one of our servers. import urllib2 import re import sys def tomcat_check(): tomcat_status = urllib2.urlopen('http://10.1.1.20:7880') results = tomcat_status.read() pattern = re.compile('<body>Tomcat is running...</body>',re.M|re.DOTALL) q = pattern.search(results) if q == []: notify_us() else: print ("Tomcat appears to be running") sys.exit() If this line is not found : <body>Tomcat is running...</body> It calls : notify_us() Which uses SMTP to send an email message to myself and another admin that Tomcat is no longer runnning on the server... I have not used the re module in Python before...so I am assuming there is a better way to do this... I am also open to a more graceful solution with Beautiful Soup ... but haven't used that either.. Just trying to keep this as simple as possible...

    Read the article

  • Sign in as different user when using Integrated Windows Authentication

    - by Sam
    I have restricted access to a site by using Integrated Windows Authentication and turning off anonymous access. This way I can then show them their real name (from looking up on Active Directory and using the server variable LOGON_USER) and do other related Active Directory tasks. How can I then prompt again for their user credentials, through a 'sign in as other user' link , showing the browser prompt (like you would get on a browser like Chrome or Firefox, or if the site was not in the 'Intranet' zone in IE) rather than a Web Form? Since SharePoint offers this functionality, I assume there is a way to do this through code, but I don't know what code can do this (using C#). I can send a 401 header which makes the prompt appear, but how do you then confirm if they are logged in?

    Read the article

  • Querying MySQL with CodeIgniter, selecting rows where field is NULL

    - by rebellion
    I'm using CodeIgniter's Active Record class to query the MySQL database. I need to select the rows in a table where a field is not set to NULL: $this->db->where('archived !=', 'NULL'); $q = $this->db->get('projects'); That only returns this query: SELECT * FROM projects WHERE archived != 'NULL'; The archived field is a DATE field. Is there a better way to solve this? I know I can just write the query myself, but I wan't to stick with the Active Record throughout my code.

    Read the article

  • How do I execute a cmd in C#, then in the same window execute another command that follows?

    - by Ashh
    Hey Guys, Right what im trying to accomplish is a program that basically sets the active partition in 1 click, saving the effort time and skill of using cmd prompt etc. I have looked into the System.Management name space but couldn't work out how to use it :( So i have resorted to using CMD, i have got a module application written in C# and basically i want to run "DISKPART" which then starts the diskpart in the cmd window, then i want to ask it to "Select disk 0" followed by "select partition 1" finally followed by "active". Doing this in CMD yourself works fine but with an application its proved to be awkward :( What ive managed to get it to do is run DiskPart fine in one window with Process.Start, then get it to open a new window and run the next piece of code but because the new window hasnt ran the diskpart cmd it doesnt work :( Any suggestions? Thanks! Ash

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Linq to Entities - left Outer Join

    - by user255234
    Could you please help me to figure this one out? I need to replace a join with OSLP table with OUTER join. Seems a bit tricky for someone who is not an expert in Linq to entities. How would I do that? var surgeonList = ( from item in context.T1_STM_Surgeon .Include("T1_STM_SurgeonTitle") .Include("OTER") where item.ID == surgeonId join reptable in context.OSLP on item.Rep equals reptable.SlpCode select new { ID = item.ID, First = item.First, Last = item.Last, Rep = reptable.SlpName, Reg = item.OTER.descript, PrimClinic = item.T1_STM_ClinicalCenter.Name, Titles = item.T1_STM_SurgeonTitle, Phone = item.Phone, Email = item.Email, Address1 = item.Address1, Address2 = item.Address2, City = item.City, State = item.State, Zip = item.Zip, Comments = item.Comments, Active = item.Active, DateEntered = item.DateEntered }).ToList(); Thanks in advance!!

    Read the article

  • WPF - Handling events from user control in View Model

    - by Vitaly
    I’m building a WPF application using MVVM pattern (both are new technologies for me). I use user controls for simple bits of reusable functionality that doesn’t contain business logic, and MVVM pattern to build application logic. Suppose a view contains my user control that fires events, and I want to add an event handler to that event. That event handler should be in the view model of the view, because it contains business logic. The question is – view and the view model are connected only by binding; how do I connect an event handler using binding? Is it even possible (I suspect not)? If not – how should I handle events from a control in the view model? Maybe I should use commands or INotifyPropertyChanged?

    Read the article

  • PHP regex help -- reverse search?

    - by Ian Silber
    So, I have a regex that searches for HTML tags and modifies them slightly. It's working great, but I need to do something special with the last closing HTML tag I find. Not sure of the best way to do this. I'm thinking some sort of reverse reg ex, but haven't found a way to do that. Here's my code so far: $html = "<div id="test"><p style="hello_world">This is a test.</p></div>"; $pattern = array('/<([A-Z][A-Z0-9]*)(\b[^>]*)>/i'); $replace = array('<tag>'); $html = preg_replace($pattern,$replace,$html); // Outputs: <tag><tag>This is a test</p></div> I'd like to replace the last occurance of "" with something special, say for example, "". Any ideas?

    Read the article

  • Better exception for non-exhaustive patterns in case

    - by toofarsideways
    Is there a way to get GHCi to produce better exception messages when it finds at runtime that a call has produced value that does not match the function's pattern matching? It currently gives the line numbers of the function which produced the non-exhaustive pattern match which though helpful at times does require a round of debugging which at times I feel is doing the same set of things over and over. So before I tried to put together a solution I wanted to see if something else exists. An exception message that in addition to giving the line numbers shows what kind of call it attempted to make? Is this even possible?

    Read the article

  • Using free function as pseudo-constructors to exploit template parameter deduction

    - by Poita_
    Is it a common pattern/idiom to use free functions as pseudo-constructors to avoid having to explicitly specify template parameters? For example, everyone knows about std::make_pair, which uses its parameters to deduce the pair types: template <class A, class B> std::pair<A, B> make_pair(A a, B b) { return std::pair<A, B>(a, b); } // This allows you to call make_pair(1, 2), // instead of having to type pair<int, int>(1, 2) // as you can't get type deduction from the constructor. I find myself using this quite often, so I was just wondering if many other people use it, and if there is a name for this pattern?

    Read the article

  • PDF text search and split library

    - by Horace Ho
    I am look for a server side PDF library (or command line tool) which can: split a multi-page PDF file into individual PDF files, based on a search result of the PDF file content Examples: Search "Page ???" pattern in text and split the big PDF into 001.pdf, 002,pdf, ... ???.pdf A server program will scan the PDF, look for the search pattern, save the page(s) which match the patten, and save the file in the disk. It will be nice with integration with PHP / Ruby. Command line tool is also acceptable. It will be a server side (linux or win32) batch processing tool. GUI/login is not supported. i18n support will be nice but no required. Thanks~

    Read the article

  • In C, how do you capture a group with regex?

    - by Sylvain
    Hi, I'm trying to extract a string from another using regex. I'm using the POSIX regex functions (regcomp, regexec ...), and I fail at capturing a group ... For instance, let the pattern be something as simple as "MAIL FROM:<(.*)>" (with REG_EXTENDED cflags) I want to capture everything between '<' and '' My problem is that regmatch_t gives me the boundaries of the whole pattern (MAIL FROM:<...) instead of just what's between the parenthesis ... What am I missing ? Thanks in advance,

    Read the article

  • Java Time Zone When Parsing DateFormat

    - by shipmaster
    I had code that parses date as follows: String ALT_DATE_TIME_FORMAT = "yyyy-MM-dd'T'HH:mm:ss.SSSZ"; SimpleDateFormat sdf = new SimpleDateFormat( ALT_DATE_TIME_FORMAT); Date date = sdf.parse(requiredTimeStamp); And it was working fine, suddenly, this stopped working. It turns out an admin made some config changes on the server and the date is currently being returned as "2010-12-27T10:50:44.000-08:00" which is not parse-able by the above pattern. I have two questions: The first would be what pattern would parse the date being returned by the JVM in the format above (specifically, just '-08:00' as the time zone)? And second, where exactly would one change such settings on a linux RHEL 5 server so that we are aware of such changes in the future?

    Read the article

  • how to modify this jquery syntax

    - by Gandalf StormCrow
    Hi all, this example below works when hover event is trigered and when its not, its working for elements already in DOM, but when element created dynamically it doesn't work, I realize I need to use jQuery live() or delegate() for this, the thing is I tried to modify it and its not producing the results as expected, here is the working code : $(".sidebar li").hover( function(){ $(this).css("background-color", "#F9F4D0"); $(this).append($('<button class="promoter" type="button" title="Active promotion"></button>')); }, function(){ $(this).css("background-color", "#F9FAFA"); $(this).children("button").remove(); } ); Here is the bit when I wanted to add live but it's not producing correct results : $(".sidebar li").live('hover', function(){ $(this).css("background-color", "#F9F4D0"); $(this).append($('<button class="promoter" type="button" title="Active promotion"></button>')); }, function(){ $(this).css("background-color", "#F9FAFA"); $(this).children("button").remove(); } ); Where did I made mistake, thank you

    Read the article

  • wpf datagrid textbox + combobox

    - by Muhammad Adnan
    I have wpf datagrid with number of template columns. some of them have textbox in them in edit mode and some combobox. i need to give cut/copy/paste facility to user from main menu (ribbon) buttons of my application. when i select some text from textbox and press copy button from main menu. copy button becomes active control so i loose textbox as active control by which i could get selected text. (any solution for this) and second thing i wanted to ask... is there any event get fired when we select textbox's contents? or solution would be appreciated. Thanks in advance...

    Read the article

  • How do you write a consistent UI Automation for MS? MSAA & UI Automation don't seem to overlap.

    - by Greg
    Working on a general Automation tool, considering moving from Win32 Message hooks to .net UI Automation, however the feature set of UI Automation doesn't cover all we have in Win32 and still doesn't seem to support all the GUI on Windows. One such example is Windows Live Messenger. Windows Live messenger 2009 is still using the older DirectUIHwnd to draw the gui. This means that you can't use windows messages to send to the controls, because the controls don't have their own HWND. It also seems to defeat the new .net UI Automation framework though the documentation seems to make out as if it can be joined in the UI Automation and Microsoft Active Accessibility document. Looking at MS Accessibility pointed to Active Accessibility 2.0 SDK Tools which showed that MSAA can interact with the contents. Is there some trick to getting the older MSAA technology that UI Automation seems to be trying to replace to actually work with UI Automation? I'd rather not have multiple solutions trying to automate the same windows for windows unlike Windows Live Messenger where each of these techniques is valid and will work.

    Read the article

  • Find Methods in a c# File programmatically

    - by sajad
    Hi Friends, I want to write a code to search for method defination and methods called in a c# file. So obviously my pattern should search for text like 1.public void xyz(blahtype blahvalue); 2.string construct = SearchData(blahvalue); Has anyone done similar to this, is Regex helpful in this case. if yes provide me the pattern. Any other workarounds. I dont know reflection(will it help in my case) Thanks, you guys gave it a try, i did not know this wud be so complex. All i wanted to do was suppose i have method like this public method1(int val) { method2(); method3(); } void method2(int val2) { method4() } i wanted to construct a string as Method1:Method2:method4 and Method1:Method3.... I guess its really complex

    Read the article

  • BlazeDS rejected connection from some IP address

    - by Shamal Karunarathne
    Hi, I'm using the BlazeDS binary version with Apache tomcat 6.0. And it seems there's a developer mode active and it only allows 3 IPs to connect to the application (Server). This is what the log says: [BlazeDS]MessageBroker '__default__' rejected connection from address 'xxx.xxx.xx.x'; Developer mode addresses already in use: xxx.x.xxx.xx, xxx.xxx.xxx.xxx, xx.xxx.xxx.xx (IP addresses are masked with 'x' for privacy) I have not added any special configuration to make developer mode active. I couldn't find any resources related to this scenario either. Please help. Thanks in Advance.

    Read the article

  • How to Command Query Responsibility Segregation (CQRS) with ASP.NET MVC?

    - by Jeffrey
    I have been reading about Command Query Responsibility Segregation (CQRS). I sort of wonder how would this work with ASP.NET MVC? I get the idea of CQRS conceptually it sounds nice and sure does introduce some complexities (event and messaging pattern) compared to the "normal/common" approach . Also the idea of CQRS sort of against the use of ORM in some ways. I am trying to think how I could use this pattern in the coming projects so if anyone has experience in combining CQRS with ASP.NET MVC and NHibernate please give some concrete examples to help me better understand CQRS and use with ASP.NET MVC. Thanks!

    Read the article

  • Overwhelmed by design patterns... where to begin?

    - by Pete
    I am writing a simple prototype code to demonstrate & profile I/O schemes (HDF4, HDF5, HDF5 using parallel IO, NetCDF, etc.) for a physics code. Since focus is on IO, the rest of the program is very simple: class Grid { public: floatArray x,y,z; }; class MyModel { public: MyModel(const int &nip1, const int &njp1, const int &nkp1, const int &numProcs); Grid grid; map<string, floatArray> plasmaVariables; }; Where floatArray is a simple class that lets me define arbitrary dimensioned arrays and do mathematical operations on them (i.e. x+y is point-wise addition). Of course, I could use better encapsulation (write accessors/setters, etc.), but that's not the concept I'm struggling with. For the I/O routines, I am envisioning applying simple inheritance: Abstract I/O class defines read & write functions to fill in the "myModel" object HDF4 derived class HDF5 HDF5 using parallel IO NetCDF etc... The code should read data in any of these formats, then write out to any of these formats. In the past, I would add an AbstractIO member to myModel and create/destroy this object depending on which I/O scheme I want. In this way, I could do something like: myModelObj.ioObj->read('input.hdf') myModelObj.ioObj->write('output.hdf') I have a bit of OOP experience but very little on the Design Patterns front, so I recently acquired the Gang of Four book "Design Patterns: Elements of Reusable Object-Oriented Software". OOP designers: Which pattern(s) would you recommend I use to integrate I/O with the myModel object? I am interested in answering this for two reasons: To learn more about design patterns in general Apply what I learn to help refactor an large old crufty/legacy physics code to be more human-readable & extensible. I am leaning towards applying the Decerator pattern to myModel, so I can attach the I/O responsibilities dynamically to myModel (i.e. whether to use HDF4, HDF5, etc.). However, I don't feel very confident that this is the best pattern to apply. Reading the Gang of Four book cover-to-cover before I start coding feels like a good way to develop an unhealthy caffeine addiction. What patterns do you recommend?

    Read the article

  • linq-to-sql "an attempt has been made to attach or add an entity that is not new"?

    - by Curtis White
    I've been getting several errors: cannot add an entity with a key that is already in use An attempt has been made to attach or add an entity that is not new, perhaps having been loaded from another datacontext In case 1, this stems from trying to set the key for an entity versus the entity. In case 2, I'm not attaching an entity but I am doing this: MyParent.Child = EntityFromOtherDataContext; I've been using using the pattern of wrap everything with a using datacontext. In my case, I am using this in a web forms scenario, and obviously moving the datacontext object to a class wide member variables solves this. My questions are thus 2 fold: How can I get rid of these errors and not have to structure my program in an odd way or pass the datacontext around while keeping the local-wrap pattern? I assume I could make another hit to the database but that seems very inefficient. Would most people recommend that moving the datacontext to the class wide scope is desirable for web pages?

    Read the article

  • Help me understand Rails eager loading

    - by aaronrussell
    I'm a little confused as to the mechanics of eager loading in active record. Lets say a Book model has many Pages and I fetch a book using this query: @book = Book.find book_id, :include => :pages Now this where I'm confused. My understanding is that @book.pages is already loaded and won't execute another query. But suppose I want to find a specific page, what would I do? @book.pages.find page_id # OR... @book.pages.to_ary.find{|p| p.id == page_id} Am I right in thinking that the first example will execute another query, and therefore making the eager loading pointless, or is active record clever enough to know that it doesn't need to do another query? Also, my second question, is there an argument that in some cases eager loading is more intensive on the database and sometimes multiple small queries will be more efficient that a single large query? Thanks for your thoughts.

    Read the article

< Previous Page | 183 184 185 186 187 188 189 190 191 192 193 194  | Next Page >