Search Results

Search found 12376 results on 496 pages for 'active pattern'.

Page 186/496 | < Previous Page | 182 183 184 185 186 187 188 189 190 191 192 193  | Next Page >

  • Iterating through tooltips

    - by icemanind
    Guys, I have a windows form with a panel control and inside the panel control are several other controls with a System.Windows.Forms.Tooltip attached to them. How can I iterate through each tooltip and set the Active property of the tooltip to false? Tooltips, unlike other controls, are not actually controls. So I had this: foreach (System.Windows.Forms.Control ctrl in this.pnlControl.Controls) { if (ctrl.Name.StartsWith("tt")) // since all my tooltip names start with 'tt' { System.Windows.Forms.ToolTip TipControl=(System.Windows.Forms.ToolTip)ctrl; TipControl.Active=false; } } This does not work though. It gets an error because the ToolTip control is not inherited from System.Windows.Forms.Control. Any ideas?

    Read the article

  • How to terminate a JBPM processInstance

    - by jie-wang
    Hi all I'm using JBPM 4.3 and trying hard to find a way to terminate one processInstance. First I simply used something like: executionService.endProcessInstance(processInstanceID, "active"); However I got exception thrown out. "exception while executing command org.jbpm.pvm.internal.cmd.EndProcessInstance java.lang.NullPointerException" Then I googled to find this post http://community.jboss.org/thread/146478, which didn't seem to give a resolution. I tried nevertheless to end all executions of the processInstance by calling ((ExecutionImpl) execution).end(); But the same exception was thrown again when I finally try to call executionService.endProcessInstance(processInstanceID, "active"); Did anyone have the same experience and solution?

    Read the article

  • AVR Analog Comparator + Internal Pullup?

    - by vicatcu
    I have what I hope is a simple question pertaining to the Atmel AVR microcontrollers. So I want to use the ATTiny85's Analog Comparator to determine if a signal is above or below a threshold. This signal is normally "floating" and grounded when "active" (i.e. it's an active low - open collector signal). If I enable the pullup on the input pin (which is also the comparator input) by doing: DDRB = 0x00; // DDRB.1 = 0 = input PORTB = 0xFF; // PORTB.1 = 1 = internal pullup enabled If i use the analog comparator and select PORTB.1 as AIN1 will the internal pullup be applied to my input signal? I'm hoping someone has personal experience to verify this behavior. Hope this question isn't too 'hardware-oriented' for stack-overflow. Thanks!

    Read the article

  • Extended with advice: Moving block wont work in Javascript

    - by Mack
    Hello Note: this is an extension of a question I just asked, i have made the edits & taken the advice but still no luck I am trying to make a webpage where when you click a link, the link moves diagonally every 100 milliseconds. So I have my Javascript, but right now when I click the link nothing happens. I have run my code through JSLint (therefore changed comaprisions to === not ==, thats weird in JS?). I get this error from JSLink though: Error: Implied global: self 15,38, document 31 What do you think I am doing wrong? <script LANGUAGE="JavaScript" type = "text/javascript"> <!-- var block = null; var clockStep = null; var index = 0; var maxIndex = 6; var x = 0; var y = 0; var timerInterval = 100; // milliseconds var xPos = null; var yPos = null; function moveBlock() { if ( index < 0 || index >= maxIndex || block === null || clockStep === null ) { self.clearInterval( clockStep ); return; } block.style.left = xPos[index] + "px"; block.style.top = yPos[index] + "px"; index++; } function onBlockClick( blockID ) { if ( clockStep !== null ) { return; } block = document.getElementById( blockID ); index = 0; x = number(block.style.left); // parseInt( block.style.left, 10 ); y = number(block.style.top); // parseInt( block.style.top, 10 ); xPos = new Array( x+10, x+20, x+30, x+40, x+50, x+60 ); yPos = new Array( y-10, y-20, y-30, y-40, y-50, y-60 ); clockStep = self.SetInterval( moveBlock(), timerInterval ); } --> </script> <style type="text/css" media="all"> <!-- @import url("styles.css"); #blockMenu { z-index: 0; width: 650px; height: 600px; background-color: blue; padding: 0; } #block1 { z-index: 30; position: relative; top: 10px; left: 10px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block2 { z-index: 30; position: relative; top: 50px; left: 220px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block3 { z-index: 30; position: relative; top: 50px; left: 440px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block4 { z-index: 30; position: relative; top: 0px; left: 600px; background-color: red; width: 200px; height: 200px; margin: 0; padding: 0; /* background-image: url("images/block1.png"); */ } #block1 a { display: block; width: 100%; height: 100%; } #block2 a { display: block; width: 100%; height: 100%; } #block3 a { display: block; width: 100%; height: 100%; } #block4 a { display: block; width: 100%; height: 100%; } #block1 a:hover { background-color: green; } #block2 a:hover { background-color: green; } #block3 a:hover { background-color: green; } #block4 a:hover { background-color: green; } #block1 a:active { background-color: yellow; } #block2 a:active { background-color: yellow; } #block3 a:active { background-color: yellow; } #block4 a:active { background-color: yellow; } --> </style>

    Read the article

  • Use fileupload as template field in a details view

    - by MyHeadHurts
    I have an admin page where a user will select a document path and add that path to a certain column of a database. I am using a fileupload on the page where they can find the document and copy the path and then paste it into the details view. However, I want to skip this step and I want them to select a document and automatically make the path show up in the details view. <asp:FileUpload ID="FileUpload1" runat="server" Visible="False" Width="384px" /><br /> <br /> <div> <asp:UpdatePanel ID="UpdatePanel1" runat="server" UpdateMode="Conditional"> <ContentTemplate> <center> <asp:DetailsView ID="DetailsView1" runat="server" AllowPaging="True" AutoGenerateRows="False" DataKeyNames="ID" DataSourceID="SqlDataSource1" Height="128px" Width="544px" Visible="False" OnModeChanged="Button2_Click" CellPadding="4" ForeColor="#333333" GridLines="None" > <Fields> <asp:BoundField DataField="Order" HeaderText="Order" SortExpression="Order" /> <asp:BoundField DataField="Department" HeaderText="Department" SortExpression="Department"/> <asp:BoundField DataField="DOC_Type" HeaderText="DOC_Type" SortExpression="DOC_Type" /> <asp:BoundField DataField="Title" HeaderText="Title" SortExpression="Title" /> <asp:BoundField DataField="Revision" HeaderText="Revision" SortExpression="Revision" /> <asp:BoundField DataField="DOC" HeaderText="DOC" SortExpression="DOC" /> <asp:BoundField DataField="Active" HeaderText="Active" SortExpression="Active" /> <asp:BoundField DataField="Rev_Date" HeaderText="Rev_Date" SortExpression="Rev_Date" /> <asp:BoundField DataField="ID" HeaderText="ID" InsertVisible="False" ReadOnly="True" SortExpression="ID" Visible="False" /> <asp:CommandField ShowInsertButton="True" /> </Fields> <FooterStyle BackColor="#5D7B9D" BorderStyle="None" Font-Bold="True" ForeColor="White" /> <CommandRowStyle BackColor="#E2DED6" BorderStyle="None" Font-Bold="True" /> <RowStyle BackColor="#F7F6F3" BorderStyle="None" ForeColor="#333333" /> <FieldHeaderStyle BackColor="#E9ECF1" BorderStyle="None" Font-Bold="True" /> <EmptyDataRowStyle BorderStyle="None" /> <PagerStyle BackColor="#284775" BorderStyle="None" ForeColor="White" HorizontalAlign="Center" /> <HeaderStyle BackColor="#5D7B9D" BorderStyle="None" Font-Bold="True" ForeColor="White" /> <InsertRowStyle BorderStyle="None" /> <EditRowStyle BackColor="#999999" BorderStyle="None" /> <AlternatingRowStyle BackColor="White" BorderStyle="None" ForeColor="#284775" /> </asp:DetailsView> &nbsp; <br /> I need to get the fileupload1 into the DOC contenttemplate area so instead of showing an empty textbox it will show just a textbox it will show the fileupload

    Read the article

  • Static Access To Multiple Instance Variable

    - by Qua
    I have a singleton instance that is referenced throughout the project which works like a charm. It saves me the trouble from having to pass around an instance of the object to every little class in the project. However, now I need to manage multiple instances of the previous setup, which means that the singleton pattern breaks since each instance would need it's own singleton instance. What options are there to still maintain static access to the singleton? To be more specific, we have our game engine and several components and plugins reference the engine through a static property. Now our server needs to host multiple game instances each having their own engine, which means that on the server side the singleton pattern breaks. I'm trying to avoid all the classes having the engine in the constructor.

    Read the article

  • Regular Expression Help in .NET

    - by Matt H.
    I have a simple pattern I am trying to match, any characters captured between parenthesis at the end of an HTML paragraph. I am running into trouble any time there is additional parentheticals in that paragraph: i.e. If the input string is "..... (321)</p" i want to get the value (321) However, if the paragraph has this text: "... (123) (321)</p" my regex is returning "(123) (321)" (everything between the opening "(" and closing ")" I am using the regex pattern "\s(.+)</p" How can I grab the correct value (using VB.NET) This is what I'm doing so far: Dim reg As New Regex("\s\(.+\)</P>", RegexOptions.IgnoreCase) Dim matchC As MatchCollection = reg.Matches(su.Question) If matchC.Count > 0 Then Dim lastMatch As Match = matchC(matchC.Count - 1) Dim DesiredValue As String = lastMatch.Value End If

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • How to activate nVidia cards programmatically on new MacBookPros for CUDA programming?

    - by Carsten Kuckuk
    The new MacBookPros come with two graphic adapters, the Intel HD Graphics, and the NVIDIA GeForce GT 330M. OS X switches back and forth between them, depending on the workload, detection of an external monitor, or activation of Rosetta. I want to get my feet wet with CUDA programming, and unfortunately the CUDA SDK doesn't seem to take care of this back-and-forth switching. When Intel is active, no CUDA device gets detected, and when the NVidia card is active, it gets detected. So my current work-around is to use the little tool gfxCardStatus (http://codykrieger.com/gfxCardStatus/) to force the card on or off, just as I need it, but that's not satisfactory. Does anybody here know what the Apple-blessed, Apple-recommended way is to (1) detect the presence of a CUDA card, (2) to activate this card when present?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Using attr_accessible in a join model with has_many :through relationship

    - by Paulo Oliveira
    I have a USER that creates a COMPANY and become an EMPLOYEE in the process. The employees table has an :user_id and a :company_id. class User has_many :employees has_many :companies, :through => :employees class Employee belongs_to :user belongs_to :company attr_accessible :active class Company has_many :employees has_many :users, :through => employees Pretty basic. But here's the thing, the resource EMPLOYEE has other attributes than its foreign keys, like the boolean :active. I would like to use attr_accessible, but this causes some problems. The attribute :user_id is set right, but :company_id is nil. @user.companies << Company.new(...) Employee id:1 user_id:1 company_id:nil So my question is: if :user_id is set right, despite it is not an attr_accessible, why :company_id isn't set right just the same? It shouldn't be an attr_accessible. I'm using Rails 3.0.8, and have also tested with 3.0.7.

    Read the article

  • plist vs static array

    - by morticae
    Generally, I use static arrays and dictionaries for containing lookup tables in my classes. However, with the number of classes creeping quickly into the hundreds, I'm hesitant to continue using this pattern. Even if these static collections are initialized lazily, I've essentially got a bounded memory leak going on as someone uses my app. Most of these are arrays of strings so I can convert strings into NSInteger constants that can be used with switch statements, etc. I could just recreate the array/dictionary on every call, but many of these functions are used heavily and/or in tight loops. So I'm trying to come up with a pattern that is both performant and not persistent. If I store the information in a plist, does the iphoneOS do anything intelligent about caching those when loaded? Do you have another method that might be related?

    Read the article

  • WCF client proxy initialization

    - by 123Developer
    I am consuming a WCF service and created its proxy using the VS 2008 service reference. I am looking for the best pattern to call WCF service method Should I create the client proxy instance every time I call the service method and close the client as soon as I am done with that? When I profiled my client application, I could see that it is taking lot of time to get the Channel while initializing the proxy client Should I use a Singleton pattern for the client proxy so that I can use the only once instance and get rid of the re-initializing overhead? Is there any hidden problem with this approach? I am using .Net framework 3.5 SP1, basicHttp binding with little customization.

    Read the article

  • How to set a key binding to make Emacs as transparent/opaque as I want?

    - by Vivi
    I want to have a command in Emacs to make it as opaque/transparent as I want (refer to the fabulous question that pointed out that transparency is possible in Emacs, and the EmacsWiki page linked there which has the code I am using below). The EmacsWiki code sets "C-c t" to toggle the previously set transparency on and off: ;;(set-frame-parameter (selected-frame) 'alpha '(<active> [<inactive>])) (set-frame-parameter (selected-frame) 'alpha '(85 50)) (add-to-list 'default-frame-alist '(alpha 85 50)) enter code here(eval-when-compile (require 'cl)) (defun toggle-transparency () (interactive) (if (/= (cadr (find 'alpha (frame-parameters nil) :key #'car)) 100) (set-frame-parameter nil 'alpha '(100 100)) (set-frame-parameter nil 'alpha '(85 60)))) (global-set-key (kbd "C-c t") 'toggle-transparency) What I would like to do is to be able to choose the % transparency when I am in Emacs. If possible, I would like a command where I type for example "C-c t N" (where N is the % opaqueness) for the active frame, and then "M-c t N" for the inactive window. If that can't be done like that, then maybe a command where if I type "C-c t" it asks me for the number which gives the opaqueness of the active window (and the same for the inactive window using "M-c t"). Thanks in advance for your time :) Below are just some comments that are not important to answer the question if you are not interested: I really want this because when I told my supervisor I was learning Emacs he said TexShop is much better and that I am using software from the 80's. I told him about the wonders of Emacs and he said TexShop has all of it and more. I matched everything he showed me except for the transparency (though he couldn't match the preview inside Emacs from preview-latex). I found the transparency thing by chance, and now I want to show him Emacs rules! I imagine this will be a piece of cake for some of you, and even though I could get it done if I spent enough time trying to learn lisp or reading around, I am not a programmer and I have only been using Emacs and a mac for a week. I am lost already as it is! So thanks in advance for your time and help - I will learn lisp eventually!

    Read the article

  • ActiveRecord fundamentally incompatible with composite keys?

    - by stimms
    I have been attempting to use subsonic for a project on which I'm working. All was going quite well until I encountered a link table with a composite primary key. That is a key made up of the primary keys of the two tables it joins. Subsonic failed to recognize both keys which was problematic. I was going to adjust subsonic to support compound keys but I stopped and though "Maybe there is a reason for this". Normally active record relies on a single primary key field for every record, even in link tables. But is this necessary? Should I just give up on active record for this project or continue with my modifications?

    Read the article

  • str_replace match only first instance

    - by kylex
    A followup question to http://stackoverflow.com/questions/3063704/ Given the following POST data: 2010-June-3 <remove>2010-June-3</remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-3 2010-June-1 I'm wanting to remove ONLY the first instance of 2010-June-3, but the following code removes all the data. $i = 1; $pattern = "/<remove>(.*?)<\/remove>/"; preg_match_all($pattern, $_POST['exclude'], $matches, PREG_SET_ORDER); if (!empty($matches)) { foreach ($matches as $match) { // replace first instance of excluded data $_POST['exclude'] = str_replace($match[1], "", $_POST['exclude'], $i); } } echo "<br /><br />".$_POST['exclude']; This echos: <remove></remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-1 It should echo: <remove>2010-June-3</remove> 2010-June-15 2010-June-16 2010-June-17 2010-June-3 2010-June-1

    Read the article

  • How to implement following with Zend navigation?

    - by simple
    I have a top navigation and a side one Home | Tours | Booking Tour1 ------ Tour2 ------ Tour3 I show the side menu depending on a active top item. But sometimes when the side menu item is clicked I have to show that items children instead of the sidemenu. When no children exist I just show Children of a top menu depending on the active item. I an really having difficulties implementing that kind a logic and any help would be appreciated. //Comment button is not working so I will add comments here After stumbling the zend navigation view helpers, I am coming to the point - Understanding the concept of how in zend V part of MVC is implemented can save someone who is new to the framework many hours. As said in the answer to this question - "Use what is available", thought first we have to know where to find what is already available out there - that is where comes handy to take a look at the concept of helpers and so forth.

    Read the article

  • Windows Phone 7, MVVM, Silverlight and navigation best practice / patterns and strategies

    - by Matt F
    Whilst building a Windows Phone 7 app. using the MVVM pattern we've struggled to get to grips with a pattern or technique to centralise navigation logic that will fit with MVVM. To give an example, everytime the app. calls our web service we check that the logon token we've assigned the app. earlier hasn't expired. We always return some status to the phone from the web service and one of those might be Enum.AuthenticationExpired. If we receive that I'd imagine we'd alert the user and navigate back to the login screen. (this is one of many examples of status we might receive) Now, wanting to keep things DRY, that sort of logic feels like it should be in one place. Therein lies my question. How should I go about modelling navigation that relies on (essentially) switch or if statements to tell us where to navigate to next without repeating that in every view. Are there recognised patterns or techniques that someone could recommend? Thanks

    Read the article

  • Daylight saving time of current tz

    - by spam2
    Hi, in my c++ software I've used Boost in some parts and also for the local time. OK, now my problem is to make a check if in my machine is active or not the DST. With the follow part of code I can know only the difference from the UTC time. In my case the difference is 2 hours because is active the DST ptime tLoc = second_clock::local_time(); ptime tUTC = second_clock::universal_time(); time_duration tDiff = tUTC - tLoc; local_time_zone = tDiff.hours(); I think that the boolean funcion has_dst() can help, right? My system is Debian GNU/Linux. Thanks

    Read the article

  • Having trouble deselecting all jquery tabs

    - by Julian
    I set up some jQuery tabs to start off with no tabs selected like this: $('#tabs').tabs( { selected: -1 } ); Then I also have a separate link that when pressed needs to deselect all the tabs. $("#deselectButton").click(function(){ $('#tabs').tabs( 'select' , -1 ) }); or $("#deselectButton").click(function(){ $('#tabs').tabs( 'selected' , -1 ) }); The deselectButton click does deselect the tabs content, however the tabs title remains active with the class 'ui-tabs-selected ui-state-active'. What is the correct way to deselect all the tabs?

    Read the article

  • Sign in as different user when using Integrated Windows Authentication

    - by Sam
    I have restricted access to a site by using Integrated Windows Authentication and turning off anonymous access. This way I can then show them their real name (from looking up on Active Directory and using the server variable LOGON_USER) and do other related Active Directory tasks. How can I then prompt again for their user credentials, through a 'sign in as other user' link , showing the browser prompt (like you would get on a browser like Chrome or Firefox, or if the site was not in the 'Intranet' zone in IE) rather than a Web Form? Since SharePoint offers this functionality, I assume there is a way to do this through code, but I don't know what code can do this (using C#). I can send a 401 header which makes the prompt appear, but how do you then confirm if they are logged in?

    Read the article

  • How to display a DateTime with chosen date parts, but in the order of the FormatProvider?

    - by Stephane
    I want to display the date in the order that the culture provides, but with the elements I want only. The DateTime.Tostring() method has a list of patterns that are very useful but I would like a very small change in it. The CultureInfo used in the following the following code are chosen as example, I don't want to rely on a specific list of CultureInfo, if possible var now = DateTime.Now; string nowString = now.ToString("m", CultureInfo.GetCultureInfo("en-us")); Console.WriteLine(nowString); nowString = now.ToString("m", CultureInfo.GetCultureInfo("fr-FR")); Console.WriteLine(nowString); displays : April 12 12 avril I would like a pattern that display the abbreviation of the month and the day, but that keeps the correct order from the specified CultureInfo. using the pattern "MMM dd" will always display the month's abbreviation first, followed by the day, breaking the french order for example. Any way to achieve that without too much custom code?

    Read the article

  • javascript string exec strange behavior

    - by Michael
    have funciton in my object which is called regularly. parse : function(html) { var regexp = /...some pattern.../ var match = regexp.exec(html); while (match != null) { ... match = regexp.exec(html); } ... var r = /...pattern.../g; var m = r.exec(html); } with unchanged html the m returns null each other call. let's say parse(html);// ok parse(html);// m is null!!! parse(html);// ok parse(html);// m is null!!! // ...and so on... is there any index or somrthing that has to be reset on html ... I'm really confused. Why match always returns proper result?

    Read the article

  • handle when callback to a dealloced delegate?

    - by athanhcong
    Hi all, I implemented the delegate-callback pattern between two classes without retaining the delegate. But in some cases, the delegate is dealloced. (My case is that I have a ViewController is the delegate object, and when the user press back button to pop that ViewController out of the NavigationController stack) Then the callback method get BAD_EXE: if (self.delegate != nil && [self.delegate respondsToSelector:selector]) { [self.delegate performSelector:selector withObject:self withObject:returnObject]; } I know the delegate-callback pattern is implemented in a lot of application. What is your solution for this?

    Read the article

< Previous Page | 182 183 184 185 186 187 188 189 190 191 192 193  | Next Page >