Search Results

Search found 32731 results on 1310 pages for 'regex for html'.

Page 187/1310 | < Previous Page | 183 184 185 186 187 188 189 190 191 192 193 194  | Next Page >

  • sed: replace only the first range of numbers

    - by Marit Hoen
    Imagine I have an input file like this: INSERT INTO video_item_theme VALUES('9', '29'); INSERT INTO video_item_theme VALUES('19', '312'); INSERT INTO video_item_theme VALUES('414', '1'); And I wish to add 10000 to only the first range of numbers, so I end up with something like this: INSERT INTO video_item_theme VALUES('10009', '29'); INSERT INTO video_item_theme VALUES('10019', '312'); INSERT INTO video_item_theme VALUES('10414', '1'); My approach would be to prefix "1000" to one digit numbers, "100" Something like...: sed 's/[0-9]\{2\}/10&/g' ... isn't very helpful, since it changes each occurance of two numbers, not only in the first occurance of numbers: INSERT INTO video_item_theme VALUES('9', '10029'); INSERT INTO video_item_theme VALUES('10019', '100312'); INSERT INTO video_item_theme VALUES('100414', '1');

    Read the article

  • set chars to uppercase between parenthesis

    - by emzap79
    let's assume in vim I have following lines: all what (strong) people have to do is pushing (heavy) weights over (and over) again in order to gain muscles and I need to convert words inside parenthesis to uppercase, what is the most convenient way to do so? How do I tell vim it needs to select everything to the first (!) closing parenthesis? So far I came up with :%s/\s(.*)\s/\U&/g unfortunately this will uppercase everything between 'strong' and 'heavy' which is not what I want. Any chance to tell vim it should select the chars to the next closing bracket only? (sorry for the silly example, couldn't think of something more sophisticated... or at least vim related... huh)

    Read the article

  • How can I delete everything after the first column in Notepad++?

    - by Bob J
    I'm trying to get rid of everything after a column in Notepad++. Column mode is not an option. Is it possible? What I have 70.97.110.40 159 ms [n/a] 21 70.97.117.177 134 ms [n/a] 21 70.97.120.10 75 ms [n/a] 21 70.97.122.105 87 ms www.portless.net 21 70.97.122.106 89 ms www.popovetsky.org 21 70.97.122.107 95 ms www.psmythe.net 21 70.97.122.104 98 ms wasabi.prostructure.com 21 70.97.122.108 89 ms crm.prostructure.com 21 70.97.122.109 87 ms internal.prostructure.com21 What I want 70.97.110.40 70.97.117.177 70.97.120.10 70.97.122.105 70.97.122.106 70.97.122.107 70.97.122.104 70.97.122.108 70.97.122.109 Thanks

    Read the article

  • Textmate: Find and replace across project with contents of one file from said project

    - by griotspeak
    I have a regular expression to find the text I want (I wrapped the relevant section in custom tags), and I can do it by hand without much issue, but what I want is a way to automatically find and replace throughout the entire project. A macro seems like an OK idea, but it would be nice to have a command (to edit and tweak). sed seems like a good bet, but I am pretty unfamiliar with it. I am not so much asking for a complete solution as I am asking for an example that does something close to what I want. I don't really know of a good way to start.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Regex working in RedHat is not giving any result in Ubuntu

    - by Supratik
    My goal is to match specific files from specific sub directories. I have the following folder structure `-- data |-- a |-- a.txt |-- b |-- b.txt |-- c |-- c.txt |-- d |-- d.txt |-- e |-- e.txt |-- org-1 | |-- a.org | |-- b.org | |-- org.txt | |-- user-0 | | |-- a.txt | | |-- b.txt I am trying to list the files only inside the data directory. I am able to get the correct result using the following command in RHEL find ./testdir/ -iwholename "*/data/[!/].txt" a.txt b.txt c.txt d.txt e.txt If I run the same command in Ubuntu it is not working. Can anyone please tell me why it is not working in Ubuntu ?

    Read the article

  • Convert from apache rewrite to nginx

    - by Linux Intel
    I want to convert from apache rewrite modules to nginx RewriteCond %{QUERY_STRING} mosConfig_[a-zA-Z_]{1,21}(=|\%3D) [OR] RewriteCond %{QUERY_STRING} base64_encode.*\(.*\) [OR] RewriteCond %{QUERY_STRING} (\<|%3C).*script.*(\>|%3E) [NC,OR] RewriteCond %{QUERY_STRING} GLOBALS(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} _REQUEST(=|\[|\%[0-9A-Z]{0,2}) RewriteCond %{QUERY_STRING} SELECT(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} UNION(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteCond %{QUERY_STRING} UPDATE(=|\[|\%[0-9A-Z]{0,2}) [OR] RewriteRule ^([^.]*)/?$ index.php [L] RewriteRule ^domain/trial/cms$ index/index.php?%{QUERY_STRING} [L] RewriteCond %{HTTP:Range} ([a-z]+) [NC] RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteCond %{ENV:byte-ranges-specifier} !^$ RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteCond %{HTTP_USER_AGENT} !^Mozilla/5 [NC] RewriteCond %{HTTP_USER_AGENT} !^Mozilla/4 [NC] RewriteCond %{HTTP_USER_AGENT} !^Opera [NC] RewriteRule ([0-9_\-]+)flv$ http://www.domain.com [R,L] RewriteRule ^$ index/index.php?%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)$ sss.php?encrypted=$1&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)/([^/^.]*)$ sss.php?tab=$1&page=$2&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !m-administrator [NC] RewriteRule ^([^/^.]*)/([^/^.]*)/([^.]*)$ sss.php?tab=$1&page=$2&queryString=$3&%{QUERY_STRING} [L] RewriteCond %{SCRIPT_FILENAME} !sss.php [NC] RewriteCond %{SCRIPT_FILENAME} !security.php [NC] RewriteRule ^([^/]*)$ index/$1?%{QUERY_STRING} [L] I tried to convert it by online tools such as : http://www.anilcetin.com/convert-apache-htaccess-to-nginx/ but it didn't convert it correctly. The conversion output is : if ($args ~ "mosConfig_[a-zA-Z_]{1,21}(=|%3D)"){ set $rule_0 1; } if ($args ~ "base64_encode.*(.*)"){ set $rule_0 1; } if ($args ~* "(<|%3C).*script.*(>|%3E)"){ set $rule_0 1; } if ($args ~ "GLOBALS(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "_REQUEST(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "SELECT(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "UNION(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($args ~ "UPDATE(=|[|%[0-9A-Z]{0,2})"){ set $rule_0 1; } if ($rule_0 = "1"){ rewrite ^/([^.]*)/?$ /index.php last; } if ($rule_1 = ""){ rewrite ^/domain/trial/cms$ /index/index.php?$args last; } if ($http_range ~* "([a-z]+)"){ set $rule_2 1$rule_2; } if ($rule_2 = "1"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } #ignored: condition 0 if ($rule_3 = "1"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } if ($http_user_agent !~* "^Mozilla/5"){ set $rule_4 1$rule_4; } if ($http_user_agent !~* "^Mozilla/4"){ set $rule_4 2$rule_4; } if ($http_user_agent !~* "^Opera"){ set $rule_4 3$rule_4; } if ($rule_4 = "321"){ rewrite /([0-9_-]+)flv$ http://www.domain.com redirect; } if ($rule_5 = ""){ rewrite ^/$ /index/index.php?$args last; } if ($uri !~* "sss.php"){ set $rule_6 1$rule_6; } if ($uri !~* "m-administrator"){ set $rule_6 2$rule_6; } if ($rule_6 = "21"){ rewrite ^/([^/^.]*)$ /sss.php?encrypted=$1&$args last; } if ($uri !~* "sss.php"){ set $rule_7 1$rule_7; } if ($uri !~* "m-administrator"){ set $rule_7 2$rule_7; } if ($rule_7 = "21"){ rewrite ^/([^/^.]*)/([^/^.]*)$ /sss.php?tab=$1&page=$2&$args last; } if ($uri !~* "sss.php"){ set $rule_8 1$rule_8; } if ($uri !~* "m-administrator"){ set $rule_8 2$rule_8; } if ($rule_8 = "21"){ rewrite ^/([^/^.]*)/([^/^.]*)/([^.]*)$ /sss.php?tab=$1&page=$2&queryString=$3&$args last; } if ($uri !~* "sss.php"){ set $rule_9 1$rule_9; } if ($uri !~* "security.php"){ set $rule_9 2$rule_9; } if ($rule_9 = "21"){ rewrite ^/([^/]*)$ /index/$1?$args last; } Please help me with the proper conversion result for nginx in order to work perfectly.

    Read the article

  • Regular expression in mySQL [migrated]

    - by Rayne
    I have a mysql table that has 2 columns - Column 1 contains a string value, and Column 2 contains the number of times that string value occurred. I'm trying to find the string abc.X.def, where the beginning of the string is "abc.", followed by one or more characters, then the string ".def". There could be more characters following ".def". How can I find such strings, then add the occurrence of such strings and display the results? For example, if I have abc.111.def23 1 abc.111.def 2 abc.22.def444 1 abc.111.def 1 Then I will get abc.111.def23 1 abc.111.def 3 abc.22.def444 1 Thank you.

    Read the article

  • Apache LocationMatch does not work for group

    - by dma_k
    I would like to configure Apache to proxy mldonkey running at localhost. Initially I have used the following configuration: <IfModule mod_proxy.c> <LocationMatch /(mldonkey|bittorrent)/> ProxyPass http://localhost:4080/ ProxyPassReverse http://localhost:4080/ </LocationMatch> </IfModule> and it didn't worked! error.log reads [error] [client 192.168.1.1] File does not exist: /var/www/mldonkey which means that Apache does not intersect the URL. However, when I change the regexp to following: <LocationMatch /mldonkey/> it started to work (i.e. mod_proxy functions OK, more over all ). I have tried the following alternatives: <LocationMatch ^/(mldonkey|bittorrent)/> <LocationMatch ^/(mldonkey|bittorrent)/.*> <LocationMatch ^/(mldonkey|bittorrent)> <LocationMatch /(mldonkey|bittorrent)> <LocationMatch "^/(mldonkey|bittorrent)/"> <LocationMatch "/(mldonkey|bittorrent)"> <LocationMatch "/(mldonkey)"> <LocationMatch "/(mldonkey)/"> with no positive result. I am stuck. Please give me a hint where to look at. P.S. Apache Server 2.2.19. P.P.S. Would be happy if <LocationMatch> would work, without using the heavy artillery of mod_rewrite.

    Read the article

  • How do I make sdiff ignore the * character?

    - by Runcible
    Here's what I'm sure is an easy one, but I can't figure it out. I have two files: file1: You are in a maze of twisty little passages, all alike file2: You are in a maze of twisty little* passages, all alike I want to perform sdiff on these files, but I want to ignore the * character. How do I do this?

    Read the article

  • Nginx HTTPS when only matching admin subfolder

    - by sebastyuiop
    I have managed to get all /admin requests redirected to https by: server { listen 80; location /admin { rewrite ^ https://$server_name$request_uri?$args permanent; } } But can't figure out how to get all https requests that are not within /admin redirected to http, so far I have: server { listen 443; location ~ /admin { rewrite ^ http://$server_name$request_uri?$args permanent; } } EDIT: I have got the redirects working as required but can't stop the /admin url going to 404. It feels like I need to put something in the empty block. server { listen 443; location /admin { } location / { rewrite ^ http://$server_name$request_uri?$args permanent; } } Thanks

    Read the article

  • Misbehavior in regular expression in VIM

    - by poissonbreaker
    I am having a problem with a regular expression on vim. I have a pattern as follows: http:\/\/\(\w\+\.\?\)\+ [matches http://(AS MANY WORDS FOLLOWED BY DOT OR NOT ENCOUNTERS) e.g. http://wd1.wd2.com] I have a text as follows: http://wd1.wd2.com/wd3 I am trying to make this substitution on it: s/\(http:\/\/\)\(\w\+\.\?\)\+/\1wd4.wd5.com and the result is http://wd4.wd5.com /wd3 (Notice the white space inserted at the end of the replacement) How can I avoid having this inserted space? I am afraid is a bug in the regexp engine but I am not sure.

    Read the article

  • Regular Expression for "AND"?

    - by Kevin
    Let's say I gave you the following text: allow_httpd_anon_write --> off allow_httpd_mod_auth_ntlm_winbind --> off allow_httpd_mod_auth_pam --> off allow_httpd_sys_script_anon_write --> off httpd_builtin_scripting --> on httpd_can_check_spam --> off httpd_can_network_connect --> off httpd_can_network_connect_cobbler --> off httpd_can_network_connect_db --> off httpd_can_network_memcache --> off httpd_can_network_relay --> off httpd_can_sendmail --> off httpd_dbus_avahi --> on httpd_enable_cgi --> on httpd_enable_ftp_server --> off httpd_enable_homedirs --> on httpd_execmem --> off httpd_read_user_content --> off httpd_setrlimit --> off httpd_ssi_exec --> off httpd_tmp_exec --> off httpd_tty_comm --> on httpd_unified --> on httpd_use_cifs --> off httpd_use_gpg --> off httpd_use_nfs --> off What I want to do is create a regular expression that can parse text like this looking for two or more words on the same line. For example, if I was looking for a SELinux boolean that covered "ftp" AND "home" on the same line, I would currently do the following: getsebool -a | grep -i ftp | grep -i home However, I am looking for a regular expression that does the same thing. Specifically, find all of the words in any order on a line...

    Read the article

  • NotePad++ - Why Does Finding ^ Not Work

    - by ChloeRadshaw
    I am trying to move away from TextPad and I just cant get reg expressions like ^ and $ to be replaced. I have definitely ticked the regular expression box What am I doing wrong EDIT: I am trying to find the start of a new line - In textpad it is find '^' and ensure reg ex is enabled. With notepad++ it does not do that. It just says not found

    Read the article

  • Request exceeded the limit of 10

    - by Webnet
    My logs are FULL of [Tue Jan 11 10:20:45 2011] [error] [client 99.162.115.123] Request exceeded the limit of 10 internal redirects due to probable configuration error. Use 'LimitInternalRecursion' to increase the limit if necessary. Use 'LogLevel debug' to get a backtrace., referer: https://www.domain.com/vehicles/Chevrolet/Uplander/2006 The problem is when I enable LogLevel debug we get HUGE error logs because all of our traffic is SSL. From what I can tell the file doesn't record these errors anymore, either that or it's so buried in SSL logs that I just can't find them. Here's my .htaccess Options -indexes RewriteEngine On RewriteRule ^battery/([^/]+)$ /browser/product?sku=BATTERY+$1&type=battery RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)/product([0-9]+)$ /browser/index.php?make=$1&model=$2&id=$3&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)/([0-9]+)$ /browser/product.php?make=$1&model=$2&year=$3&id=$4&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)/([^/]+)$ /store/product/list.php?make=$1&model=$2&year=$3&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)/([^/]+)$ /vehicle/make/model/year/list.php?make=$1&model=$2&%{QUERY_STRING} [L,NC] RewriteRule ^vehicles/([^/]+)$ /vehicle/make/model/list.php?make=$1&%{QUERY_STRING} [L,NC]

    Read the article

  • Can I sort files A-Z and at the same time Z-A?

    - by The_Buff
    I am trying to sort and rename a large number of files that are labeled #####_## The LEFT side of the underscore are numbers (e.g., 32956715, 32956810, etc.) that do not repeat. The RIGHT side of the underscore are also numbers (e.g., 1, 2, 3, etc.) and they do repeat. (The left side is the number of a scan and the right side is the page of that particular scan.) I would like to be able to sort the left side of the underscore Z-A and the right side A-Z. Example: 3_1 3_2 3_3 2_1 2_2 2_3 1_1 1_2 1_3 I am using ReNamer by den4b (easily the best free renamer out there). It supports regular expressions so I believe there should be an easy way to do this, but I don't know how. (I've been trying to learn regular expressions but I don't use them enough to retain anything.) I'm open for any suggestions that achieve the same result. I've spent enough time trying to figure it out that I could have probably just sorted them myself already but this is a reccuring problem so hopefully someone has a solution that will save me lots of time in the long run. Thank You!

    Read the article

  • Notepad ++ regular expression

    - by arvindwill
    have javascript file will millions of lines. The problem is IE dont support ','(comma) followed by '}'(curly close bracket) by using notepadd++ need to find all the comma which is followed by curly close bracket. So regular expression \,.*\} works. but the problem between the comma and close bracket many tab space or newline or linefeed can be there . cant able to provide the newline with spaces in regular expression. like below one somestring, }

    Read the article

  • Searching Multiple Terms

    - by nevets1219
    I know that grep -E 'termA|termB' files allows me to search multiple files for termA OR termB. What I would like to do instead is search for termA AND termB. They do not have to be on the same line as long as the two terms exists within the same file. Essentially a "search within result" feature. I know I can pipe the results of one grep into another but that seems slow when going over many files. grep -l "termA" * | xargs grep -l "termB" | xargs grep -E -H -n --color "termA|termB" Hopefully the above isn't the only way to do this. It would be extra nice if this could work on Windows (have cygwin) and Linux. I don't mind installing a tool to perform this task.

    Read the article

  • referral with regex for firefox?

    - by acidzombie24
    I am looking for a firefox referral plugin. I would like to be able to forge the referral name based on the pagename without extension. Such as http://site.com/page/abc.ANYTHING i need to set the referral as http://site.com/view/blah-abc-more.ext Does anyone know of a solution?

    Read the article

  • Avoid richfaces to send back javascript libraries in the ajax responses

    - by pakore
    I'm using JSF 1.2 with Richfaces, and for every ajax request, the server is sending back the response, whichi is good, but it also contains all the links to the javascript files. I want to improve the performance so I just want the <body> to be returned, because all the javascript files are already loaded in the browser when the user logs in (my app is not restful). How can i do that? Thanks This is an example of a response to reRender an image when clicking a button. <?xml version="1.0"?> <html lang="nl_NL" xmlns="http://www.w3.org/1999/xhtml"><head><title></title><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalorg/richfaces/renderkit/html/css/basic_both.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalorg/richfaces/renderkit/html/css/extended_both.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" media="rich-extended-skinning" rel="stylesheet" type="text/css" /><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/page.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalorg.ajax4jsf.javascript.PrototypeScript.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg.ajax4jsf.javascript.AjaxScript.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg.ajax4jsf.javascript.ImageCacheScript.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/browser_info.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/ajax4jsf/javascript/scripts/form.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/tabPanel.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/tabPanel.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/jquery/jquery.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/jquery.utils.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/json/json-mini.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg.ajax4jsf.javascript.DnDScript.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/utils.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/json/json-dom.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/dnd/dnd-common.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/dnd/dnd-draggable.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/dnd/dnd-dropzone.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/form.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/script/controlUtils.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/common-scrollable-data-table.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/extended-data-table.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/drag-indicator.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/ext-dt-drag-indicator.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/ext-dt-simple-draggable.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/ext-dt-simple-dropzone.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalorg/richfaces/renderkit/html/css/dragIndicator.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/extendedDataTable.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/menu.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/context-menu.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/available.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/menu.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/menucomponents.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/tooltip.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalorg/richfaces/renderkit/html/css/tooltip.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/datascroller.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/datascroller.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/modalPanel.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/modalPanelBorders.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalorg/richfaces/renderkit/html/css/modalPanel.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/tiny_mce/tiny_mce_src.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/editor.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/editor.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/events.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/scriptaculous/effects.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/JQuerySpinBtn.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/calendar.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalorg/richfaces/renderkit/html/css/calendar.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/panelbar.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/panelbar.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/comboboxUtils.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/utils.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/inplaceinputstyles.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finalscripts/inplaceinput.js.xhtml" type="text/javascript"> </script><link class="component" href="/eyeprevent/a4j/s/3_3_3.Finalcss/inplaceinput.xcss/DATB/eAF7sqpgb-jyGdIAFrMEaw__.xhtml" rel="stylesheet" type="text/css" /><script src="/eyeprevent/a4j/g/3_3_3.Finalorg/richfaces/renderkit/html/scripts/skinning.js.xhtml" type="text/javascript"> </script><script src="/eyeprevent/a4j/g/3_3_3.Finaljquery.js.xhtml" type="text/javascript"> </script></head> <body> <img id="j_id305:supportImage" src="/eyeprevent/image/os-ir-central.jpg" width="50%" /> <meta name="Ajax-Update-Ids" content="j_id305:supportImage" /> <span id="ajax-view-state"><input type="hidden" name="javax.faces.ViewState" id="javax.faces.ViewState" value="j_id24" autocomplete="off" /> </span><meta id="Ajax-Response" name="Ajax-Response" content="true" /> <meta name="Ajax-Update-Ids" content="j_id305:supportImage" /> <span id="ajax-view-state"><input type="hidden" name="javax.faces.ViewState" id="javax.faces.ViewState" value="j_id24" autocomplete="off" /> </span><meta id="Ajax-Response" name="Ajax-Response" content="true" /> </body> </html> And this is the code that generated it: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:ui="http://java.sun.com/jsf/facelets" xmlns:h="http://java.sun.com/jsf/html" xmlns:f="http://java.sun.com/jsf/core" xmlns:a4j="http://richfaces.org/a4j" xmlns:rich="http://richfaces.org/rich"> <ui:composition> <h:form> <h:panelGrid columns="1"> <a4j:region> <h:graphicImage id="supportImage" value="#{user.support.imagePath}" rendered="#{user.support.imageLoaded}" width="50%" /> </a4j:region> <h:panelGroup> <a4j:commandButton action="#{user.support.acceptImage}" value="YES" reRender="supportImage"/> <a4j:commandButton action="#{user.support.rejectImage}" value="NO" reRender="supportImage"/> </h:panelGroup> </h:panelGrid> </h:form> </ui:composition> </html>

    Read the article

  • multiline perl search and replace (one-liner)

    - by yaya3
    I want to perform the following vim substitution as a one-liner in the terminal with perl. I would prefer to allow for any occurences of white space and/or new lines, rather than explicitly catering for them as I am below. %s/blockDontForget">\n*\s*<p><span><a\(.*\)<\/span>/blockDontForget"><p><a\1/g I've tried this: perl -pi -e 's/blockDontForget"><p><span><a(.*)<\/span>/blockDontForget"><p><a$1/msg' I presume I am misinterpreting the flags. Where am I going wrong? Thanks. EDIT: The above example is to strip the spans out of the following html: <div class="block blockDontForget"> <p><span><a href="../../../foo/bar/x/x.html">Lorem Ipsum</a></span></p> </div>

    Read the article

  • Replaceing <a href="mailto: with just email aadress

    - by Lauri
    I want to replace all "mailto:" links in html with plain emails. In: text .... <a href="mailto:[email protected]">not needed</a> text Out: text .... [email protected] text I did this: $str = preg_replace("/\<a.+href=\"mailto:(.*)\".+\<\/a\>/", "$1", $str); But it fails if there are multiple emails in string or html inside "a" tag In: <a href="mailto:[email protected]">not needed</a><a href="mailto:[email protected]"><font size="3">[email protected]</font></a> Out: [email protected]">

    Read the article

  • How do I convert CamelCase into human-readable names in Java?

    - by Frederik
    I'd like to write a method that converts CamelCase into a human-readable name. Here's the test case: public void testSplitCamelCase() { assertEquals("lowercase", splitCamelCase("lowercase")); assertEquals("Class", splitCamelCase("Class")); assertEquals("My Class", splitCamelCase("MyClass")); assertEquals("HTML", splitCamelCase("HTML")); assertEquals("PDF Loader", splitCamelCase("PDFLoader")); assertEquals("A String", splitCamelCase("AString")); assertEquals("Simple XML Parser", splitCamelCase("SimpleXMLParser")); assertEquals("GL 11 Version", splitCamelCase("GL11Version")); }

    Read the article

  • Perl: Edit hyperlinks in nested tags that aren't on seperate lines

    - by user305801
    I have an interesting problem. I wrote the following perl script to recursively loop through a directory and in all html files for img/script/a tags do the following: Convert the entire url to lowercase Replace spaces and %20 with underscores The script works great except when an image tag in wrapped with an anchor tag. Is there a way to modify the current script to also be able to manipulate the links for nested tags that are not on separate lines? Basically if I have <a href="..."><img src="..."></a> the script will only change the link in the anchor tag but skip the img tag. #!/usr/bin/perl use File::Find; $input="/var/www/tecnew/"; sub process { if (-T and m/.+\.(htm|html)/i) { #print "htm/html: $_\n"; open(FILE,"+<$_") or die "couldn't open file $!\n"; $out = ''; while(<FILE>) { $cur_line = $_; if($cur_line =~ m/<a.*>/i) { print "cur_line (unaltered) $cur_line\n"; $cur_line =~ /(^.* href=\")(.+?)(\".*$)/i; $beg = $1; $link = html_clean($2); $end = $3; $cur_line = $beg.$link.$end; print "cur_line (altered) $cur_line\n"; } if($cur_line =~ m/(<img.*>|<script.*>)/i) { print "cur_line (unaltered) $cur_line\n"; $cur_line =~ /(^.* src=\")(.+?)(\".*$)/i; $beg = $1; $link = html_clean($2); $end = $3; $cur_line = $beg.$link.$end; print "cur_line (altered) $cur_line\n"; } $out .= $cur_line; } seek(FILE, 0, 0) or die "can't seek to start of file: $!"; print FILE $out or die "can't print to file: $1"; truncate(FILE, tell(FILE)) or die "can't truncate file: $!"; close(FILE) or die "can't close file: $!"; } } find(\&process, $input); sub html_clean { my($input_string) = @_; $input_string = lc($input_string); $input_string =~ s/%20|\s/_/g; return $input_string; }

    Read the article

< Previous Page | 183 184 185 186 187 188 189 190 191 192 193 194  | Next Page >