Search Results

Search found 45013 results on 1801 pages for 'example'.

Page 188/1801 | < Previous Page | 184 185 186 187 188 189 190 191 192 193 194 195  | Next Page >

• Hosts file in Apache keep changing for OS Linux Redhat [on hold]

  - by jack f

  I have installed Apache server. Two clients ex client_1 and client_2. The operation that we are performing on client_1 reflecting to client_2. We have etc/hosts file in our software install location which is keep on changing for client_2 with client_1 IP address. If I correct the entries in hosts file to client_2 also in the next few minuets it is changing automatically to the client_1(if we start the client_1 service). Please explain the use of hosts file and where and when it will change by Apache service. The hosts file in the location /etc/hosts/ for the both clients are same ============================================= Do not remove the following line, or various programs that require network functionality will fail. 127.0.0.1 localhost.localdomain localhost Local LAN 190.0.0.1 client_1.Example.com client_1 190.0.0.2 client_2.Example.com client_2 HR LAN 10.1.74.2 client_1hr peer 10.1.74.3 client_2hr ESP LAN 10.69.69.1 client_1esp 10.69.69.2 client_2esp Any help will be appreciated. Thanks in advance, Jack F

  Read the article

• How can I lock a dictionary in debian server installed with ngix?

  - by Tin Aung Linn

  I tried so many methods and get stick hours with this.I edit /etc/nginx/nginx.conf and write these lines. location /home/user/domains/example.com/public_html/lockfolder/ { auth_basic "Restricted"; auth_basic_user_file /home/user/domains/example.com/.htpasswd; } and I use crypt(3) encryption to make passwd with the command mkpasswd.Then I did with the given procedure user:encryptedpasswd in .htpasswd. But things does not work as said.Let me know if anyone know how I can exactly make configure for my purpose! Thanks you.

  Read the article

• emacs does not open a file from argument and syntax highlight does not work

  - by Jus

  In my latest ubuntu box, When I type for example emacs ~/.bashrc, Emacs will start but not open .bashrc. This is true for any file I pass in. I've used Emacs for several years, and have never experienced this problem before. I added (global-font-lock-mode 1);; to my .emacs file, and Emacs does recognize it, for example. "(C++/; Abbrev)", but it won't do syntax highlighting. If you can solve any of these problems, it will be very appreciated. The following is my machine's configuration: uname -a Linux 2.6.35-28-generic-pae #49-Ubuntu SMP Tue Mar 1 14:58:06 UTC 2011 i686 GNU/Linux ~/.emacs (global-font-lock-mode 1);;

  Read the article

• How do I get a PDF link in a Word document to open in the default browser?

  - by Tweek

  I'm trying to create a Word document with links to resources on the web. If I create a hyperlink to a regular HTML file, when I click on the link, it opens in my default browser (Google Chrome) as expected. However, if I click on a link to a PDF file on a website, it opens in Internet Explorer. Before it opens, I also get the following prompt: Microsoft Office Opening http://www.example.com/example.pdf Some files can contain viruses or otherwise be harmful to your computer. It is important to be certain that this file is from a trustworthy source. Would you like to open this file? OK Cancel I'm using Office 2010, but I'm asking for a user who is using Office 2007 and is experiencing the same issue. (His default browser is Firefox.) We're both on Windows 7.

  Read the article

• How do you know which domain owns the hosting?

  - by BubbleStalker

  For example if I have 1) host adress 2) login 3) password, I am entering by SSH on ruby on rails hosting, then how can i be sured that this hosting belongs to a specific domain? for example how can I know if www.site.com - belongs to some specific hosting to which I have access. I am asking this because I have access to hosting of ruby on rails, and when i modify files, there is no changes, i've tried to use the files "script", "serv", "restart.txt" - by ssh: touch tmp/restart.txt ./serv restart script restart nothing of the above helped...and I don't know what to do, any ideas?

  Read the article

• linux + match only VALID IP from text file into other file

  - by yael

  please advice how to match only the valid IPs ( 255.255.255.255 ) from the file.txt and insert only the valid IP into VALID_IP.txt file ( see VALID_IP.txt for example ) the solution should be implemented in my ksh script ( so perl or sed or awk is fine also ) more file.txt e32)5.500.5.5*kjcdr ##@$1.1.1.1+++jmjh 1.1.1.1333 33331.1.1.1 @5.5.5.?????? ~3de.ede5.5.5.5 1.1.1.13444r54 192.9.30.174 &&^#%5.5.5.5 :5.5.5.5@%%^^&* :5.5.5.5: **22.22.22.22 172.78.0.1()*5.4.3.277 example of VALID_IP.txt file 1.1.1.1 192.9.30.174 5.5.5.5 5.5.5.5 5.5.5.5 22.22.22.22 172.78.0.1

  Read the article

• A space-efficient filesystem for grow-as-needed virtual disks ?

  - by Steve Schnepp

  A common practice is to use non-preallocated virtual disks. Since they only grow as needed, it makes them perfect for fast backup, overallocation and creation speed. Since file systems are usually based on physical disks they have the tendency to use the whole area available1 in order to increase the speed2 or reliability3. I'm searching a filesystem that does the exact opposite : try to touch the minimum blocks need by an aggressive block reuse. I would happily trade some performance for space usage. There is already a similar question, but it is rather general. I have very specific goal : space-efficiency. 1. Like page caching uses all the free physical memory 2. Canonical example : online defragmentation 3. Canonical example : snapshotting

  Read the article

• How do you change color of gradient image found on the net?

  - by askmoo

  For example, I found this gradient image (randomly chosen) How do you change its color in Photoshop or GIMP? I tried overlay but it covers everything with that color. For example I want to have white-to-red gradient image. Possible to do it in a quick way via any of these tools or I have to make it from the scratch? This is the image before and after I use the tool suggested. You can see the horizontal striped on the after image.

  Read the article

• Setting up a domain with a dedicated server

  - by Andrew M

  I have a dedicated server with a bunch of stuff on it already. Basically, I am accessing it now with the free domain I got when I purchased the server (http://example.com/directory, etc). I also have a second domain I want to use with a specific subdirectory (http://exampletwo.com/ should basically work as if I were under http://example.com/two, but it should use the exampletwo domain. I would assume I would change the A record of the second domain to the IP of the server, but how do I make it work with a subdirectory? I have full DNS control of the second domain but it is purchased on from a different registrar than the dedicated server. EDIT: It is a CentOS 5 server running Plesk/Virtuozoo.

  Read the article

• Is there a way to get Postfix to both forward an e-mail *and* reject it via recipient_address_rejected

  - by Mac

  In postfix, I'd like a way to deal with e-mail accounts that are no longer active by having postfix send the standard "Recipient address rejected" type message, but still forwarding the e-mail to another user. Thus, if someone sends an e-mail to [email protected], it will bounce the message back to the sender for future reference, but the mail will still get forwarded to [email protected] to deal with. .vacation and / or .forward files let me down because they will either reply or forward, but not both. Any tips?

  Read the article

• Run totally silent rsync?

  - by jackr

  I have a cronjob that runs hourly, and is totally silent unless something goes wrong. Well ... almost ... A part of the job is rsync --del -Cacqrz public/. user@host.example.com:/target/path This always prints "logged in". How can I make it stop? (Short of 'grep -v' ;-) I don't get the "logged in" message if I do things like ssh user@host.example.com ls The transport is, of course, ssh (using keys). Source host is either OSX or Ubuntu (tried both, same behavior). Target host is Linux of some flavor.

  Read the article

• Url for search withing Exchange Server OWA

  - by Martin Vobr

  I can easily create url for searching the Internet for specific term: http://www.bing.com/search?q=example Is is possible to create a similar url for searching my Exchange server mailbox using Outlook Web App? Something like: http://my.exchange.server.tld/owa/search.aspx?q=example EDIT Some of comments asked for target, so here is the clarification: There is a web-based backoffice system which includes customer's email addresses. I want to provide an easy way to show emails related to this customer in a support mailbox. Adding a link to an OWA search result page seemed a way to accomplish quickly. I can lookup emails either via EWS or IMAP. I wanted to reuse OWA for displaying them instead of reinventing the wheel. If creating a search link is not possible what would be best alternative approach? I'm thinking about getting message list via EWS/IMAP, showing them and (at least now) redirecting to OWA in order to display the message content.

  Read the article

• solaris + match the network device name according to IP address

  - by yael

  how to find the device name as ( e1000g2 , e1000g3 , etc ) according to his IP address on Solaris machine for example ifconfig -a | grep 10.106.134.133 inet 10.106.134.133 netmask ffffff00 broadcast 10.106.134.255 ifconfig with grep command view only the line with the IP address , and the device name appears before the IP address so my target is to match the device name according to the IP address on Solaris machine , and then insert the device name in to parameter ( ksh ) please advice? full example: from ifconfig -a ( I get the IP and device name , what I need is to find the device name according to IP address , and insert the device name in to parameter ) e1000g2: flags=201000843<UP,BROADCAST,RUNNING,MULTICAST,IPv4,CoS> mtu 1500 inet 10.106.134.133 netmask ffffff00 broadcast 10.106.134.255

  Read the article

• Dynamic authentication realms in Apache

  - by Cogsy

  I have a front end server acting as a gateway proxy for many (a dynamic 'many') building monitors with embedded webservers. They are accessed with a URL like: http://www.example.com/monitor1/ http://www.example.com/monitor2/ ... I'm trying to restrict access to these monitors to only the users that own them. So what I need is a way of specifying rights to users or groups for specific directories. The standard auth mechanisms I see in Apache won't work because I need to specify every location. I'd prefer some dynamic map or script. Any suggestions?

  Read the article

• What is the canonical name for domain names with extra parts?

  - by ConfusedFromIreland

  I am confused about domain names (I think) I call these things, i.e. names you can buy, 'domain names' bbc.co.uk google.com I call these things, i.e. extensions of names 'host names' www.bbc.co.uk mail.yahoo.com arts.mit.edu hello.there.example.com Is this naming scheme correct? Are there official definitions of these? In particular, what are each of the texts between the dots called (i.e. the name for "www", "bbc", "edu", "example")?

  Read the article

• What are some good installation tools for Linux?

  - by George Edison

  Excluding package managers, what are some good installation tools for creating software installation programs on Linux? (for example, AutoPackage)

  Read the article

• Disqus cache of unposted posts

  - by user129107

  Some webpages implement Disqus and also have the rather bad policy of adding auto refresh to the page. This result in for example one writing a long answer in a debate and then a refresh comes along – and everything is gone. Is the comments, written, but not posted, cached somewhere? Is it possible to retrieve? I have experienced this on various pages. In the current case the debate page was reloaded and a rather lengthy post with a lot of references and long thought out sentences vanished. This page closes the debate during night time, and do a auto refresh of the page when one pass midnight – as such I'm not able to retrieve the debate for another 8 hours. Other pages implement for example an auto refresh after 20 minutes. Linux, Google Chrome.

  Read the article

• How to re-arrange Excel database from 1 long row, into 3 short rows and automatically repeat the process?

  - by user326884

  I would appreciate help on the above-mentioned topic. I am unfamiliar with Visual Basic for Excel, so will need step-by-step guidance (if solution is via Visual Basic). For example :- Row 1, Sheet A: A1 B1 C1 D1 E1 F1 G1 H1 I1 To be re-arranged into Sheet B : Row 1 : A1, B1, C1 Row 2 : D1, E1, F1 Row 3 : G1, H1, I1 The Sheet A (database sheet) has a lot of rows (example 3,000 rows), hence the Sheet B is estimated to have 9,000 rows (i.e. 3 x 3,000). Thanking you in anticipation of your speedy response.

  Read the article

• Problem with the hosts file under windows 7

  - by martani_net

  I updated some entries in the hosts file "C:\WINDOWS\System32\drivers\etc" to make google for example point to 127.0.0.1 # Additionally, comments (such as these) may be inserted on individual # lines or following the machine name denoted by a '#' symbol. # # For example: # # 102.54.94.97 rhino.acme.com # source server # 38.25.63.10 x.acme.com # x client host 127.0.0.1 localhost ::1 localhost 127.0.0.1 google.com This works fine under windows Vista, but not under Widows 7. When I type google, it goes directly to Google's website. For info, I am not using a proxy server. I think there are some temporary DNS settings that must be flushed, but I don't know how, anyone knows how to fix this? Thank you.

  Read the article

• Windows 7 tasks don't switch when clicking window

  - by Jonathan Weinraub

  I got a peculiar problem with an enduser today. He says for the past month or so, if he has a window open (not maximised) and he clicks the window below it (also not maximised), it won't switch to it. For example, if he is in Lotus Notes, and wants to go back to Firefox, and he clicks the Firefox title bar, the tasks don't change focus/switch to it. This doesn't happen for applications. Usually it is with Firefox but if he's in Matlab and goes to PADS for example, they switch fine. If you close the apps, and reopen them, it'll work, but about 30 minutes later the weirdness then resumes. Any insight would be greatly appreciated. Thanks!

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• How to get the Host value inside ~/.ssh/config

  - by iconoclast

  Within a ~/.ssh/config or ssh_config file, %h will give you the HostName value, but how do you get the Host ("alias") value? Why would I want to do that? Well, here's an example Host some_host_alias HostName 1.2.3.4 User my_user_name PasswordAuthentication no IdentityFile ~/.ssh/some_host_alias.rsa.id LocalCommand some_script.sh %h # <---- this is the critical line If I pass %h to the script, then it uses 1.2.3.4, which fails to give it all the options it needs to connect to that machine. I need to pass some_host_alias, but I can't find the % variable for that. (And: yes! I'm aware of the risk of recursion. That's solved inside the script.) UPDATE: Kenster pointed out that I could just hard-code the Host value as an argument to the script. Of course this will work in the example I gave, but it won't work if I'm using pattern matching for the Host.

  Read the article

• Apache redirect alias to a different domain

  - by John Magnolia

  I previous had both Web and Mail on the same server and for each of my vhosts/domains, I could visit example.com/mail or foo.com/mail which would display the Roundcube Webmail across all vhosts. E.g Alias /mail "/usr/share/apache2/roundcub/" Although now I have moved the Mail server onto a completely different server and now have a SSL for the main domain. https://mail.example.com which is now the new location of Roundcube for all vhosts/domains. Question: is it possible to redirect all alias for "/mail" from the Web server to the new URL?

  Read the article

• Moving a file using PuTTY

  - by Paul Trotter

  I am newbie struggling to move a file on a Linux VPS using PuTTY. I can log in with a user in PuTTY at this point I can navigate to see the file I wish to move (~/servers/apache-solr-3.6.2/example/webapps/solr.war). By using cd .. a couple of times from the directory I begin at when I first log in to PuTTY I can then navigate to the location I wish to move the file to: usr/local/jakarta/apache-tomcat-5.5.36/webapps/ I know that I need to use cp to copy the file and have tried variations on: cp ~/servers/apache-solr-3.6.2/example/webapps/solr.war usr/local/jakarta/apache-tomcat-5.5.36/webapps However each time I get 'No such file or directory' I have tried excluding the ~/ and the start and I have tried specifying solr.war at the end of the command. Please excuse the newbie question, but I would really appreciate some advice on what I am doing wrong here.

  Read the article

• One subdomain is not working

  - by BFTrick

  Hello there, My main domain works just fine - www.example.com and a subdomain set up by another developer works as well - sub1.example.com. But when I try to set another subdomain up I go through the process everything seems to work. The software creates the default files where the subdomain files should go. But when I try to browse there it doesn't work. My host uses Plesk to do all of the hosting stuff. What do you think the problem is? I doubt it is some sort of cache issue because I had problems on my phone which I tried after problems on the pc. Maybe for some reason Plesk needs time to set this up? I have used Cpanel before and that works instantly.

  Read the article

< Previous Page | 184 185 186 187 188 189 190 191 192 193 194 195  | Next Page >