Search Results

Search found 45013 results on 1801 pages for 'example'.

Page 189/1801 | < Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >

• Dynamic authentication realms in Apache

  - by Cogsy

  I have a front end server acting as a gateway proxy for many (a dynamic 'many') building monitors with embedded webservers. They are accessed with a URL like: http://www.example.com/monitor1/ http://www.example.com/monitor2/ ... I'm trying to restrict access to these monitors to only the users that own them. So what I need is a way of specifying rights to users or groups for specific directories. The standard auth mechanisms I see in Apache won't work because I need to specify every location. I'd prefer some dynamic map or script. Any suggestions?

  Read the article

• Keep ASP.NET site and content separate

  - by Nelson

  I have an ASP.NET site in folder x. Currently lots of other static content gets added to folder x and gets mixed in, making it one big mess. I would like to keep the ASP.NET site and the content separate somehow. I know you can create virtual directories in IIS, but there are LOTS and even some content in the root. The content people are not technical and really need an easy way to add it. I would stick everything in a subfolder (they don't touch anything outside, I don't touch their folder), but that would change their URLs (www.example.com/something to www.example.com/content/something). I almost need a way to "merge" two folders and have them act as one. I'm guessing that is impossible since there could be file conflicts, etc. Any other ways I can achieve this?

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• I can see markup characters in vim `:help`

  - by Relax

  I just created a .txt file inside .vim/doc for documenting one little function of my .vimrc, ran :helptags ~/.vim/doc and apparently the whole vim help system went wild. Now, if I open for example :help help, I see things like: This also works together with other characters, for example to find help for CTRL-V in Insert mode: > :help i^V < (notice the < and characters). I can also see the ~ at the end of headlines and the modeline at the end of the help page (thinks like vim:tw=78:ts=8:ft=help:norl:). I have no idea about what happens or how to fix it. Any clue? Thanks in advance!

  Read the article

• Moving a file using PuTTY

  - by Paul Trotter

  I am newbie struggling to move a file on a Linux VPS using PuTTY. I can log in with a user in PuTTY at this point I can navigate to see the file I wish to move (~/servers/apache-solr-3.6.2/example/webapps/solr.war). By using cd .. a couple of times from the directory I begin at when I first log in to PuTTY I can then navigate to the location I wish to move the file to: usr/local/jakarta/apache-tomcat-5.5.36/webapps/ I know that I need to use cp to copy the file and have tried variations on: cp ~/servers/apache-solr-3.6.2/example/webapps/solr.war usr/local/jakarta/apache-tomcat-5.5.36/webapps However each time I get 'No such file or directory' I have tried excluding the ~/ and the start and I have tried specifying solr.war at the end of the command. Please excuse the newbie question, but I would really appreciate some advice on what I am doing wrong here.

  Read the article

• Apache resolves all URLs to default

  - by Ariel

  I am using Apache 2.2 on a Debian-based distro. For some reason, all URLs are directed to the default index. No error or anything. That means: example.domain.com goes to domain.com. "example" can be just anything. In the default Vhost file (/etc/apache2/sites-available/default) I've added: ServerName: www.domain.com But it still keeps that odd behaviour. Please let me know how to enable the common, default behaviour. I haven't changed anything by the way, this is since installation. Update: Following SvW's answer, I am looking for a way to force Apache not to accept any URL, only those specified as VirtualHosts.

  Read the article

• Are you able to specify a the profile you want to use in pfexec?

  - by jigjig

  Are you able to specify which profile you want to use for a given user when using pfexec who has been assigned multiple profiles? One example for this use is so that we can execute a command as a different user within the same process. In exec_attr, you are able to specify the uid/gid that will be used to execute a particular command as in the following example entry: Name Service Security:suser:cmd:::/usr/sbin/rpc.nsid:uid=0;gid=0 The above profile will use the super user (uid=0) to execute the rpc.nsid command. In user_attr, you can specify multiple profiles as below: testuser::::type=normal;profiles=Name Service Security,Object Access Management Can you then specify directly to use the Object Access Management profile to pfexec?

  Read the article

• Is possible to arbitrarily register names to the same public IP?

  - by Alex. S.

  I registered a domain, lets say mysite.com (for example), then, results that somebody else has an A record from anotheraddress.com pointing to the same IP address of mine (in a VPS in linode.com) What can I do to avoid this???, I mean, I would prefer reject accesses from anotheraddress.com to my site. I just know only by casualty putting my genuine domain name on this http://www.domaintools.com/reverse-ip/ My DNS server is name.com, and the DNS server pointing to the my public IP is from GoDaddy. Is possible to register arbitrarily names to the same public IP? Can I use my DNS record with mysite.com to point to 209.85.133.147 (google.com), for example?

  Read the article

• Automate hashing for each file in a folder?

  - by Kennie R.

  I have quite a few FTP folders, and I add a few each month and prefer to leave some sort of method of verifying their integrity, for example the files MD5SUMS, SHA256SUMS, ... which I could create using a script. Take for example: find ./ -type f -exec md5sum $1 {} \; This works fine, but when I run it each time for each shaxxx sum afterwards, it creates a sum of the MD5SUMs file which is really not wanted. Is there a simpler way, or script, or common way of hashing all the files in to their sums file without causing problems like that? I could really use a better option.

  Read the article

• Per-user vhost logging

  - by kojiro

  I have a working per-user virtual host configuration with Apache, but I would like each user to have access to the logs for his virtual hosts. Obviously the ErrorLog and CustomLog directives don't accept the wildcard syntax that VirtualDocumentRoot does, but is there a way to achieve logs in each user's directory? <VirtualHost *:80> ServerName *.example.com ServerAdmin [email protected] VirtualDocumentRoot /home/%2/projects/%1 <Directory /home/*/projects/> Options FollowSymlinks Indexes IndexOptions FancyIndexing FoldersFirst AllowOverride All Order Allow,Deny Allow From All Satisfy Any </Directory> Alias /favicon.ico /var/www/default/favicon.ico Alias /robots.txt /var/www/default/robots.txt LogLevel warn # ErrorLog /home/%2/logs/%1.error.log # CustomLog /home/%2/logs/%1.access.log combined </VirtualHost>

  Read the article

• Access Rails under /app/, not /app/public/

  - by blinry

  I'm trying to deploy Rails 2.1.2 with Apache 2.2.10 and FastCGI (yeah, bad, ancient, ugly, I know). My application can be accessed via example.com/app/public/, but I want to access it via example.com/app/. In my .htaccess-File (in the app/-directory!) I have: RewriteEngine On RewriteBase /app/ RewriteCond %{REQUEST_FILENAME} !-f RewriteRule ^(.*)$ public/dispatch.fcgi [QSA,L] How can I forward each request going to app/ to app/public/? Every time I try this (like, with RewriteRule ^.*$ public/$1 [QSA]) I get a routing error: No route matches "/app/" with {:method=>:get} Help?

  Read the article

• VLC stream with trickplay

  - by marjasin

  The idea is to start a video stream from one computer and watch it on another with the ability to start/stop the stream. I think I could do this with VLC but i haven't been able to figure out how. I've tried the following: (From the official forum) Stream with RTSP and RTP: on the server, run: % vlc -vvv input_stream --sout '#rtp{dst=192.168.0.12,port=1234,sdp=rtsp://server.example.org:8080/test.sdp}' on the client(s), run: % vlc rtsp://server.example.org:8080/test.sdp But this doesn't give me the ability to start/stop the stream from the client. According to the VLC release note something called "Trick play" was added in version 1.0. This seems to be what I'm looking for but i can't find any documentation that descibes how to use it.

  Read the article

• HTTPS load balancing based on some component of the URL

  - by user38118

  We have an existing application that we wish to split across multiple servers (for example: 1000 users total, 100 users split across 10 servers). Ideally, we'd like to be able relay the HTTPS requests to a particular server based on some component of the URL. For example: Users 1 through 100 go to http://server1.domain.com/ Users 2 through 200 go to http://server2.domain.com/ etc. etc. etc. Where the incoming requests look like this: https://secure.domain.com/user/{integer user # goes here}/path/to/file Does anyone know of an easy way to do this? Pound looks promising... but it doesn't look like it supports routing based on URL like this. Even better would be if it didn't need to be hard-coded- The load balancer could make a separate HTTP request to another server to ask "Hey, what server should I relay to for a request to URL {the URL that was requested goes here}?" and relay to the hostname returned in the HTTP response.

  Read the article

• All HTTPS, or is it OK to accept HTTP and redirect (secure vs. user friendly)

  - by tharrison

  Our site currently redirects requests sent to http://example.com to https://example.com -- everything beyond this is served over SSL. For now, the redirect is done with an Apache rewrite rule. Our site is dealing with money, however, so security is pretty important. Does allowing HTTP in this way pose any greater security risk than just not opening or listening on port 80? Ideally, it's a little more user-friendly to redirect. (I am aware that SSL is only one of a large set of security considerations, so please make the generous assumption that we have done at least a "very good" job of covering various security bases.)

  Read the article

• RedirectPermanent vs RewriteRule [R]

  - by notbrain

  I currently have a perm_redirects.conf file that gets included into my apache config stack where I have lines in the format RedirectPermanent /old/url/path /new/url/path It looks like I'm required to use an absolute URL for the new path, e.g.: http://example.com/new/url/path. In the logs I'm getting "incomplete redirect target /new/url/path was corrected to http://example.com/new/url/path." (paraphrased). In the 2.2 docs for RewriteRule, at the bottom they show the following as being a valid redirect, with only the url-paths instead of an abs URL for the right hand side of the redirect: RewriteRule ^/old/url/path(.*) /new/url/path$1 [R] But I can't seem to get that format to work to replicate the functionality of the RedirectPermanent version. Is this possible?

  Read the article

• Syncronize Linux /etc/ directory

  - by entend

  I have virtual machine with Linux (Ubuntu server) which is used as prototype for other machines. Sometimes I make changes in prototype system and want to import this changes at some other machine. I know about Puppet, cfengine and FAI but want something easy for example rsync script which will work through ssh when it needed. Main goal is /etc/ directory. But I don't want to syncronize some private files for example /etc/passwd /etc/shadow and so on. I don't know all of it. Are there tips for my task ? May be someone have such rsync script.

  Read the article

• using sed to replace two patterns within a larger pattern

  - by Hair of the Dog

  Using sed how could I replace two patterns within a larger pattern on a single line? Given a single line of text I want to find a pattern (Let's call this the outer pattern) and then within that outer pattern replace two inner patterns. Here's a one line example of the input text: Z:\source\private\main\developer\foo\setenv.sh(25): export 'FONTCONFIG_PATH'="$WINE_SHARED_SUPPORT/X11/etc/fonts" In the example above the outer pattern is "/^.*([[:digit:]]+):/" which should equal "Z:\source\private\main\developer\foo\setenv.sh(25):" The two inner patterns are "/^[A-Za-z]:/" and "/\/". Another way to phrase my question is: Using sed I know how to perform replacements of a pattern using the "s" command, but how do I limit the range of "s" command so it only works on the portion of the input string up to the "(25):"? The ultimate result I am trying to get is the line of text is transformed into this: /enlistments/source/private/main/developer/foo/setenv.sh(25): export 'FONTCONFIG_PATH'="$WINE_SHARED_SUPPORT/X11/etc/fonts"

  Read the article

• MOD_REWRITE not creating correct path

  - by Bill

  SO I am trying to setup a RewriteRule on my server for caching static objects. the files are in this naming scheme /docroot/css/stylesheet.min.css and I have them printed in the code like /docroot/css/stylesheet.min.123438348.css (the number is example it comes from a get modified function). Note docroot is an example directory how can I have the server ignore the numbers and redirect to the stylesheet.min.css I need to do this for every css and js files (/js and /css) as well as one specific spritemap image my current attempt RewriteRule ^/(docroot)/(js|css)/(.+).(min).(.+).(js|css)$ /$1/$2/$3.$4.$6 RewriteRule ^(/docroot/images/spritemap).([0-9]+).(png)$ $1.$3 Update: Now I have the setup like this RewriteEngine on Options FollowSymLinks RewriteRule ^(.+).(min).([0-9]+).(js|css)$ $1.$2.$4 [L] This is rewriting localhost/docroot/css/stylesheet.min.12343242.css to /var/www/html/docroot/trunk/docroot/css/stylesheet.min.css so it is getting the right file how do I get apache to take off the beginning of the that the /var/www/html/docroot/trunk/

  Read the article

• Is it possible to open several web pages when browser is started?

  - by gotqn

  I am searching for browser option or plugin (it will be best if it is available in Web Kit browsers,Opera or Firefox - not IE) that allows me to open several web pages when it is initially started. For example, let's say that I have some file with settings in which I have pointed the following websites: Google + gmail StackOverflow.com SuperUser.com dba.stackexchange.com linkedin etc... and when I firstly started the Chrome browser, all this sites will be opened in new tabs and because the browser has saved my passwords I will be logged in. I will find this very helpful because: It will saves me time I will not miss anything when I turn off my computer (for example to forget to check my mail)

  Read the article

• count the number of times a substring is found within a date range in excel

  - by ckr

  I have a spreadsheet that contains test data. column A has the test name and column B contains the test date. I want to count the number of times that the string Rerun is found within a certain date range. For example A B test1 11/2/2012 test2 11/7/2012 test1_Rerun_1 11/10/2012 test2_Rerun_1 11/16/2012 I am doing a weekly report so want to show how many tests had to be rerun in a particular week. so in the above example: week ending 11/2/12 would return 0 (look for dates 10/26/12 and <=11/2/12 with substring "Rerun") week ending 11/9/12 would return 0 (look for dates 11/2/12 and <= 11/9/12 with substring "Rerun") week ending 11/16/12 would return 2 (look for dates 11/9/12 and <=11/16/12 with substring "Rerun")

  Read the article

• Program for scanning, saving and restoring window position?

  - by hellbell.myopenid.com

  Is there some program for scanning, saving and restoring last window position? For example at this moment i have opened five window first is google chrome which is not opened at full screean but at half of display, second is notepad which is on right side, and third is cmd which is under notepad. So I want to use this combination of "layout" when primary using google chrome (surfing at internet), but if working primary at other program let's say word (writting text) i want to use other program and at different position (cause is effectivly). So the point is to easy switching from one "layout" to another. (Like in many program that support more modes, for example visual studio - debug layout, - coding layout, etc ...)

  Read the article

• Limiting to the ServerName in Apache2

  - by David

  I have 2 sites defined in my Apache2. Each one has a servername. For example: Server 1 (first in sites-enabled) responds to www.example.com Server 2 (second in sites-enabled) responds to www.example2.com Ok, the problem is when I type the server IP in the URL, the first server responds. How could I limit the response to only specifying its servername? I would like to block the IP calls. If that is not possible, I would like the second server to respond, not the first. I cannot change the order because there are aliases defined in the second server that would override the first server config.

  Read the article

• Running suspicious X programs in GNU/Linux

  - by Vi

  What the most harmful thing can malware program started as separate limited user account do if it has access to the X server? Network and filesystem things are already considered by chroot and netfilter. It obviously can lock the screen and I will need to switch to other vt and kill it manually. Can it for example disrupt other GUI programs on the same X server (access to root terminal in nearby window)? I know that it is safer to run it in separate X server, for example, in Xtightvnc or even some virtual machine, but how dangerous is to just run it like other programs?

  Read the article

• Register a domain with NIC

  - by tandu

  I recently bought a .es domain for the purpose of creating a domain hack. I registered the domain with esreg.com (SANE Systems, apparently). My card was charged, but the domain is listed as not registered. I have not yet been able to get in contact with them. Their website seems to have a small form to register the site and to specify the nameservers, but when I fill it out it says "You have to specify the NIC handles first." I don't know how to get those. They have for example a box that says "Owner" with an example of SK86-ESNIC-F4. I have another website so I may have this information, but I don't know how to get it.

  Read the article

• Script to restart BlackBerry services

  - by ICTdesk.net

  Can somebody give me a script advice/example of how to restart services? I have to restart 17 services, but the first 4 services have to be in the right order and after the restart command is given to one of the services, the next one should be started when the previous one is finished. I know I can restart a service by net command, and I can build a delay by for example a ping command that repeats for an x amount of times, but I never know in advance how long it is going to take for a service to restart. Thanks, Kindest regards, Marcel

  Read the article

< Previous Page | 185 186 187 188 189 190 191 192 193 194 195 196  | Next Page >