Search Results

Search found 6743 results on 270 pages for 'regular joe'.

Page 194/270 | < Previous Page | 190 191 192 193 194 195 196 197 198 199 200 201  | Next Page >

  • DataGridRow Cells property

    - by Michal Krawiec
    I would like to get to DataGridRow Cells property. It's a table of cells in a current DataGrid. But I cannot get access direct from code nor by Reflection: var x = dataGridRow.GetType().GetProperty("Cells") //returns null Is there any way to get this table? And related question - in Watch window (VS2008) regular properties have an icon of a hand pointing on a sheet of paper. But DataGridRow.Cells has an icon of a hand pointing on a sheet of paper with a little yellow envelope in a left bottom corner - what does it mean? Thanks for replies.

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • sharing web user controls across projects.

    - by Kyle
    I've done this using a regular .cs file that just extends System.Web.UI.UserControl and then included the assembly of the project that contains the control into other projects. I've also created .ascx files in one project then copied all ascx files from a specified folder in the properties-Build Events-Pre-build event. Now what I want to do is a combination of those two: I want to be able to use ascx files that I build in one project, in all of my other projects but I want to include them just using assembly references rather than having to copy them to my "secondary" projects as that seems a ghetto way to accomplish what I want to do. It works yes, but it's not very elegant. Can anyone let me know if this even possible, and if so, what the best way to approach this is?

    Read the article

  • what the true nature of @ in Transct-SQL

    - by Richard77
    Hello, I reading some old ScottGu's blogs on Linq2SQL. Now I'm doing the SPROC part. I'd like to know what's the exact meaning of @variable. See this from ScottGu's Blog ALTER PROCEDURE dbo.GetCustomersDetails ( @customerID nchar(5), @companyName nvarchar(40) output ) AS SELECT @companyName = CompanyName FROM Customers WHERE CustomerID = @customerID SELECT * FROM Orders WHERE CustomerID = @customerID ORDER BY OrderID I'm kind of lost as, so far, I've though of anything preceded by a '@' as a placeholder for user input. But, in the example above, it looks like '@companyName' is used as a regular variable like in C# for instance (SELECT @companyName = ...). But, @companyName is not known yet. So, what the true nature a something preceded by a '@' like above? a vriable? a simple placeholder to accommodate user entered value? Thanks for helping

    Read the article

  • Multiple Forms on the Same Page with Rails

    - by Eric Koslow
    So I'm building a rails app for high school students and I've hit a problem when it comes to creating users. I want the students to only be able to create accounts if they select their school and type in their school's password correctly. What is the correct / easiest way of doing this? Should I create a gatekeeper to the user#new action that they have to pass first or if their a way that on the same page a student can submit to forms. One would be the regular username, email, password using: form_for @user do ... end But then creating another form for the high-school / high-school password selection. Ideally the controller would be able to get the params of the high-school form, validate those, then go on to create the user from the user params. Is this possible using rails? My setup: Rails 3 and Ruby 1.9.2dev Thank you!

    Read the article

  • Django queries Especial Caracters

    - by Jorge Machado
    Hi, I Working on location from google maps and using django to. My question is: I have a String in request.GET['descricao'] lets say it contains "Via rapida". In my database i have store = "Via Rápida" i'm doing : local = Local.objects.filter(name__icontains=request.GET['descricao']) with that i can get everthing fine like "Via Rapida" but the result that have "Via rápida" never get match in the query (ASCI caracter may be ?) what must i do given a string "Via rapida" match "via rápida" and "via rapida" ? Regular Expressions ? how ? Thanks

    Read the article

  • C# Threads.Abort()

    - by Betamoo
    If a thread is running a function func1 that calls another function func2 inside it... Then I called thread.Abort() Will this stop func1 only OR func1 and func2 and all the functions func1 has called?? Thanks Edit: Here are more detail: func1 is called in a new thread, it continuously calls func2 on regular basis... func2 begin doing some work only if some array is not null.. it finishes it and return When supervisor wants to save data, it aborts Thread of func1- and then makes array null, saves data, then fill in the array with new one.. and starts Thread with func1 again.. Sometimes exception is raised because array is null in func2.. so func1 abort did not affect func2

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Using string.Format for simple things?

    - by Gerrie Schenck
    In my early .Net programming days, I used string.Format() only for complex string concatenations, for example to compile strings as Problem with customer order 234 of date 2/2/2002 and payment id 55543. But now I use string.Format for almost every string concatenation I have to do, also simple ones such as prefixing a string with something. Console.WriteLine(string.Format("\t\t{0}", myString)); Is there any possible overhead on this? Maybe I should use the regular + operator to do these simple operations? What's your opinion on this?

    Read the article

  • building mono from svn - android target

    - by Jeremy Bell
    There were patches made to mono on trunk svn to support android. My understanding is that essentially instead of Koush's system which builds mono using the android NDK build system directly, these patches add support for the android NDK using the regular mono configure.sh process. I'd like to play around with this patch, but not being an expert in the mono build system, I have no idea how to tell it to target the android NDK, or even where to look. I've been able to build mono from SVN using the default target (linux) on Ubuntu, but no documentation on how to target android was given with the patches. Since anyone not submitting or reviewing a patch is generally ignored on the mono mailing list, I figured I'd post the question here.

    Read the article

  • Convert PDF to PDF/A-1

    - by AZtec
    I know this probably is not strictly a programming-question (well maybe it is, i don't know) but i'm having serious problems trying to convert a regular pdf (with hyperlinks, bookmarks, images, embedded fonts etc.) into a PDF/A-1 format. I get all kinds of errors when i check it with pdfaPilot. How can i prepare a pdf so no problems will occur when i try to convert to PDF/A-1. Most problems can be fixed with pdfaPilot but apparently not all. One of the problems i get is with the XMP Metadata which are "not properly defined". Wat exactly does this mean, and can i do something to prevent this. Another one is: "Syntax problem: Array with more than 8191 elements" (i hope this one is solvable) I hope someone can help me out here, since i'm in a tight spot right now with deadlines that are killing me.

    Read the article

  • Open C: Directly with `FileStream` without `CreateFile` API

    - by DxCK
    I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

    Read the article

  • php regex to remove HTML

    - by Me1000
    Before we start, strip_tags() doesn't work. now, I've got some data that needs to be parsed, the problem is, I need to get rid of all the HTML that has been formated very strangely. the tags look like this: (notice the spaces) < p > blah blah blah < / p > < a href= " link.html " > blah blah blah < /a > All the regexs I've been trying aren't working, and I don't know enough about regex formating to make them work. I don't care about preserving anything inside of the tags, and would prefer to get rid of the text inside a link if I could. Anyone have any idea? (I really need to just sit down and learn regular expressions one day)

    Read the article

  • Seemingly normal link does not work in MVC, IIS5, SparkView.

    - by Matt W
    I have a regular link being generated in MVC1.0 as: /Login/Logout This link does not work. The code for it is: <a href="${Links.Logout}" class="SignOut">Sign out</a> As I am using SparkView. I am using IIS5.1 on WinXP Pro. I cannot work out why the link on the page calls the MVC action if I open the link in a separate browser tab but not when I click directly on it in the original page. This feels like a browser bug (Chrome, Firefox, IE8) but they all perform the same way. Thanks, Matt.

    Read the article

  • How do I put my return data from an asmx into JSON? I'm having trouble finding decent literature

    - by jphenow
    I want to return an array of javascript objects from my asp.net asmx file. ie. variable = [ { *value1*: 'value1', *value2*: 'value2', ..., }, { . . } ]; I seem have been having trouble reaching this. I'd put this into code but I've been hacking away at it so much it'd probably do more harm than good in having this answered. Basically I am using a web service to find names as people type the name. I'd use a regular text file or something but its a huge database that's always changing - and don't worry I've indexed the names so searching can be a little snappier - but I would really prefer to stick with this method and just figure out how to get usable JSON back to javascript. I've seen a few that sort of attempt to describe how one would approach this but I honestly think microsofts articles are damn near unreadable. Thanks in advance for assistance.

    Read the article

  • NSString: EOL and rangeOfString issues

    - by carloe
    Could someone please tell me if I am missing something here... I am trying to parse individual JSON objects out of a data stream. The data stream is buffered in a regular NSString, and the individual JSON objects are delineated by a EOL marker. if([dataBuffer rangeOfString:@"\n"].location != NSNotFound) { NSString *tmp = [dataBuffer stringByReplacingOccurrencesOfString:@"\n" withString:@"NEWLINE"]; NSLog(@"%@", tmp); } The code above outputs "...}NEWLINE{..." as expected. But if I change the @"\n" in the if-statement above to @"}\n", I get nothing.

    Read the article

  • NVP request - CreateRecurringPaymentsProfile

    - by jiwanje.mp
    Im facing problem with Trail period and first month payemnt. My requirement is users can signup with trial period which allow new users to have a 30 day free trial. This means they will not be charged the monthly price until after the first 30 days the regular amount will be charged to user. but the next billing date should be one month later the profile start date. but next billing data and profile start date shows same when i query by GetRecurringPaymentProfile? Please help me how can i send the Recurring bill payment for this functionality. Thanks in advance, jiwan

    Read the article

  • How to skip "Loose Object" popup when running 'git gui'

    - by Michael Donohue
    When I run 'git gui' I get a popup that says This repository currently has approximately 1500 loose objects. It then suggests compressing the database. I've done this before, and it reduces the loose objects to about 250, but that doesn't suppress the popup. Compressing again doesn't change the number of loose objects. Our current workflow requires significant use of 'rebase' as we are transitioning from Perforce, and Perforce is still the canonical SCM. Once Git is the canonical SCM, we will do regular merges, and the loose objects problem should be greatly mitigated. In the mean time, I'd really like to make this 'helpful' popup go away.

    Read the article

  • Replace text in string with delimeters using Regex

    - by user1057735
    I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

    Read the article

  • How can I replace only the last occurence of an number in a string with php?

    - by Shawn
    How would you change this: a-10-b-19-c into something like this: a-10-b-20-c using regular expressions in PHP? The only solution I've found so far is: reverse the original string - "c-91-b-01-a" find the first number - "91" reverse it - "19" turn in into a number (parseInt) - 19 add 1 to it (+1) - 20 turn it into a string again (toString) - "20" reverse it again - "02" replace the original match with this new number - "c-02-b-01-a" reverse the string - "a-10-b-20-c" I was hoping someone on SO would have a simpler way to do this... Anyone?

    Read the article

  • How can I build a Truth Table Generator?

    - by KingNestor
    I'm looking to write a Truth Table Generator as a personal project. There are several web-based online ones here and here. (Example screenshot of an existing Truth Table Generator) I have the following questions: How should I go about parsing expressions like: ((P = Q) & (Q = R)) = (P = R) Should I use a parser generator like ANTLr or YACC, or use straight regular expressions? Once I have the expression parsed, how should I go about generating the truth table? Each section of the expression needs to be divided up into its smallest components and re-built from the left side of the table to the right. How would I evaluate something like that? Can anyone provide me with tips concerning the parsing of these arbitrary expressions and eventually evaluating the parsed expression?

    Read the article

  • Getting Unit Tests to work with Komodo IDE for Python

    - by devoured elysium
    I've tried to run the following code on Komodo IDE (for python): import unittest class MathLibraryTests(unittest.TestCase): def test1Plus1Equals2(self): self.assertEqual(1+1, 2) Then, I created a new test plan, pointing to this project(file) directory and tried to run it the test plan. It seems to run but it doesn't seem to find any tests. If I try to run the following code with the "regular" run command (F7) class MathLibraryTests(unittest.TestCase): def testPlus1Equals2(self): self.assertEqual(1+1, 2) if __name__ == "__main__": unittest.main() it works. I get the following output: ---------------------------------------------------------------------- Ran 1 test in 0.000s OK What might I be doing wrong?

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

< Previous Page | 190 191 192 193 194 195 196 197 198 199 200 201  | Next Page >