Search Results

Search found 6743 results on 270 pages for 'regular joe'.

Page 195/270 | < Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Theory of computation - Using the pumping lemma for CFLs

    - by Tony
    I'm reviewing my notes for my course on theory of computation and I'm having trouble understanding how to complete a certain proof. Here is the question: A = {0^n 1^m 0^n | n>=1, m>=1} Prove that A is not regular. It's pretty obvious that the pumping lemma has to be used for this. So, we have |vy| = 1 |vxy| <= p (p being the pumping length, = 1) uv^ixy^iz exists in A for all i = 0 Trying to think of the correct string to choose seems a bit iffy for this. I was thinking 0^p 1^q 0^p, but I don't know if I can obscurely make a q, and since there is no bound on u, this could make things unruly.. So, how would one go about this?

    Read the article

  • Forumotion profile customization using jQuery based on URL

    - by Harvengure
    The idea is have a jQuery snippet (I like Jquery...I can understand it better then regular javascript) that will detect that when it has been run on a profile with a url such as "http://customize.forum-motion.com/profile.forum?mode=viewprofile&u=1" (just as an example)...then upon detecting that it is a url of a profile...fetch data from a specific (and most likely hidden) element before wrapping that data in css tags and appending it to the heady of the current document. In short I'm trying to figure out how to make a sort of profile customization system where users can create their own css. The biggest problem I am having so far is figuring out how to make it so that the snippet can figure out what URL its being run on. Is there a function that can do this in jQuery at all?

    Read the article

  • How to determine if code is running in Foundation or GUI?

    - by Mitch Cohen
    I'm writing a Mac app with two targets - a regular Cocoa GUI and a Foundation command-line tool. They do very similar things other than the GUI, so I'm sharing most of the code between the two. I'd like to do a few things slightly differently depending on which target is running. I can think of many ways to do this (#define something in the pch, check for existence of GUI definitions...). I'm curious if there's a standard or recommended way to do this. Thanks!

    Read the article

  • Should you remove all warnings in your Verilog or VHDL design? Why or why not?

    - by Brian Carlton
    In (regular) software I have worked at companies where the gcc option -Wall is used to show all warnings. Then they need to be dealt with. With non-trivial FPGA/ASIC design in Verilog or VHDL there are often many many warnings. Should I worry about all of them? Do you have any specific techniques to suggest? My flow is mainly for FPGAs (Altera and Xilinx in particular), but I assume the same rules would apply to ASIC design, possibly more so due to the inability to change the design after it is built.

    Read the article

  • Trying to create text boxes dynammically and remove them

    - by fari
    I am using VB.NET vb 2008 . I am trying to create text boxes dynammically and remove them here is the code i have written so far Private Sub setTextBox() Dim num As Integer Dim pos As Integer num = Len(word) temp = String.Copy(word) Dim intcount As Integer remove() GuessBox.Visible = True letters.Visible = True pos = 0 'To create the dynamic text box and add the controls For intcount = 0 To num - 1 Txtdynamic = New TextBox Txtdynamic.Width = 20 Txtdynamic.Visible = True Txtdynamic.MaxLength = 1 Txtdynamic.Location = New Point(pos + 5, 0) pos = pos + 30 'set the font size Txtdynamic.Font = New System.Drawing.Font("Verdana", 8.25!, System.Drawing.FontStyle.Regular, System.Drawing.GraphicsUnit.Point, CType(0, Byte)) Txtdynamic.Name = "txtdynamic_" & intcount & "_mycntrl" Txtdynamic.Enabled = False Txtdynamic.Text = "" Panel1.Controls.Add(Txtdynamic) Next Panel1.Visible = True Controls.Add(Panel1) Controls.Add(GuessBox) Controls.Add(letters) letter = "" letters.Text = "" hang_lable.Text = "" tries = 0 End Sub`enter code here` Function remove() For Each ctrl In Panel1.Controls Panel1.Controls.Remove(ctrl) Next End Function I am able to create the textboxes but only a few of them are removed. by using For Each ctrl In Panel1.Controls it doesn't retrieve all the controls and some ae duplicated as well.

    Read the article

  • preg_match problem

    - by Biroka
    I'm trying to get some stuff from a string in php. In RegexBuddy and Regular expression tester (firefox addon) it works good, but php gives me the following: Warning: preg_match() [function.preg-match]: Compilation failed: unmatched parentheses at offset 34 in D:\path\example.php on line 62 my pattern is "/.{4}_tmp\\([A-Za-z0-9.\\]*)\(([0-9]*)\) : (.*)/i" an example string: C:\Temp\browseide\projects\32\821C_tmp\SourceFiles\main.c(8) : error C2143: syntax error : missing ';' before 'for' what RegexBuddy gets: 821C_tmp\SourceFiles\main.c(8) : error C2143: syntax error : missing ';' before 'for' Group 1: SourceFiles\main.c Group 2: 8 Group 3: error C2143: syntax error : missing ';' before 'for'

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • How to get a service to listen on port 80 on Windows Server 2003

    - by Miky D
    I've coded a custom windows service that listens on TCP port 80 but when I try to install it on a Windows Server 2003 machine it fails to start because some other service is already listening on that port. So far I've disabled the IIS Admin service and the HTTP SSL service but no luck. When I run netstat -a -n -o | findstr 0.0:80 it gives me the process id 4 as the culprit, but when I look at the running processes that process id points to the "System" process. What can I do to get the System process to stop listening on port 80 and get my service to listen instead? P.S. I should point out that the service runs fine if I install it on my Windows XP or Windows 7 development boxes. Also, I should specify that this has nothing to do with it being a service. I've tried starting a regular application that attempts to bing to port 80 on the Windows Server 2003 with the same outcome - it fails because another application is already bound to that port.

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • Listing mysql row entries from tags into one single row

    - by Derrick
    Hi guys, Ive got two tables, one a listings and another representing a list of tags for the listing table. In the listings table the tag ids are stored in a field called tags as 1-2-3- this has worked out very well for me regular expressions and joins to seperate and display the data, BUT... I now need to pull the titles of those tags into a single row. See below. listings table id tags 1 1-2-3- 2 4-5-6- tags table id title 1 pig 2 dog 3 cat 4 mouse 5 elephant 6 duck And what I need to produce out of the listings table is: id tags 2 mouse, elephant, duck any suggestions?

    Read the article

  • How can I build a Truth Table Generator?

    - by KingNestor
    I'm looking to write a Truth Table Generator as a personal project. There are several web-based online ones here and here. (Example screenshot of an existing Truth Table Generator) I have the following questions: How should I go about parsing expressions like: ((P = Q) & (Q = R)) = (P = R) Should I use a parser generator like ANTLr or YACC, or use straight regular expressions? Once I have the expression parsed, how should I go about generating the truth table? Each section of the expression needs to be divided up into its smallest components and re-built from the left side of the table to the right. How would I evaluate something like that? Can anyone provide me with tips concerning the parsing of these arbitrary expressions and eventually evaluating the parsed expression?

    Read the article

  • Typed Arrays in Gecko 2: Float32Array concatenation and expansion.

    - by janesconference
    Hi all, I'm a bit confused with Javascript Typed Arrays. What I have several *Float32Array*s, that have no concat method. I'd like to concatenate them all inside another Float32Array, but: as I said before, there is no concatenation method if I try to write past the array length, the array is not expanded (aka this won't work - please note that event.frameBuffer and buffer are both Float32Array and that I don't know what the final length of my buffer will be): var length_now = buffer.length; for (var i = 0; i < event.frameBuffer.length; i += 1) { buffer [length_now + i] = event.frameBuffer[i]; } The only solution I found is to copy the Float32Array in a regular array, that's definitely not what I want. How would you do, stackoverflowers?

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • How can I remove sensitive data from the debug_backtrace function?

    - by RenderIn
    I am using print_r(debug_backtrace(), true) to retrieve a string representation of the debug backtrace. This works fine, as print_r handles recursion. When I tried to recursively iterate through the debug_backtrace() return array before turning it into a string it ran into recursion and never ended. Is there some simple way I can remove certain sensitive key/value pairs from the backtrace array? Perhaps some way to turn the array to a string using print_r, then back to an array with the recursive locations changed to the string RECURSION, which I could the iterate through. I don't want to execute regular expressions on the string representation if possible.

    Read the article

  • Efficient data structure design

    - by Sway
    Hi there, I need to match a series of user inputed words against a large dictionary of words (to ensure the entered value exists). So if the user entered: "orange" it should match an entry "orange' in the dictionary. Now the catch is that the user can also enter a wildcard or series of wildcard characters like say "or__ge" which would also match "orange" The key requirements are: * this should be as fast as possible. * use the smallest amount of memory to achieve it. If the size of the word list was small I could use a string containing all the words and use regular expressions. however given that the word list could contain potentially hundreds of thousands of enteries I'm assuming this wouldn't work. So is some sort of 'tree' be the way to go for this...? Any thoughts or suggestions on this would be totally appreciated! Thanks in advance, Matt

    Read the article

  • Does DataType DataAnnotation Check the Expression?

    - by Jason
    I am currently using DataAnnotations within my ASP.NET MVC website to ensure data is properly validated. One question I wanted to verify (I think I know the answer, but I can't find verification online) - does the DataType DataAnnotation perform regular expression checks to ensure that you have received a valid e-mail/phone/currency/etc? [Required(ErrorMessage = "Price required")] [DataType(DataType.Currency, ErrorMessage = "Not a valid price")] [Range(0, double.MaxValue, ErrorMessage = "Price must be greater than 0.")] public decimal Price { get; set; } I believe the answer is no (meaning I have to provide my own, custom, RegularExpressionAttribute), but I wanted to double check before I do that for various field types.

    Read the article

  • Testing file existence using NSURL

    - by Peter Hosey
    Snow Leopard introduced many new methods to use NSURL objects to refer to files, not pathnames or Core Services' FSRefs. However, there's one task I can't find a URL-based method for: Testing whether a file exists. I'm looking for a URL-based version of -[NSFileManager fileExistsAtPath:]. Like that method, it should return YES if the URL describes anything, whether it's a regular file, a directory, or anything else. I could attempt to look up various resource values, but none of them are explicitly guaranteed to not exist if the file doesn't, and some of them (e.g., NSURLEffectiveIconKey) could be costly if it does. I could just use NSFileManager's fileExistsAtPath:, but if there's a more modern method, I'd prefer to use that. Is there a simple method or function in Cocoa, CF, or Core Services that's guaranteed/documented to tell me whether a given file (or file-reference) URL refers to a file-system object that exists?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Open C: Directly with `FileStream` without `CreateFile` API

    - by DxCK
    I trying to open C: directly with FileStream without success: new FileStream("C:", FileMode.Open, FileAccess.Read, FileShare.ReadWrite); System.UnauthorizedAccessException was unhandled Message="Access to the path 'C:\' is denied." Source="mscorlib" StackTrace: in System.IO.__Error.WinIOError(Int32 errorCode, String maybeFullPath) in System.IO.FileStream.Init(String path, FileMode mode, FileAccess access, Int32 rights, Boolean useRights, FileShare share, Int32 bufferSize, FileOptions options, SECURITY_ATTRIBUTES secAttrs, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share, Int32 bufferSize, FileOptions options, String msgPath, Boolean bFromProxy) in System.IO.FileStream..ctor(String path, FileMode mode, FileAccess access, FileShare share) in ReadingMftNewTest.Program.Main(String[] args) in D:\CS\2008\ReadingMftNewTest\ReadingMftNewTest\Program.cs:line 76 Note that i openning "C:" but the error says "C:\", where did this slash came from? :\ Is there any chance to open C: without using the CreateFile API? I really don't want be depending on WIN32 API because this code should also run on Mono that dont support WIN32 API, but successfully openning devices with regular FileStream (Mono 1 Microsoft 0).

    Read the article

  • ASP.NET MVC controllers with identical names

    - by Anton Gogolev
    Hi! Here's what I'm trying to do. I have an ASP.NET MVC web application, where I'd like to have a separate "admin" area (accessible via http://example.com/admin) and a regular area, available for all users. In both these parts of the site I have a /blogs section, but when accessing http://example.com/admin/blogs I want to be presented with admin interface for blogs, whereas usual http://example.com/blogs should just list all blogs. And the problem itself is: how do I get ASP.NET MVC to instantiate appropriate controllers, provided that there are two BlogsControllers: one in Site.Admin namespace, and the other is in Site.Sitefront namespace? Granted, I could rename admin controller to BlogsAdminController, but I'd like to keep the names as they already are.

    Read the article

  • Using C# and gppg, how would I construct an abstract syntax tree?

    - by Rupert
    Is there a way to do this almost out-of-the-box? I could go and write a big method that would use the collected tokens to figure out which leaves should be put in which branches and in the end populate a TreeNode object, but since gppg already handled everything by using supplied regular expressions, I was wondering if there's an easier way? Even if not, any pointers as to how best to approach the problem of creating an AST would be appreciated. Apologies if I said anything silly, I'm only just beginning to play the compiler game. :)

    Read the article

  • Which testing method to go with? [Rails]

    - by yuval
    I am starting a new project for a client today. I have done some rails projects before but never bothered writing tests for them. I'd like to change that starting with this new project. I am aware there are several testing tools, but am a bit confused as to which I should be using. I heard of RSpec, Mocha, Webrat, and Cucamber. Please keep in mind I never really wrote any regular tests, so my knowledge of testing in general is quite limited. How would you suggest I get started? Thanks!

    Read the article

  • PostgreSQL String search for partial patterns removing exrtaneous characters

    - by tbrandao
    Looking for a simple SQL (PostgreSQL) regular expression or similar solution (maybe soundex) that will allow a flexible search. So that dashes, spaces and such are omitted during the search. As part of the search and only the raw characters are searched in the table.: Currently using: SELECT * FROM Productions WHERE part_no ~* '%search_term%' If user types UTR-1 it fails to bring up UTR1 or UTR 1 stored in the database. But the matches do not happen when a part_no has a dash and the user omits this character (or vice versa) EXAMPLE search for part UTR-1 should find all matches below. UTR1 UTR --1 UTR 1 any suggestions...

    Read the article

  • How can I replace only the last occurence of an number in a string with php?

    - by Shawn
    How would you change this: a-10-b-19-c into something like this: a-10-b-20-c using regular expressions in PHP? The only solution I've found so far is: reverse the original string - "c-91-b-01-a" find the first number - "91" reverse it - "19" turn in into a number (parseInt) - 19 add 1 to it (+1) - 20 turn it into a string again (toString) - "20" reverse it again - "02" replace the original match with this new number - "c-02-b-01-a" reverse the string - "a-10-b-20-c" I was hoping someone on SO would have a simpler way to do this... Anyone?

    Read the article

< Previous Page | 191 192 193 194 195 196 197 198 199 200 201 202  | Next Page >