Search Results

Search found 207 results on 9 pages for 'vijay prasath'.

Page 2/9 | < Previous Page | 1 2 3 4 5 6 7 8 9  | Next Page >

  • Network Manager kicks off abruptly

    - by Vijay Selvaraj
    I have installed Ubuntu 10.10 and trying to connect with my ADSL Wireless broadband internet modem using Linksys WUSB600N receiver. The good news is the OS is able to detect my wifi network and I am able to hook to network over WPA authentication with basic settings. But the network goes off abruptly and never connects again until I reboot the machine. I have Windows 7 as dual boot on my machine. The same adapter works perfectly with Windows 7 but not in Ubuntu. Is there anything in need to tweak to make things working or do I need to try any other better network manager on Ubuntu?

    Read the article

  • Groovy Debugging

    - by Vijay Allen Raj
    Groovy Debugging - An Overview:ADF BC developers may express snippets of business logic (like the following) as embedded groovy expressions: default / calculated attribute valuesvalidation rules / conditionserror message tokensLOV input values (VO) This approach has the advantages that: Groovy has a compact, EL-like syntax for expressing simple logicADF has extended this syntax to provide useful built-insembedded Groovy expressions are customizableGroovy debugging support helps improve maintainability of business logic expressed in Groovy.Following is an example how groovy debugging works.Example:This example shows how a script expression validator can be created and the groovy script debugged. It shows Step over, breakpoint functionalities as well as syntax coloring.Let us create a ADFBC application based on Emp and Dept tables, and add a script expression validator based on the script:  if (Sal >= 5000){ //If EmpSal is greater than a property value set on the custom //properties on the root AM //raise a custom exception else raise a custom warning if (Sal >= source.DBTransaction.rootApplicationModule.propertiesMap.salHigh) { adf.error.raise("ExcGreaterThanApplicationLimit"); } else { adf.error.warn("WarnGreaterThan5000"); } } else if (EmpSal <= 1000) { adf.error.raise("ExcTooLow"); }return true;In the Emp.xml Flat editor, place breakpoints at various locations as shown below:Right click the appmodule and click Debug. Enter a value greater than 5000 and click next. You can see the debugging work as shown below:  The code can be also be stepped over and debugged.

    Read the article

  • usage of setPropertyListener and setActionListener

    - by Vijay Mohan
    The incorrect usage could lead to hard-to-debug problems so better to understand the fundamentals behind it's working.setpropertyListener queues an event on the server side, so if for a command component you have a showPopup behavior/actionListner as well as setPropertyListener then fwk does the queuing correctly and raises further event on the component. While, the setactionListener simply raises an event on the server side instead of queueing it, so any further event on command component gets cancelled.Also, if you use an ActionListener and showPopup behavior together on a command component, then the order of their invocation is undetermined and also one of event gets cancelled on the component. So, either use only actionListner and do the popup invocation stuff progrmmatically in your bean or use the declarative stuff logically so that no clash of event happens.

    Read the article

  • New Worklist features on 12.1.3

    - by Vijay Shanmugam
    Following new Worklist features are available on E-Business Suite 12.1.3 via Patch 13646173. Ability to view comments on top of a notification If an action is performed on a notification such as Reassign, Request for Information or Provide Information, the recipient of the notification will see who performed the last action and the associated comment on top of the notification. Reassigning a request for information notification If an approver requests more information on a notification from it's submitter, the submitter now has two options Answer Request for More Information Transfer Request for More Information If the submitter thinks the requested information can be provided by another user, he/she can transfer the request to the other user. Please note that only Transfer is supported for Request for More Information. Once transferred, the submitter cannot access the notification and provide the requested information. Use actual sent date when reassigning a notification The Sent field in notification header always showed the date on which the notification was first created. If the notification was later reassigned, the Sent date was not updated to show the last action date. This caused problems in following scenario Approval notification was sent to JACK on 01-JAN-2012 JACK waited for 10 days before reassigning to JILL on 10-JAN-2012 JILL does not see the notification as sent on 10-JAN-2012, instead sees it as sent on 01-JAN-2012 Although the notification was originally created on 01-JAN-2012, it was sent to JILL only on 10-JAN-2012 The enhancement now shows the correct sent date in Worklist and Notification Details page. Figure 1 - Depicts all the above 3 features Related Action History for response required notification So far it was possible to embed Action History of an response-required notification into another FYI notification using #RELATED_HISTORY attribute (Please refer to Workflow Developer Guide for details about this attribute). The enhancement now enables developers to embed Action History of one response-required notification into another response-required notification. To embed Action History of one response-required notification into another, create message attribute #RELATED_HISTORY. To this attribute set a value during run-time in the following format. {TITLE}[ITEM_TYPE:ITEM_KEY]PROCESS_NAME:ACTIVITY_LABEL_NAMEThe TITLE, ITEM_TYPE and ITEM_KEY are optional values. TITLE is used as Related Action History header title. If TITLE is not present, then a default title "Related Action History" is shown. If ITEM_TYPE is present and ITEM_KEY is not, For Example: {TITLE}[ITEM_TYPE]PROCESS_NAME:ACTIVITY_LABEL_NAME , the Related Action History is populated from parent item type of the current item. If both ITEM_TYPE and ITEM_KEY is present, For Example: {TITLE}[ITEM_TYPE:ITEM_KEY]PROCESS_NAME:ACTIVITY_LABEL_NAME , the Related Action History is populated from that specific instance activity. Figure 2 - Depicts Related Action History feature

    Read the article

  • How to access a row from af:table out of context

    - by Vijay Mohan
    Scenario : Lets say you have an adf table in a jsff and it is included as af:region inside other page(parent page).Now your requirement is to access some specific rows from the table and do some operations. Now, since you are aceessing the table outside the context in which it is present, so first you will have to setup the context and then you can use the visitCallback mechanism to do the opeartions on table. Here is the sample code: ================= final RichTable table = this.getRichTable();         FacesContext facesContext = FacesContext.getCurrentInstance();         VisitContext visitContext =   RequestContext.getCurrentInstance().createVisitContext(facesContext,null, EnumSet.of(VisitHint.SKIP_TRANSIENT,VisitHint.SKIP_UNRENDERED), null);         //Annonymous call         UIXComponent.visitTree(visitContext,facesContext.getViewRoot(),new VisitCallback(){             public VisitResult visit(VisitContext context, UIComponent target)               {                   if (table != target)                   {                     return VisitResult.ACCEPT;                   }                   else if(table == target)                   {                       //Here goes the Actual Logic                       Iterator selection = table.getSelectedRowKeys().iterator();                       while (selection.hasNext()) {                           Object key = selection.next();                           //store the original key                           Object origKey = table.getRowKey();                           try {                               table.setRowKey(key);                               Object o = table.getRowData();                               JUCtrlHierNodeBinding rowData = (JUCtrlHierNodeBinding)o;                               Row row = rowData.getRow();                               System.out.println(row.getAttribute(0));                           }                           catch(Exception ex){                               ex.printStackTrace();                           }                           finally {                               //restore original key                               table.setRowKey(origKey);                           }                       }                   }                   return VisitResult.COMPLETE;               }         }); 

    Read the article

  • MultiSelectChoice: How to get underlying values selected

    - by Vijay Mohan
    Let's say you include a multiselectchoice component in your jspx/jsff page, which has <f;selectItem> or <af:forEach> binded to a VO iterator to populate the multiselectchoice and the value property of which is binded to a List attribute binding.When the user selects some items in that choice List then u want the actual values to be posted.You can check the valuepassthrough flag to true , but many a times it doesn't help and you end up getting the indexes of multiselect values.Here is a way to get the actual values..Lets say in the bean u have a utility method to achieve this as follows..You can associate a valueChangeListener for the multiselectchoice as follows..public void onValueChangeOfLOV(ValueChangeEvent valueChangeEvent) { //get array of indexes of selected items in master list List valueIndexes = (List)valueChangeEvent.getNewValue(); String concatCodes = returnSelectmanyChoiceValues(valueIndexes,"YourIterator", "YourAttribute"); } public String returnSelectmanyChoiceValues(List valueIndexes,String iterName, String idAttrName){ DCBindingContainer dc = (DCBindingContainer)BindingContext.getCurrent().getCurrentBindingsEntry(); DCIteratorBinding iter = dc.findIteratorBinding(iterName); ViewObject vo = iter.getViewObject(); String codes = ""; for(Object index : valueIndexes){ String iIndex = (String)index; Row row = vo.getRowAtRangeIndex(Integer.parseInt(iIndex)); codes = codes +(String)row.getAttribute(idAttrName)+","; } //remove last "," if(codes.endsWith(",")) codes = codes.substring(0,codes.lastIndexOf(",")); return codes; }This will return u a comma separated values of the selected items. if you want thenYou can store it in a List.

    Read the article

  • News Applications internal working [on hold]

    - by Vijay
    How does news applications work other than RSS Feed based applications? I know some of them take the RSS content from the source site.But sometimes I see, those applications show - Title Description Date Image video etc. Even though when I see the original site's rss, image, video is not there in rss. So how does one get that to show in there applications? Some applications even shows feeds from magazine sites, newspaper sites. How do these applications work? I am creating an application which will link to different news sites feeds categorized (like top news, technology, games, articles etc.) On the front page it will show the website names, then on selection of any news site it will get the feed from that website and show it to user. So I would like to know All the fetching of data from should be done on user selection or data should be prefetched? Detailed information I want to fetch from the original like provided in the rss data. How should I go about it?

    Read the article

  • Internet (HTTP) is not working on Sony Viao

    - by vijay
    I switched my sony viao laptop from XP to ubuntu 10.04 recently. I have it connected through router at home. The internet was working fine with XP. With ubuntu, i am not able to connect to interenet. I am able to update using apt, and i am able to ping too. It seems like there is a DNS issue, when i try to goto sites from firefox, it doesn't work. I tried disabling the ipv6 in firefox config, it doesn't work. My router is on 192.168.2.1 instead of 192.168.1.1 any ideas on what config i might need to change to make this work? or could this be a drive issue?

    Read the article

  • installing xbuntu desktop in ubuntu 12.04

    - by Vijay Nalawade
    I have installed ubuntu 12.04. I want to install xfce desktop.when i able to install xubuntu desktop getting following message. sudo apt-get install lubuntu-desktop Media change: please insert the disc labeled 'Ubuntu 12.04.1 LTS Precise Pangolin - Release i386 (20120817.3)' in the drive '/cdrom/' and press enter i didn't know why this error are coming and also i don't have CD driver. i installed Ubuntu using usb. please let me know how to install xubuntu desktop.

    Read the article

  • pppoeconf problem in ubuntu

    - by Vijay Nalawade
    pppoeconf now working in ubuntu 11.04. so i tried using network manager by adding dsl connection.after putting all details user name ,password , service name its working first time, named dslconnection1. but after rebooting i am not able to connect to internet. both ppppoeconf is not working and dslconnection1 option is not visible,also auto etho is not visible. so how to connect to internet in above case

    Read the article

  • How to work for Ubuntu? [duplicate]

    - by vijay
    This question already has an answer here: How can I contribute to Ubuntu? 4 answers I am very much impressed by Ubuntu. I want to work for it but I know only C language. Can somebody guide me on how to work for Ubuntu. thanks for your reply I don't want to learn any other programming languages. programatically i want to contribute.

    Read the article

  • How to set an alert in Selenium RC using C# in .cs file?

    - by Vijay Prasath
    Purpose: To convert the following code from Selenium IDE to RC in C#. <tr> <td>storeEval</td> <td>alert("Please Enter the Verification code");</td> <td></td> </tr> To set pause for enter Captcha value. in a loop. its working fine in IDE. Tried with the converted code it shows as the following but VS08 shows Synax error. String = selenium.GetEval("alert(\"Please Enter the Verification code\");");

    Read the article

  • Best Automation Frame work design

    - by Vijay Prasath
    Using Nunit Frame work or Creating Visual studio Test Projects which one is the best way to save the time and effective automation? Now i am using selenium IDE to script the maximum parts in my application to reduce the time of execution(i feel ide execution is faster than test project execution) using gotoif, while, regexp ..etc and would go Selenium RC only for data driven methods and the events which have not been handled by IDE. Please suggest me Am i in the right way? because i am in the beginning stage on Automating my applications asking this Question for early correction is better.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 1 2 3 4 5 6 7 8 9  | Next Page >