Search Results

Search found 11922 results on 477 pages for 'odi solutions and news'.

Page 205/477 | < Previous Page | 201 202 203 204 205 206 207 208 209 210 211 212  | Next Page >

  • Website & Forum sharing the same login credentials ?

    - by Brian
    I am going to be running a small site (100 hits a week maybe) and I am looking for a quick and easy way to share login information between the main website, a control panel (webmin, cpanel, or something), and the forum. One login needed to access any of the three. The website won't have use for the login, per say. But it will display "logged in" when you are on the website. Any custom solutions, any thoughts, logic, examples?

    Read the article

  • How do you monitor and react when some scheduled job fails? - general question

    - by Dzida
    Hi, In many projects my team faced problems with 'silent fails' of some important components. There are lot of tasks executed behind the scenes and if somethings fails (either by errors in logic or hardware problems) in most cases responsible person is not notified (or not notified instantly). I know about heavy-weight monitoring tools that could solve some of that problems but there over-complicated and too expensive for our team. I am interested what are your solutions for such problems.

    Read the article

  • Circumvent proxy filter that disables the download of EXE files

    - by elgrego
    Do you know of a way to download exe files although the web proxy has a filter in place not to allow this? I have searched for a feature web site that does automatic file renaming. That should certainly make it possible. The solution would take a URL and then change the extension so that it would look to my proxy as I was downloading a .dat file (or similar). There are perhaps other solutions to this problem.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

  • Any way to Sync Google Bookmarks to iPhone OTA?

    - by BenA
    Does anybody know if its possible to sync Google Bookmarks over the air to my iPhone? Either natively or with an App? Googling it only seems to yield solutions involving importing my bookmarks to IE, and then syncing through iTunes. I'd like to skip both of these middlemen if thats at all possible.

    Read the article

  • Blocking IP addresses Load Balanced Cluster

    - by Dom
    Hi We're using HAproxy as a front end load balancer / proxy and are looking for solutions to block random IP addresses from jamming the cluster. Is anyone familiar with a conf for HAProxy that can block requests if they exceed a certain threshold from a single IP within a defined period of time. Or can anyone suggest a software solution which could be placed in front of HAProxy to handle this kind of blocking. Thanks Dom--

    Read the article

  • Personal Browsing Monitor Software [closed]

    - by jmadden93
    Anyone know of any personal browsing monitor software? I'd like to be able to monitor my own browsing habbits and the time I spend on entertainment, vs work vs educational sites. Something that offers more than simply looking at the history feature built into browsers. It would be nice if it gave you a breakdown of how much time you spend on certain categories of sites like social media, vs video, vs. news, productivity, etc. I think it would be useful to know how one spends their time.

    Read the article

  • Any free Exchange hosts out there?

    - by Pure.Krome
    Hi folks, Are there any free Microsoft Exchange hosted solutions? I understand that Microsoft Exchange is a paid/licensed product, but I was curious if there might be a host that has a free hosting model (e.g. for <= 3 mailboxes per domain)? Larger mail boxes per domain == cost. ?? Finally, please refrain from suggesting other mail services (eg. sendmail, etc).

    Read the article

  • Free web gallery installation that can use existing directory hierarchy in filesystem?

    - by user1338062
    There are several different free software gallery projects (Gallery, Coppermine, etc), but as far as I know each of those creates a copy of imported images in their internal storage, be it directory structure or database). Is there any gallery software that would allow keeping existing directory hierarchy of media files (images, videos), as-is, and just store the meta-data of them in a database? I guess at least various NAS solutions ship with software like this.

    Read the article

  • Virtualization Solution

    - by Xeross
    I have a home server I use for various things, and have recently switched over to using VMs, however I can't seem to find a decent VM solution that does what I want. Xen Connection keeps dropping every few minutes (So this means it's practically unusable), but with ParaVirtOps faster than VMWare ESXi, and I can use software RAID VMWare ESXi Works fine, no connection drops, but I have to run it from USB stick, modify some archive file and I can't use software RAID -- So are there any other solutions out there that do allow me to use software raid, that have a stable network connection, and that also offer paravirtualization

    Read the article

  • Problems with Finder background images produced in Mac OS X 10.6?

    - by Joe
    Morning all. I'm creating DMG installers with background pictures. My build machine is 10.6. I'm having problems getting them working consistently: If I create one on 10.4 it works fine in 10.5, 10.5 and 10.6, If I create one for 10.5 it works fine in 10.4, 10.5 and 10.6, But if I create one in 10.6, the background picture shows in 10.6 but does not show in 10.4 or 10.5. I think I recall having seen similar reports in one or two places but there's not much information on the web. Has anyone here come across this problem? Is it recognised? Fixable? Unfortunately I have no option of running 10.5 on my build machine... Thanks! Update: This is a confirmed known bug in 10.6 . I will update this if there is any extra news.

    Read the article

  • ffdshow h.264 audio desync

    - by Core Xii
    When I encode video with ffdshow with h.264, the audio is out of sync. At the very beginning of the video, the picture freezes for about 1 second, while the audio plays fine, resulting in the audio being that 1 second ahead of the picture throughout the entire video. Any ideas on possible causes or, obviously, solutions?

    Read the article

  • How to prevent Vista from entering Sleep mode when certain conditions exist?

    - by idyllhands
    Mainly, I would like to prevent my laptop from entering Sleep mode when I am playing music or streaming video. This is on my laptop, so another option that would work would be to prevent sleep mode whenever the laptop is plugged into my tv via HDMI (ie when HDMI port is in use). Or prevent sleep mode whenever there is audio playing.. I am soon upgrading to Windows 7, so solutions using 7 would be great also/instead. Thanks!

    Read the article

  • Some Domain Clients unable to access certain websites

    - by Shaunie
    I have a small domain around 20 clients with a 2003 R2 SP2 DC. Most of my clients can browse the internet freely and dont have a problem. However a couple are reporting problems accessing certain sites. IE: Hotmail, skyscanner, bbc news They can browse the sites sometimes then other times they get 408\409 errors. other machines in the domain can access these sites. I have cleared out dns cache on these machines modified external dns servers on the DC still to no avail. The main issue is the person not able to access skyscanner uses it several times a day to book flights for employess going on leave or returning to work. both clients are running XP SP3 though one machine is getting change for one running win7 shortly. Any advice greatly appreciated. thanks

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • How to block a website completely?

    - by user37076
    I want to block some sites(e.g. youtube,news sites ), because I have a problem with procrastination and I find these websites affect my productivity very much. I used to block them by adding them to HOSTS file. However, gradually every time I want to take a break, I open the hosts file and comment my block again. Is there any way I can block the websites and cannot (at least a little bit hard, e.g. I have to reboot my pc) unblock them. I have no access to the router or any firewall, besides the ones on my computer. I just want to FORCE myself to work without any chance to procrastinate.

    Read the article

  • How can I make vim show the current class and method I'm editing

    - by dcrosta
    Does anyone know if it's possible (or know of an existing vim script or plugin) that can create a "status bar" that shows the name of the current class and method (or function) I'm editing? I'm imagining that it would plug into the syntax parser for the filetype of the current buffer, and display a breadcrumb trail to show you what you're currently editing. I don't know vimscript well enough to suggest any more than that, but if there aren't any good solutions already, I may begin to hack on one, so suggestions as to where to start are welcome, too!

    Read the article

  • Mercurial repositories hosting with different user access levels

    - by kender
    I want to set a few Mercurial 'central' repositories on one machine. There are few things I need to have working though: Each repository should have its own ACL, with different users allowed to push/pull It shouldn't be ssh-based (it shouldn't require users to have shell accounts on that machine) So, I guess that leaves me with some https with basic authentication, right? Are there any working solutions that provide this kind of functions?

    Read the article

  • Making many network shares appear as one

    - by jimbojw
    Givens: disk is cheap, and there's plenty lying around on various computers around the corporate intranet redundant contiguous large storage volumes are expensive Problem: It would be fantastic to have a single entry point (drive letter, network path) that presents all this space as one contiguous filesystem, effectively abstracting the disk and network architecture from the paths presented to users. Does anyone know how to implement such a solution? I'm open to Windows and non-windows solutions, free and proprietary.

    Read the article

  • There are currently no logon servers available

    - by linganna
    we are using free-ipaserver(192.168.0.200) on fedora, clients are windows xp. we are successfully added two xp clients(m01(192.168.0.60, m02(192.168.0.61) on test environment. and also our server name is ipaserver & domain name is xyz.com , samba has been configured working fine. problem is whenever we access from one xp machine another xp machine we are getting this error, There are currently no logon servers available to service the logon request, please give the solutions.

    Read the article

  • Secure Standalone Server Plus Firewall Unit [closed]

    - by orbitron
    We need to send a 2U server, 1U UPS and 1U firewall to a third-party. The thing is, it needs to be a secured case (locked unit) that has proper airflow and we can have power and networking cables coming out of the back. We've googled far and wide and have only been able to find 'hard case' units that offer some level of security but they are extremely bulky and require freight delivery. Thank you for any insight or solutions.

    Read the article

< Previous Page | 201 202 203 204 205 206 207 208 209 210 211 212  | Next Page >