Search Results

Search found 61944 results on 2478 pages for 'text database'.

Page 207/2478 | < Previous Page | 203 204 205 206 207 208 209 210 211 212 213 214  | Next Page >

  • Recovering database files from a corrupted VHD

    - by Apocalypse9
    We have a SQL server hosted on a virtual machine. Our hosting company updated/restarted the server and for some reason the virtual machines became unbootable. We've spoken to Microsoft and used a few higher level tools to attempt to recover the virtual machines but were unsuccessful. In browsing the file system the database folder doesn't even appear. I'm wondering if there are any lower level tools that might be able to find and copy the database files. As far as I know the physical hard drive is ok, so I'm hoping there may be some way to recover the files themselves even if the rest of the virtual machine file-system is a loss. Obviously we're in a bit of a bind, and any help/ suggestions are very much appreciated.

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • WMI Notfication and database mirroring

    - by user22215
    Hi all I'm having a problem configuring a WMI alert that I would like to use with database mirroring. I'm running on Windows 2008 Enterprise X64 with Server 2008 Enterprise X64 also SQL Server has SP1 installed. Basically I click on alert select WMI after that I typed the below SQL statement SELECT * FROM DATABASE_MIRRORING_STATE_CHANGE WHERE DatabaseName = 'testmove' AND State = 8 I have also made sure the service broker is enabled for the msdb and all mirrored databases however I still can't get this to work basically the alert never fires. I'm testing with just the alert functionality I have not even added in the agent job yet. I tested this by right clicking on my mirrored database and forcing it to fail over. Any help with this problem would be much appreciated

    Read the article

  • Some strange things in the db table of mysql database

    - by 0al0
    I noticed some weird things in the db table of mysql database in a client's server, after having the Mysql service stopping for no reason what are the test, and test_% entries? Why are there two entries for the database AQUA? Why is there a entry with a blank name? Should I worry about any of those? What should I do for each specific case? Is it safe to just delete the ones that should not be there, after backing up?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Clean out a large MediaWiki text table

    - by Bart van Heukelom
    I just discovered that an old MediaWiki of mine was infested with spam, and the database table named "text" (which contains the page content) is 3GB large. I've deleted all the spam pages manually, but: The table is still the same size. I wonder how it got to 3GB anyway. There wasn't that much spam (about a hundred medium-sized pages) How can I get rid of this mess? If you want to inspect the wiki, it's over here. The database is MySQL 5.0.75.

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • unlock database files when SQL server is idle

    - by Andy
    In my development/test environment on my laptop, I can't back up the SQL server database files because the file handles are kept permanently open by SQL server (VSS doesn't work because the drive is truecrypted) I was hoping there may be some setting in SQL server that can make it unlock the data files after a certain period of inactivity and automatically open them again on demand, but I can't find anything. I don't really want to be dumping the database out every night because it's only a development environment. apart from stopping sql server before I do the backup is there any other solution?

    Read the article

  • How to connect to MySQL server in LAN

    - by waelbk
    Ok, Here is the technical description. My laptop's config: Ip Adress:192.168.2.5 Mysqlserver 5.0 on port : 3306 Operating system: Ubuntu the database is in this machine My friend's laptop config: Ip Adress:192.168.2.4 Mysqlserver 5.0 on port : 3306 Operating system: Windows XP Both are on a wireless LAN connected through a belkin router (192.168.2.1) I put this but its not working: url = "jdbc:mysql://192.168.2.5:3306/Database" so how configure to connect to this database?

    Read the article

  • SQL Server database constantly restarting

    - by Michael Itzoe
    We have SQL Server 2008 Express installed on a Windows 2003 server. Looking at the event log, one of the databases appears to be restarting anywhere from every couple seconds to every 15 to 30 minutes. This server hosts about half a dozen databases; the problem is with only one. This database is also the onle one comprised of multiple schemas (not just dbo). There are thousands of events going back several months. There doesn't seem to be any affect on the website using the database, nor does any data appear to be corrupted or compromised. I'm not a DBA, so I don't even know where to look for causes to this. Any suggestions?

    Read the article

  • Code-First Database Creation During TFS 2010 CI Build

    - by jedimindtrickster
    I would like to automate code-first database generation during the automated CI build of a web project in Team Foundation Server 2010. When run locally the tests create a code-first database specified by the connection string in the app.config of the tests project. How do I configure the TFS Build Configuration to mimic this behaviour on the TFS build server? Edit The problem, it turns out, was that the TFS build server was successfully running the test which was using the default connection string in the app.config which pointed to the local SQL Server, not where I expected it. The solution was to use SlowCheetah on the TFS server as a means to transform the App.config file using the QA transform as per this blog article.

    Read the article

  • How to put text in same row but different column if a certain text is present in the same row?

    - by melai
    How can I put text in the same row but different column if a certain text is present in the same row? Issue Area Correction Done Process changed bin Process skip lap converted to global Security done global migration Process changed bin How can I code this in a macro? For example: If the correction done is in the cell, the Issue should be Process automatically. If the word global is present the Issue should be Security. I have 500 rows and I want to have the code until row 500.

    Read the article

  • I Cannot connect to remote MySQL database using SSH tunnel

    - by Scott
    Brand new server, brand new MySQL 5.5 install on Ubuntu 12.04. I can log in to the database as root from the command line. I can log on via Navicat MySQL or Sequel Pro as root on port 3306 from my Mac. I cannot log in using an SSH tunnel to the server and then to the database as root. I have tried both localhost and 127.0.0.1 as server for the local connection part. My password is fine. root is currently defined at %, 127.0.0.1, and localhost. I have set up this same type of connection at least 30 times before and never had a problem. The SSH connection gets made with no problem, and then it just hangs trying to connect to the DB and finally times out. The only thing I changed in my.cnf was to comment out the bind-address = 127.0.0.1 line. Any help? Any Ideas?

    Read the article

  • Why does Chrome show overlapping text?

    - by dog44wgm
    In Chrome, news articles at: http://www.theprovince.com with a leading photo and caption show the caption text overlapped with the body text. I have an image but as a new user here I'm not allowed to upload it. It happens at that site almost always, here's an example from today: http://www.theprovince.com/sports/Canucks+Blackhawks+collision+Titanic+proportions/5721421/story.html It rarely happens elsewhere. The same link works fine in Internet Explorer so I'm guessing it's a Chrome issue. It's been like this for many months, I read the site almost everyday. I click on "Print this Article" to get a proper look at it, but it's annoying, hope someone has the answer. Thanks in advance.

    Read the article

  • Cleaning cruft from the stored configs database

    - by Zoredache
    I have setup stored configuration primarily as a method to manage my ssh known_hosts. Unfortunately as I retire hosts the old configs still exist in my database. The answer seems to be run the command puppet node clean <hostname>. The problem is that while this does command does run, and does clean up some data, it doesn't seem to clean up everything. For example I can still find values in the puppet_tags table that only applied to a hosts that no longer exists. What should I be doing to keep my stored configuration database clean of all extra junk that seems to be building up? P.S. Can anyone point me any documentation for the stored configuration schema?  If I could find good documentation, or at least an entity-relationship-diagram, I would be tempted to just do some manual clean-up.

    Read the article

  • Search desktop files using a list of keywords stored in a text file

    - by Tod1d
    I have a list of 1285 keywords (database object names) that I have compiled into a TXT file; one keyword per line. I would like to search a directory of files (most have a .aspx or .cs extension) using this list of keywords. My main goal is find out which of the 1285 database objects are being referenced in these files. Can anyone recommend a tool that could accomplish this? Otherwise, I will just create my own. Thanks.

    Read the article

  • how to change database timezone on vps

    - by michael
    I am running my domain on a vps and I have virtualmin and webmin access. In my php files, I need to record the current time by using mysql NOW() when a row is inserted. I changed the timezone from the php configuration on webmin, but the database function NOW() is still using the default timezone. How can I change the database timezone? PS: I run mysql command to change timezone on webmin, but it gave me the error: Failed to execute SQL : SQL SET time_zone = 'America/New_York'; failed : Unknown or incorrect time zone: 'America/New_York'

    Read the article

  • Format text to 5 chars from a number

    - by Wheelersg
    In Access, I used a query to sum some numbers and appended the answer to another table(table2). Now I need to export the number as a text with 5 positions but can't seem to get it to hard code all 5 positions. I have it formatted as text, field length 5, custom foramt "00000" (also tried @@@@@). Example: 3 + 3 + 1 = 7. THen append the 7 to table2. It always shows as 7. I need it to shows as 00007.

    Read the article

  • Migrating Split Access Database from one domain to another (not working, details in Q)

    - by Expo_Rob
    Some background: I'm a programmer, not a network administrator, who has been asked to migrate some accounting software (Integrated Office Accounting version 3.2) from an existing domain (OLD_NETWORK) to a new domain (NEW_NETWORK). No-body at the office knows how it works under the hood. It is a split Access 2000 database with the back-end shared and on a file server (which is also the DC) using mapped drives. The DC is NT Server 4 SP 6. The new server is server 2003. The two networks are running independently (ie: two computers on each desk). I have been able to get new computers set up on NEW_NETWORK and working with the IOA software just perfectly but for one problem: The company here uses other entirely separate databases which access the tables IOA maintains (specifically the 'customers' table) via links. To switch between these systems, you press F11 then File-Open the appropriate database and away you go (this is necessary to maintain the permissions that the IOA system uses to protect the customers table). The entire database is Access 2000, the links go to other Access databases, SQL-Server is not involved in any way, nor is a migration to SQL server likely. If I can't migrate anything over, everything will stay as it is, and the NEW_NETWORK computers will not be used. The problem: When I try and update these seperate databases (I shall call one "BANK_ACCOUNT", but the name does not matter), it says "this recordset cannot be updated". It also will sometimes not pull information out of the 'customers' table (ie: date_entered) when looking at a report of everyone who opened a bank account on a certain day (ie: today). I have tried: Giving 'everyone' full control via. shared directory permissions Giving 'everyone' full control on a file system level Checking the permissions within Access (everyone has full read/write on all tables) Copying the entire server contents from one file server to another (ie: xcopy everything) Copying the entire local client files from one computer to another, putting them in the exact same position in the file system, with the same permissons (or full control to 'everyone'). Running as an Administrator Taking one of the NEW_NETWORK computers, having it join OLD_NETWORK and run the software (direct copy from a working system with identical drive mappings), this did not work Weeping openly My Question: Is there anything else I can try? (sorry for this being so long)

    Read the article

  • MySQL FULLTEXT aggravation

    - by southof40
    Hi - I'm having problems with case-sensitivity in MySQL FULLTEXT searches. I've just followed the FULLTEXT example in the MySQL doco at http://dev.mysql.com/doc/refman/5.1/en/fulltext-boolean.html . I'll post it here for ease of reference ... CREATE TABLE articles ( id INT UNSIGNED AUTO_INCREMENT NOT NULL PRIMARY KEY, title VARCHAR(200), body TEXT, FULLTEXT (title,body) ); INSERT INTO articles (title,body) VALUES ('MySQL Tutorial','DBMS stands for DataBase ...'), ('How To Use MySQL Well','After you went through a ...'), ('Optimizing MySQL','In this tutorial we will show ...'), ('1001 MySQL Tricks','1. Never run mysqld as root. 2. ...'), ('MySQL vs. YourSQL','In the following database comparison ...'), ('MySQL Security','When configured properly, MySQL ...'); SELECT * FROM articles WHERE MATCH (title,body) AGAINST ('database' IN NATURAL LANGUAGE MODE); ... my problem is that the example shows that SELECT returning the first and fifth rows ('..DataBase..' and '..database..') but I only get one row ('database') ! The example doesn't demonstrate what collation the table in the example had but I have ended up with latin1_general_cs on the title and body columns of my example table. My version of MySQL is 5.1.39-log and the connection collation is utf8_unicode_ci . I'd be really grateful is someone could suggest why my experience differs from the example in the manual ! Be grateful for any advice.

    Read the article

  • SQL SERVER – Concat Strings in SQL Server using T-SQL – SQL in Sixty Seconds #035 – Video

    - by pinaldave
    Concatenating  string is one of the most common tasks in SQL Server and every developer has to come across it. We have to concat the string when we have to see the display full name of the person by first name and last name. In this video we will see various methods to concatenate the strings. SQL Server 2012 has introduced new function CONCAT which concatenates the strings much efficiently. When we concat values with ‘+’ in SQL Server we have to make sure that values are in string format. However, when we attempt to concat integer we have to convert the integers to a string or else it will throw an error. However, with the newly introduce the function of CONCAT in SQL Server 2012 we do not have to worry about this kind of issue. It concatenates strings and integers without casting or converting them. You can specify various values as a parameter to CONCAT functions and it concatenates them together. Let us see how to concat the values in Sixty Seconds: Here is the script which is used in the video. -- Method 1: Concatenating two strings SELECT 'FirstName' + ' ' + 'LastName' AS FullName -- Method 2: Concatenating two Numbers SELECT CAST(1 AS VARCHAR(10)) + ' ' + CAST(2 AS VARCHAR(10)) -- Method 3: Concatenating values of table columns SELECT FirstName + ' ' + LastName AS FullName FROM AdventureWorks2012.Person.Person -- Method 4: SQL Server 2012 CONCAT function SELECT CONCAT('FirstName' , ' ' , 'LastName') AS FullName -- Method 5: SQL Server 2012 CONCAT function SELECT CONCAT('FirstName' , ' ' , 1) AS FullName Related Tips in SQL in Sixty Seconds: SQL SERVER – Concat Function in SQL Server – SQL Concatenation String Function – CONCAT() – A Quick Introduction 2012 Functions – FORMAT() and CONCAT() – An Interesting Usage A Quick Trick about SQL Server 2012 CONCAT Function – PRINT A Quick Trick about SQL Server 2012 CONCAT function What would you like to see in the next SQL in Sixty Seconds video? Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Database, Pinal Dave, PostADay, SQL, SQL Authority, SQL in Sixty Seconds, SQL Query, SQL Scripts, SQL Server, SQL Server Management Studio, SQL Tips and Tricks, T SQL, Technology, Video Tagged: Excel

    Read the article

  • ASP.NET Podcast Show #148 - ASP.NET WebForms to build a Mobile Web Application

    - by Wallym
    Check the podcast site for the original url. This is the video and source code for an ASP.NET WebForms app that I wrote that is optimized for the iPhone and mobile environments.  Subscribe to everything. Subscribe to WMV. Subscribe to M4V for iPhone/iPad. Subscribe to MP3. Download WMV. Download M4V for iPhone/iPad. Download MP3. Link to iWebKit. Source Code: <%@ Page Title="MapSplore" Language="C#" MasterPageFile="iPhoneMaster.master" AutoEventWireup="true" CodeFile="Default.aspx.cs" Inherits="AT_iPhone_Default" %> <asp:Content ID="Content1" ContentPlaceHolderID="head" Runat="Server"></asp:Content><asp:Content ID="Content2" ContentPlaceHolderID="Content" Runat="Server" ClientIDMode="Static">    <asp:ScriptManager ID="sm" runat="server"         EnablePartialRendering="true" EnableHistory="false" EnableCdn="true" />    <script type="text/javascript" src="http://maps.google.com/maps/api/js?sensor=true"></script>    <script  language="javascript"  type="text/javascript">    <!--    Sys.WebForms.PageRequestManager.getInstance().add_endRequest(endRequestHandle);    function endRequestHandle(sender, Args) {        setupMapDiv();        setupPlaceIveBeen();    }    function setupPlaceIveBeen() {        var mapPlaceIveBeen = document.getElementById('divPlaceIveBeen');        if (mapPlaceIveBeen != null) {            var PlaceLat = document.getElementById('<%=hdPlaceIveBeenLatitude.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceIveBeenLongitude.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=lblPlaceIveBeenName.ClientID %>').innerHTML;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapPlaceIveBeen, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }    }    function setupMapDiv() {        var mapdiv = document.getElementById('divImHere');        if (mapdiv != null) {            var PlaceLat = document.getElementById('<%=hdPlaceLat.ClientID %>').value;            var PlaceLon = document.getElementById('<%=hdPlaceLon.ClientID %>').value;            var PlaceTitle = document.getElementById('<%=hdPlaceTitle.ClientID %>').value;            var latlng = new google.maps.LatLng(PlaceLat, PlaceLon);            var myOptions = {                zoom: 14,                center: latlng,                mapTypeId: google.maps.MapTypeId.ROADMAP            };            var map = new google.maps.Map(mapdiv, myOptions);            var marker = new google.maps.Marker({                position: new google.maps.LatLng(PlaceLat, PlaceLon),                map: map,                title: PlaceTitle,                clickable: false            });        }     }    -->    </script>    <asp:HiddenField ID="Latitude" runat="server" />    <asp:HiddenField ID="Longitude" runat="server" />    <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1/jquery.min.js%22%3E%3C/script>    <script language="javascript" type="text/javascript">        $(document).ready(function () {            GetLocation();            setupMapDiv();            setupPlaceIveBeen();        });        function GetLocation() {            if (navigator.geolocation != null) {                navigator.geolocation.getCurrentPosition(getData);            }            else {                var mess = document.getElementById('<%=Message.ClientID %>');                mess.innerHTML = "Sorry, your browser does not support geolocation. " +                    "Try the latest version of Safari on the iPhone, Android browser, or the latest version of FireFox.";            }        }        function UpdateLocation_Click() {            GetLocation();        }        function getData(position) {            var latitude = position.coords.latitude;            var longitude = position.coords.longitude;            var hdLat = document.getElementById('<%=Latitude.ClientID %>');            var hdLon = document.getElementById('<%=Longitude.ClientID %>');            hdLat.value = latitude;            hdLon.value = longitude;        }    </script>    <asp:Label ID="Message" runat="server" />    <asp:UpdatePanel ID="upl" runat="server">        <ContentTemplate>    <asp:Panel ID="pnlStart" runat="server" Visible="true">    <div id="topbar">        <div id="title">MapSplore</div>    </div>    <div id="content">        <ul class="pageitem">            <li class="menu">                <asp:LinkButton ID="lbLocalDeals" runat="server" onclick="lbLocalDeals_Click">                <asp:Image ID="imLocalDeals" runat="server" ImageUrl="~/Images/ArtFavor_Money_Bag_Icon.png" Height="30" />                <span class="name">Local Deals.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbLocalPlaces" runat="server" onclick="lbLocalPlaces_Click">                <asp:Image ID="imLocalPlaces" runat="server" ImageUrl="~/Images/Andy_Houses_on_the_horizon_-_Starburst_remix.png" Height="30" />                <span class="name">Local Places.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbWhereIveBeen" runat="server" onclick="lbWhereIveBeen_Click">                <asp:Image ID="imImHere" runat="server" ImageUrl="~/Images/ryanlerch_flagpole.png" Height="30" />                <span class="name">I've been here.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbMyStats" runat="server">                <asp:Image ID="imMyStats" runat="server" ImageUrl="~/Images/Anonymous_Spreadsheet.png" Height="30" />                <span class="name">My Stats.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="menu">                <asp:LinkButton ID="lbAddAPlace" runat="server" onclick="lbAddAPlace_Click">                <asp:Image ID="imAddAPlace" runat="server" ImageUrl="~/Images/jean_victor_balin_add.png" Height="30" />                <span class="name">Add a Place.</span>                <span class="arrow"></span>                </asp:LinkButton>                </li>            <li class="button">                <input type="button" value="Update Your Current Location" onclick="UpdateLocation_Click()">                </li>        </ul>    </div>    </asp:Panel>    <div>    <asp:Panel ID="pnlCoupons" runat="server" Visible="false">        <div id="topbar">        <div id="title">MapSplore</div>        <div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromDeals" OnClick="ReturnFromDeals_Click" /></div></div>    <div class="content">    <asp:ListView ID="lvCoupons" runat="server">        <LayoutTemplate>            <ul class="pageitem" runat="server">                <asp:PlaceHolder ID="itemPlaceholder" runat="server" />            </ul>        </LayoutTemplate>        <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Place.Name") %>' OnClick="lbBusiness_Click">                    <span class="comment">                    <asp:Label ID="lblAddress" runat="server" Text='<%#Eval("Place.Address1") %>' />                    <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Place.Distance"))) + " meters" %>' CssClass="smallText" />                    <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                    <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                    </span>                    <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView><asp:GridView ID="gvCoupons" runat="server" AutoGenerateColumns="false">            <HeaderStyle BackColor="Silver" />            <AlternatingRowStyle BackColor="Wheat" />            <Columns>                <asp:TemplateField AccessibleHeaderText="Business" HeaderText="Business">                    <ItemTemplate>                        <asp:Image ID="imPlaceType" runat="server" Text='<%#Eval("Type") %>' ImageUrl='<%#Eval("Image") %>' />                        <asp:LinkButton ID="lbBusiness" runat="server" Text='<%#Eval("Name") %>' OnClick="lbBusiness_Click" />                        <asp:LinkButton ID="lblAddress" runat="server" Text='<%#Eval("Address1") %>' CssClass="smallText" />                        <asp:Label ID="lblDis" runat="server" Text='<%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>' CssClass="smallText" />                        <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                        <asp:HiddenField ID="hdGeoPromotionId" runat="server" Value='<%#Eval("GeoPromotionId") %>' />                        <asp:Label ID="lblInfo" runat="server" Visible="false" />                    </ItemTemplate>                </asp:TemplateField>            </Columns>        </asp:GridView>    </div>    </asp:Panel>    <asp:Panel ID="pnlPlaces" runat="server" Visible="false">    <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Return"                 ID="ReturnFromPlaces" OnClick="ReturnFromPlaces_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvPlaces" runat="server">            <LayoutTemplate>                <ul id="ulPlaces" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                    <li class="menu">                        <asp:LinkButton ID="lbNotListed" runat="server" CssClass="name"                            OnClick="lbNotListed_Click">                            Place not listed                            <span class="arrow"></span>                            </asp:LinkButton>                    </li>                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu">                <asp:LinkButton ID="lbImHere" runat="server" CssClass="name"                     OnClick="lbImHere_Click">                <%#DisplayName(Eval("Name")) %>&nbsp;                <%# Convert.ToString(Convert.ToInt32(Eval("Distance"))) + " meters" %>                <asp:HiddenField ID="hdPlaceId" runat="server" Value='<%#Eval("PlaceId") %>' />                <span class="arrow"></span>                </asp:LinkButton></li></ItemTemplate></asp:ListView>    </div>    </asp:Panel>    <asp:Panel ID="pnlImHereNow" runat="server" Visible="false">        <div id="topbar">        <div id="title">            MapSplore</div><div id="leftbutton">            <asp:LinkButton runat="server" Text="Places"                 ID="lbImHereNowReturn" OnClick="lbImHereNowReturn_Click" /></div></div>            <div id="rightbutton">            <asp:LinkButton runat="server" Text="Beginning"                ID="lbBackToBeginning" OnClick="lbBackToBeginning_Click" />            </div>        <div id="content">        <ul class="pageitem">        <asp:HiddenField ID="hdPlaceId" runat="server" />        <asp:HiddenField ID="hdPlaceLat" runat="server" />        <asp:HiddenField ID="hdPlaceLon" runat="server" />        <asp:HiddenField ID="hdPlaceTitle" runat="server" />        <asp:Button ID="btnImHereNow" runat="server"             Text="I'm here" OnClick="btnImHereNow_Click" />             <asp:Label ID="lblPlaceTitle" runat="server" /><br />        <asp:TextBox ID="txtWhatsHappening" runat="server" TextMode="MultiLine" Rows="2" style="width:300px" /><br />        <div id="divImHere" style="width:300px; height:300px"></div>        </div>        </ul>    </asp:Panel>    <asp:Panel runat="server" ID="pnlIveBeenHere" Visible="false">        <div id="topbar">        <div id="title">            Where I've been</div><div id="leftbutton">            <asp:LinkButton ID="lbIveBeenHereBack" runat="server" Text="Back" OnClick="lbIveBeenHereBack_Click" /></div></div>        <div id="content">        <asp:ListView ID="lvWhereIveBeen" runat="server">            <LayoutTemplate>                <ul id="ulWhereIveBeen" class="pageitem" runat="server">                    <asp:PlaceHolder ID="itemPlaceholder" runat="server" />                </ul>            </LayoutTemplate>            <ItemTemplate>            <li class="menu" runat="server">                <asp:LinkButton ID="lbPlaceIveBeen" runat="server" OnClick="lbPlaceIveBeen_Click" CssClass="name">                    <asp:Label ID="lblPlace" runat="server" Text='<%#Eval("PlaceName") %>' /> at                    <asp:Label ID="lblTime" runat="server" Text='<%#Eval("ATTime") %>' CssClass="content" />                    <asp:HiddenField ID="hdATID" runat="server" Value='<%#Eval("ATID") %>' />                    <span class="arrow"></span>                </asp:LinkButton>            </li>            </ItemTemplate>        </asp:ListView>        </div>        </asp:Panel>    <asp:Panel runat="server" ID="pnlPlaceIveBeen" Visible="false">        <div id="topbar">        <div id="title">            I've been here        </div>        <div id="leftbutton">            <asp:LinkButton ID="lbPlaceIveBeenBack" runat="server" Text="Back" OnClick="lbPlaceIveBeenBack_Click" />        </div>        <div id="rightbutton">            <asp:LinkButton ID="lbPlaceIveBeenBeginning" runat="server" Text="Beginning" OnClick="lbPlaceIveBeenBeginning_Click" />        </div>        </div>        <div id="content">            <ul class="pageitem">            <li>            <asp:HiddenField ID="hdPlaceIveBeenPlaceId" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLatitude" runat="server" />            <asp:HiddenField ID="hdPlaceIveBeenLongitude" runat="server" />            <asp:Label ID="lblPlaceIveBeenName" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenAddress" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCity" runat="server" />,             <asp:Label ID="lblPlaceIveBeenState" runat="server" />            <asp:Label ID="lblPlaceIveBeenZipCode" runat="server" /><br />            <asp:Label ID="lblPlaceIveBeenCountry" runat="server" /><br />            <div id="divPlaceIveBeen" style="width:300px; height:300px"></div>            </li>            </ul>        </div>                </asp:Panel>         <asp:Panel ID="pnlAddPlace" runat="server" Visible="false">                <div id="topbar"><div id="title">MapSplore</div><div id="leftbutton"><asp:LinkButton ID="lbAddPlaceReturn" runat="server" Text="Back" OnClick="lbAddPlaceReturn_Click" /></div><div id="rightnav"></div></div><div id="content">    <ul class="pageitem">        <li id="liPlaceAddMessage" runat="server" visible="false">        <asp:Label ID="PlaceAddMessage" runat="server" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtPlaceName" runat="server" placeholder="Name of Establishment" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtAddress1" runat="server" placeholder="Address 1" />        </li>        <li class="bigfield">        <asp:TextBox ID="txtCity" runat="server" placeholder="City" />        </li>        <li class="select">        <asp:DropDownList ID="ddlProvince" runat="server" placeholder="Select State" />          <span class="arrow"></span>              </li>        <li class="bigfield">        <asp:TextBox ID="txtZipCode" runat="server" placeholder="Zip Code" />        </li>        <li class="select">        <asp:DropDownList ID="ddlCountry" runat="server"             onselectedindexchanged="ddlCountry_SelectedIndexChanged" />        <span class="arrow"></span>        </li>        <li class="bigfield">        <asp:TextBox ID="txtPhoneNumber" runat="server" placeholder="Phone Number" />        </li>        <li class="checkbox">            <span class="name">You Here Now:</span> <asp:CheckBox ID="cbYouHereNow" runat="server" Checked="true" />        </li>        <li class="button">        <asp:Button ID="btnAdd" runat="server" Text="Add Place"             onclick="btnAdd_Click" />        </li>    </ul></div>        </asp:Panel>        <asp:Panel ID="pnlImHere" runat="server" Visible="false">            <asp:TextBox ID="txtImHere" runat="server"                 TextMode="MultiLine" Rows="3" Columns="40" /><br />            <asp:DropDownList ID="ddlPlace" runat="server" /><br />            <asp:Button ID="btnHere" runat="server" Text="Tell Everyone I'm Here"                 onclick="btnHere_Click" /><br />        </asp:Panel>     </div>    </ContentTemplate>    </asp:UpdatePanel> </asp:Content> Code Behind .cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls;using LocationDataModel; public partial class AT_iPhone_Default : ViewStatePage{    private iPhoneDevice ipd;     protected void Page_Load(object sender, EventArgs e)    {        LocationDataEntities lde = new LocationDataEntities();        if (!Page.IsPostBack)        {            var Countries = from c in lde.Countries select c;            foreach (Country co in Countries)            {                ddlCountry.Items.Add(new ListItem(co.Name, co.CountryId.ToString()));            }            ddlCountry_SelectedIndexChanged(ddlCountry, null);            if (AppleIPhone.IsIPad())                ipd = iPhoneDevice.iPad;            if (AppleIPhone.IsIPhone())                ipd = iPhoneDevice.iPhone;            if (AppleIPhone.IsIPodTouch())                ipd = iPhoneDevice.iPodTouch;        }    }    protected void btnPlaces_Click(object sender, EventArgs e)    {    }    protected void btnAdd_Click(object sender, EventArgs e)    {        bool blImHere = cbYouHereNow.Checked;        string Place = txtPlaceName.Text,            Address1 = txtAddress1.Text,            City = txtCity.Text,            ZipCode = txtZipCode.Text,            PhoneNumber = txtPhoneNumber.Text,            ProvinceId = ddlProvince.SelectedItem.Value,            CountryId = ddlCountry.SelectedItem.Value;        int iProvinceId, iCountryId;        double dLatitude, dLongitude;        DataAccess da = new DataAccess();        if ((!String.IsNullOrEmpty(ProvinceId)) &&            (!String.IsNullOrEmpty(CountryId)))        {            iProvinceId = Convert.ToInt32(ProvinceId);            iCountryId = Convert.ToInt32(CountryId);            if (blImHere)            {                dLatitude = Convert.ToDouble(Latitude.Value);                dLongitude = Convert.ToDouble(Longitude.Value);                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber,                    dLatitude, dLongitude);            }            else            {                da.StorePlace(Place, Address1, String.Empty, City,                    iProvinceId, ZipCode, iCountryId, PhoneNumber);            }            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Awesome, your place has been added. Add Another!";            txtPlaceName.Text = String.Empty;            txtAddress1.Text = String.Empty;            txtCity.Text = String.Empty;            ddlProvince.SelectedIndex = -1;            txtZipCode.Text = String.Empty;            txtPhoneNumber.Text = String.Empty;        }        else        {            liPlaceAddMessage.Visible = true;            PlaceAddMessage.Text = "Please select a State and a Country.";        }    }    protected void ddlCountry_SelectedIndexChanged(object sender, EventArgs e)    {        string CountryId = ddlCountry.SelectedItem.Value;        if (!String.IsNullOrEmpty(CountryId))        {            int iCountryId = Convert.ToInt32(CountryId);            LocationDataModel.LocationDataEntities lde = new LocationDataModel.LocationDataEntities();            var prov = from p in lde.Provinces where p.CountryId == iCountryId                        orderby p.ProvinceName select p;                        ddlProvince.Items.Add(String.Empty);            foreach (Province pr in prov)            {                ddlProvince.Items.Add(new ListItem(pr.ProvinceName, pr.ProvinceId.ToString()));            }        }        else        {            ddlProvince.Items.Clear();        }    }    protected void btnImHere_Click(object sender, EventArgs e)    {        int i = 0;        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value),            Lon = Convert.ToDouble(Longitude.Value);        List<Place> lp = da.NearByLocations(Lat, Lon);        foreach (Place p in lp)        {            ListItem li = new ListItem(p.Name, p.PlaceId.ToString());            if (i == 0)            {                li.Selected = true;            }            ddlPlace.Items.Add(li);            i++;        }        pnlAddPlace.Visible = false;        pnlImHere.Visible = true;    }    protected void lbImHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        ListViewItem lvi = (ListViewItem)(((LinkButton)sender).Parent);        HiddenField hd = (HiddenField)lvi.FindControl("hdPlaceId");        long PlaceId = Convert.ToInt64(hd.Value);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        Place pl = da.GetPlace(PlaceId);        pnlImHereNow.Visible = true;        pnlPlaces.Visible = false;        hdPlaceId.Value = PlaceId.ToString();        hdPlaceLat.Value = pl.Latitude.ToString();        hdPlaceLon.Value = pl.Longitude.ToString();        hdPlaceTitle.Value = pl.Name;        lblPlaceTitle.Text = pl.Name;    }    protected void btnHere_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        string WhatsH = txtImHere.Text;        long PlaceId = Convert.ToInt64(ddlPlace.SelectedValue);        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsH,            dLatitude, dLongitude);    }    protected void btnLocalCoupons_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();     }    protected void lbBusiness_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        GridViewRow gvr = (GridViewRow)(((LinkButton)sender).Parent.Parent);        HiddenField hd = (HiddenField)gvr.FindControl("hdPlaceId");        string sPlaceId = hd.Value;        Int64 PlaceId;        if (!String.IsNullOrEmpty(sPlaceId))        {            PlaceId = Convert.ToInt64(sPlaceId);        }    }    protected void lbLocalDeals_Click(object sender, EventArgs e)    {        double dLatitude = Convert.ToDouble(Latitude.Value);        double dLongitude = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        pnlCoupons.Visible = true;        pnlStart.Visible = false;        List<GeoPromotion> lgp = da.NearByDeals(dLatitude, dLongitude);        lvCoupons.DataSource = lgp;        lvCoupons.DataBind();    }    protected void lbLocalPlaces_Click(object sender, EventArgs e)    {        DataAccess da = new DataAccess();        double Lat = Convert.ToDouble(Latitude.Value);        double Lon = Convert.ToDouble(Longitude.Value);        List<LocationDataModel.Place> places = da.NearByLocations(Lat, Lon);        lvPlaces.DataSource = places;        lvPlaces.SelectedIndex = -1;        lvPlaces.DataBind();        pnlPlaces.Visible = true;        pnlStart.Visible = false;    }    protected void ReturnFromPlaces_Click(object sender, EventArgs e)    {        pnlPlaces.Visible = false;        pnlStart.Visible = true;    }    protected void ReturnFromDeals_Click(object sender, EventArgs e)    {        pnlCoupons.Visible = false;        pnlStart.Visible = true;    }    protected void btnImHereNow_Click(object sender, EventArgs e)    {        long PlaceId = Convert.ToInt32(hdPlaceId.Value);        string UserName = Membership.GetUser().UserName;        string WhatsHappening = txtWhatsHappening.Text;        double UserLat = Convert.ToDouble(Latitude.Value);        double UserLon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        da.StoreUserAT(UserName, PlaceId, WhatsHappening,             UserLat, UserLon);    }    protected void lbImHereNowReturn_Click(object sender, EventArgs e)    {        pnlImHereNow.Visible = false;        pnlPlaces.Visible = true;    }    protected void lbBackToBeginning_Click(object sender, EventArgs e)    {        pnlStart.Visible = true;        pnlImHereNow.Visible = false;    }    protected void lbWhereIveBeen_Click(object sender, EventArgs e)    {        string UserName = Membership.GetUser().UserName;        pnlStart.Visible = false;        pnlIveBeenHere.Visible = true;        DataAccess da = new DataAccess();        lvWhereIveBeen.DataSource = da.UserATs(UserName, 0, 15);        lvWhereIveBeen.DataBind();    }    protected void lbIveBeenHereBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = false;        pnlStart.Visible = true;    }     protected void lbPlaceIveBeen_Click(object sender, EventArgs e)    {        LinkButton lb = (LinkButton)sender;        ListViewItem lvi = (ListViewItem)lb.Parent.Parent;        HiddenField hdATID = (HiddenField)lvi.FindControl("hdATID");        Int64 ATID = Convert.ToInt64(hdATID.Value);        DataAccess da = new DataAccess();        pnlIveBeenHere.Visible = false;        pnlPlaceIveBeen.Visible = true;        var plac = da.GetPlaceViaATID(ATID);        hdPlaceIveBeenPlaceId.Value = plac.PlaceId.ToString();        hdPlaceIveBeenLatitude.Value = plac.Latitude.ToString();        hdPlaceIveBeenLongitude.Value = plac.Longitude.ToString();        lblPlaceIveBeenName.Text = plac.Name;        lblPlaceIveBeenAddress.Text = plac.Address1;        lblPlaceIveBeenCity.Text = plac.City;        lblPlaceIveBeenState.Text = plac.Province.ProvinceName;        lblPlaceIveBeenZipCode.Text = plac.ZipCode;        lblPlaceIveBeenCountry.Text = plac.Country.Name;    }     protected void lbNotListed_Click(object sender, EventArgs e)    {        SetupAddPoint();        pnlPlaces.Visible = false;    }     protected void lbAddAPlace_Click(object sender, EventArgs e)    {        SetupAddPoint();    }     private void SetupAddPoint()    {        double lat = Convert.ToDouble(Latitude.Value);        double lon = Convert.ToDouble(Longitude.Value);        DataAccess da = new DataAccess();        var zip = da.WhereAmIAt(lat, lon);        if (zip.Count > 0)        {            var z0 = zip[0];            txtCity.Text = z0.City;            txtZipCode.Text = z0.ZipCode;            ddlProvince.ClearSelection();            if (z0.ProvinceId.HasValue == true)            {                foreach (ListItem li in ddlProvince.Items)                {                    if (li.Value == z0.ProvinceId.Value.ToString())                    {                        li.Selected = true;                        break;                    }                }            }        }        pnlAddPlace.Visible = true;        pnlStart.Visible = false;    }    protected void lbAddPlaceReturn_Click(object sender, EventArgs e)    {        pnlAddPlace.Visible = false;        pnlStart.Visible = true;        liPlaceAddMessage.Visible = false;        PlaceAddMessage.Text = String.Empty;    }    protected void lbPlaceIveBeenBack_Click(object sender, EventArgs e)    {        pnlIveBeenHere.Visible = true;        pnlPlaceIveBeen.Visible = false;            }    protected void lbPlaceIveBeenBeginning_Click(object sender, EventArgs e)    {        pnlPlaceIveBeen.Visible = false;        pnlStart.Visible = true;    }    protected string DisplayName(object val)    {        string strVal = Convert.ToString(val);         if (AppleIPhone.IsIPad())        {            ipd = iPhoneDevice.iPad;        }        if (AppleIPhone.IsIPhone())        {            ipd = iPhoneDevice.iPhone;        }        if (AppleIPhone.IsIPodTouch())        {            ipd = iPhoneDevice.iPodTouch;        }        return (iPhoneHelper.DisplayContentOnMenu(strVal, ipd));    }} iPhoneHelper.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; public enum iPhoneDevice{    iPhone, iPodTouch, iPad}/// <summary>/// Summary description for iPhoneHelper/// </summary>/// public class iPhoneHelper{ public iPhoneHelper() {  //  // TODO: Add constructor logic here  // } // This code is stupid in retrospect. Use css to solve this problem      public static string DisplayContentOnMenu(string val, iPhoneDevice ipd)    {        string Return = val;        string Elipsis = "...";        int iPadMaxLength = 30;        int iPhoneMaxLength = 15;        if (ipd == iPhoneDevice.iPad)        {            if (Return.Length > iPadMaxLength)            {                Return = Return.Substring(0, iPadMaxLength - Elipsis.Length) + Elipsis;            }        }        else        {            if (Return.Length > iPhoneMaxLength)            {                Return = Return.Substring(0, iPhoneMaxLength - Elipsis.Length) + Elipsis;            }        }        return (Return);    }}  Source code for the ViewStatePage: using System;using System.Data;using System.Data.SqlClient;using System.Configuration;using System.Web;using System.Web.Security;using System.Web.UI;using System.Web.UI.WebControls;using System.Web.UI.WebControls.WebParts;using System.Web.UI.HtmlControls; /// <summary>/// Summary description for BasePage/// </summary>#region Base class for a page.public class ViewStatePage : System.Web.UI.Page{     PageStatePersisterToDatabase myPageStatePersister;        public ViewStatePage()        : base()    {        myPageStatePersister = new PageStatePersisterToDatabase(this);    }     protected override PageStatePersister PageStatePersister    {        get        {            return myPageStatePersister;        }    } }#endregion #region This class will override the page persistence to store page state in a database.public class PageStatePersisterToDatabase : PageStatePersister{    private string ViewStateKeyField = "__VIEWSTATE_KEY";    private string _exNoConnectionStringFound = "No Database Configuration information is in the web.config.";     public PageStatePersisterToDatabase(Page page)        : base(page)    {    }     public override void Load()    {         // Get the cache key from the web form data        System.Int64 key = Convert.ToInt64(Page.Request.Params[ViewStateKeyField]);         Pair state = this.LoadState(key);         // Abort if cache object is not of type Pair        if (state == null)            throw new ApplicationException("Missing valid " + ViewStateKeyField);         // Set view state and control state        ViewState = state.First;        ControlState = state.Second;    }     public override void Save()    {         // No processing needed if no states available        if (ViewState == null && ControlState != null)            return;         System.Int64 key;        IStateFormatter formatter = this.StateFormatter;        Pair statePair = new Pair(ViewState, ControlState);         // Serialize the statePair object to a string.        string serializedState = formatter.Serialize(statePair);         // Save the ViewState and get a unique identifier back.        key = SaveState(serializedState);         // Register hidden field to store cache key in        // Page.ClientScript does not work properly with Atlas.        //Page.ClientScript.RegisterHiddenField(ViewStateKeyField, key.ToString());        ScriptManager.RegisterHiddenField(this.Page, ViewStateKeyField, key.ToString());    }     private System.Int64 SaveState(string PageState)    {        System.Int64 i64Key = 0;        string strConn = String.Empty,            strProvider = String.Empty;         string strSql = "insert into tblPageState ( SerializedState ) values ( '" + SqlEscape(PageState) + "');select scope_identity();";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);            sqlCn.Open();            i64Key = Convert.ToInt64(sqlCm.ExecuteScalar());            if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return i64Key;    }     private Pair LoadState(System.Int64 iKey)    {        string strConn = String.Empty,            strProvider = String.Empty,            SerializedState = String.Empty,            strMinutesInPast = GetMinutesInPastToDelete();        Pair PageState;        string strSql = "select SerializedState from tblPageState where tblPageStateID=" + iKey.ToString() + ";" +            "delete from tblPageState where DateUpdated<DateAdd(mi, " + strMinutesInPast + ", getdate());";        SqlConnection sqlCn;        SqlCommand sqlCm;        try        {            GetDBConnectionString(ref strConn, ref strProvider);            sqlCn = new SqlConnection(strConn);            sqlCm = new SqlCommand(strSql, sqlCn);             sqlCn.Open();            SerializedState = Convert.ToString(sqlCm.ExecuteScalar());            IStateFormatter formatter = this.StateFormatter;             if ((null == SerializedState) ||                (String.Empty == SerializedState))            {                throw (new ApplicationException("No ViewState records were returned."));            }             // Deserilize returns the Pair object that is serialized in            // the Save method.            PageState = (Pair)formatter.Deserialize(SerializedState);             if (sqlCn.State != ConnectionState.Closed)            {                sqlCn.Close();            }            sqlCn.Dispose();            sqlCm.Dispose();        }        finally        {            sqlCn = null;            sqlCm = null;        }        return PageState;    }     private string SqlEscape(string Val)    {        string ReturnVal = String.Empty;        if (null != Val)        {            ReturnVal = Val.Replace("'", "''");        }        return (ReturnVal);    }    private void GetDBConnectionString(ref string ConnectionStringValue, ref string ProviderNameValue)    {        if (System.Configuration.ConfigurationManager.ConnectionStrings.Count > 0)        {            ConnectionStringValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ConnectionString;            ProviderNameValue = System.Configuration.ConfigurationManager.ConnectionStrings["ApplicationServices"].ProviderName;        }        else        {            throw new ConfigurationErrorsException(_exNoConnectionStringFound);        }    }    private string GetMinutesInPastToDelete()    {        string strReturn = "-60";        if (null != System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"])        {            strReturn = System.Configuration.ConfigurationManager.AppSettings["MinutesInPastToDeletePageState"].ToString();        }        return (strReturn);    }}#endregion AppleiPhone.cs file: using System;using System.Collections.Generic;using System.Linq;using System.Web; /// <summary>/// Summary description for AppleIPhone/// </summary>public class AppleIPhone{ public AppleIPhone() {  //  // TODO: Add constructor logic here  // }     static public bool IsIPhoneOS()    {        return (IsIPad() || IsIPhone() || IsIPodTouch());    }     static public bool IsIPhone()    {        return IsTest("iPhone");    }     static public bool IsIPodTouch()    {        return IsTest("iPod");    }     static public bool IsIPad()    {        return IsTest("iPad");    }     static private bool IsTest(string Agent)    {        bool bl = false;        string ua = HttpContext.Current.Request.UserAgent.ToLower();        try        {            bl = ua.Contains(Agent.ToLower());        }        catch { }        return (bl);        }} Master page .cs: using System;using System.Collections.Generic;using System.Linq;using System.Web;using System.Web.UI;using System.Web.UI.HtmlControls;using System.Web.UI.WebControls; public partial class MasterPages_iPhoneMaster : System.Web.UI.MasterPage{    protected void Page_Load(object sender, EventArgs e)    {            HtmlHead head = Page.Header;            HtmlMeta meta = new HtmlMeta();            if (AppleIPhone.IsIPad() == true)            {                meta.Content = "width=400,user-scalable=no";                head.Controls.Add(meta);             }            else            {                meta.Content = "width=device-width, user-scalable=no";                meta.Attributes.Add("name", "viewport");            }            meta.Attributes.Add("name", "viewport");            head.Controls.Add(meta);            HtmlLink cssLink = new HtmlLink();            HtmlGenericControl script = new HtmlGenericControl("script");            script.Attributes.Add("type", "text/javascript");            script.Attributes.Add("src", ResolveUrl("~/Scripts/iWebKit/javascript/functions.js"));            head.Controls.Add(script);            cssLink.Attributes.Add("rel", "stylesheet");            cssLink.Attributes.Add("href", ResolveUrl("~/Scripts/iWebKit/css/style.css") );            cssLink.Attributes.Add("type", "text/css");            head.Controls.Add(cssLink);            HtmlGenericControl jsLink = new HtmlGenericControl("script");            //jsLink.Attributes.Add("type", "text/javascript");            //jsLink.Attributes.Add("src", ResolveUrl("~/Scripts/jquery-1.4.1.min.js") );            //head.Controls.Add(jsLink);            HtmlLink appleIcon = new HtmlLink();            appleIcon.Attributes.Add("rel", "apple-touch-icon");            appleIcon.Attributes.Add("href", ResolveUrl("~/apple-touch-icon.png"));            HtmlMeta appleMobileWebAppStatusBarStyle = new HtmlMeta();            appleMobileWebAppStatusBarStyle.Attributes.Add("name", "apple-mobile-web-app-status-bar-style");            appleMobileWebAppStatusBarStyle.Attributes.Add("content", "black");            head.Controls.Add(appleMobileWebAppStatusBarStyle);    }     internal string FindPath(string Location)    {        string Url = Server.MapPath(Location);        return (Url);    }}

    Read the article

  • SQL SERVER – Standard Reports from SQL Server Management Studio – SQL in Sixty Seconds #016 – Video

    - by pinaldave
    SQL Server management Studio 2012 is wonderful tool and has many different features. Many times, an average user does not use them as they are not aware about these features. Today, we will learn one such feature. SSMS comes with many inbuilt performance and activity reports, but we do not use it to the full potential. Connect to SQL Server Node >> Right Click on it >> Go to Reports >> Click on Standard Reports >> Pick Any Report. Please note that some of the reports can be IO intensive and not suggested to run during business hours! More on Standard Reports: SQL SERVER – Out of the Box – Activity and Performance Reports from SSSMS SQL SERVER – Generate Report for Index Physical Statistics – SSMS SQL SERVER – Configure Management Data Collection in Quick Steps I encourage you to submit your ideas for SQL in Sixty Seconds. We will try to accommodate as many as we can. If we like your idea we promise to share with you educational material. Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Database, Pinal Dave, PostADay, SQL, SQL Authority, SQL in Sixty Seconds, SQL Query, SQL Scripts, SQL Server, SQL Server Management Studio, SQL Tips and Tricks, T SQL, Technology, Video

    Read the article

  • Need a solution to store images (1 billion, 1000,000,000) which users will upload to a website via php or javascript upload [on hold]

    - by wish_you_all_peace
    I need a solution to store images (1 billion) which users will upload to a website via PHP or Javascript upload (website will have 1 billion page views a month using Linux Debian distros) assuming 20 photos per user maximum (10 thumbnails of size 90px by 90px and 10 large, script resized images of having maximum width 500px or maximum height 500px depending on shape of image, meaning square, rectangle, horizontal, vertical etc). Assume this to be a LEMP-stack (Linux Nginx MySQL PHP) social-media or social-matchmaking type application whose content will be text and images. Since everyone knows storing tons of images (website users uploaded images in this case) are bad inside a single directory or NFS etc, please explain all the details about the architecture and configuration of the entire setup of storage solution, to store 1 billion images on any method you recommend (no third-party cloud storage like S3 etc. It has to be within the private data center using our own hardware and resources.). The solution has to include both the storage solution and organizing the images uploaded by users. How will we organize the users images if a single user will not have more than 20 images (10 thumbs and 10 large of having either width or height 500px)? Please consider that this has to be organized in a structural way so we can fetch a single user's images via PHP/Javascript or API programmatically through some type of user's unique identifier(s).

    Read the article

< Previous Page | 203 204 205 206 207 208 209 210 211 212 213 214  | Next Page >