Search Results

Search found 73708 results on 2949 pages for 'file systems'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 21/2949 | < Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >

  • Reliable file copy (move) process - mostly Unix/Linux

    - by mfinni
    Short story : We have a need for a rock-solid reliable file mover process. We have source directories that are often being written to that we need to move files from. The files come in pairs - a big binary, and a small XML index. We get a CTL file that defines these file bundles. There is a process that operates on the files once they are in the destination directory; that gets rid of them when it's done. Would rsync do the best job, or do we need to get more complex? Long story as follows : We have multiple sources to pull from : one set of directories are on a Windows machine (that does have Cygwin and an SSH daemon), and a whole pile of directories are on a set of SFTP servers (Most of these are also Windows.) Our destinations are a list of directories on AIX servers. We used to use a very reliable Perl script on the Windows/Cygwin machine when it was our only source. However, we're working on getting rid of that machine, and there are other sources now, the SFTP servers, that we cannot presently run our own scripts on. For security reasons, we can't run the copy jobs on our AIX servers - they have no access to the source servers. We currently have a homegrown Java program on a Linux machine that uses SFTP to pull from the various new SFTP source directories, copies to a local tmp directory, verifies that everything is present, then copies that to the AIX machines, and then deletes the files from the source. However, we're finding any number of bugs or poorly-handled error checking. None of us are Java experts, so fixing/improving this may be difficult. Concerns for us are: With a remote source (SFTP), will rsync leave alone any file still being written? Some of these files are large. From reading the docs, it seems like rysnc will be very good about not removing the source until the destination is reliably written. Does anyone have experience confirming or disproving this? Additional info We will be concerned about the ingestion process that operates on the files once they are in the destination directory. We don't want it operating on files while we are in the process of copying them; it waits until the small XML index file is present. Our current copy job are supposed to copy the XML file last. Sometimes the network has problems, sometimes the SFTP source servers crap out on us. Sometimes we typo the config files and a destination directory doesn't exist. We never want to lose a file due to this sort of error. We need good logs If you were presented with this, would you just script up some rsync? Or would you build or buy a tool, and if so, what would it be (or what technologies would it use?) I (and others on my team) are decent with Perl.

    Read the article

  • Comparison of Code Review Tools/Systems

    - by SytS
    There are a number of tools/systems available aimed at streamlining and enhancing the code review process, including: CodeStriker Review Board, code review system in use at VMWare Code Collaborator, commercial product by SmartBear Rietveld, based on Modrian, the code review system in use at Google Crucible, commercial product by Atlassian These systems all have varying feature sets, and differ in degrees of maturity and polish; the selection is a little bewildering for someone who is evaluating code review systems for the frist time. Some of these tools have already been mentioned in other questions/answers on StackOverflow, but I would like to see a more comprehensive comparison of the more popular systems, especially with respect to: integration with source control systems integration with bug tracking systems supported workflow (reviews pre/post commit, review or contiguous/non-contigous revision ranges, etc) deployment/maintenance requirements

    Read the article

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

  • Digital Asset Management, iPhoto / Aperture server... alternative

    - by Sisyphus
    Afternoon, Clients, 10 : All Apples running either Leopard or Snow Leopard Server : Snow Leopard server, (and I have a old Dell Poweredge 650 at home running Gentoo 2.6, if anybody as a Linux solution). The situation: I work in small design company with 8 people, at present we are looking to consolidate all our image files onto one location, at present we each use our preferred single user DAM solution, be it, Adobe Bridge, iPhoto/Aperture (some don't bother at all) The filetypes commonly used are .psd, .pdf, .eps, .tiff, .jpg and RAW image files. Ideally what is needed: Centralised on one server, but allows us to search via spotlight (not essential, but would be nice) Include searchable metadata information such as date, location, title Open-source or as low cost as possibly Allow simultaneous users to import files So far, I have looked at a few open source DAM, systems, such as Razuna, Gallery (not strictly DAM), ResourceSpace, Notre-DAM, while these are brilliant and open-source, they don't integrate as smoothly with the Desktop as iPhoto and aperture. For iPhoto and aperture, I have tried creating a Shared library on the server (a tad laggy), and also using a drive with no permissions, put a library and letting each client read from it, however if they want to put images onto the library only, it's only supports one user at a time writing to the library... Any ideas what could fulfill our needs? Or is it time to bite the bullet for FinalCut Server? Thanks in advance.

    Read the article

  • rename files with the same name

    - by snorpey
    Hi. I use the following function to rename thumbnails. For example, if I upload a file called "image.png" to an upload folder, and this folder already has a file named "image.png" in it, the new file automatically gets renamed to "image-copy-1.png". If there also is a file called "image-copy-1.png" it gets renamed to "image-copy-2.png" and so on. The following function returns the new filename. At least that's what it is supposed to do... The renaming doesn't seeem to work correctly, though. Sometimes it produces strange results, like: 1.png 1-copy-1.png 1-copy-2.png 1-copy-2-copy-1.png 1-copy-2-copy-3.png I hope you understand my problem, despite my description being somewhat complex... Can you tell me what went wrong here? (bonus question: Is regular expressions the right tool for doing this kind of stuff?) <?php function renameDuplicates($path, $file) { $fileName = pathinfo($path . $file, PATHINFO_FILENAME); $fileExtension = "." . pathinfo($path . $file, PATHINFO_EXTENSION); if(file_exists($path . $file)) { $fileCopy = $fileName . "-copy-1"; if(file_exists($path . $fileCopy . $fileExtension)) { if ($contains = preg_match_all ("/.*?(copy)(-)(\\d+)/is", $fileCopy, $matches)) { $copyIndex = $matches[3][0]; $fileName = substr($fileCopy, 0, -(strlen("-copy-" . $copyIndex))) . "-copy-" . ($copyIndex + 1); } } else { $fileName .= "-copy-1"; } } $returnValue = $fileName . $fileExtension; return $returnValue; }?>

    Read the article

  • Integrating HP Systems Insight Manager into an existing environment

    - by ewwhite
    I'm working with an environment that spans multiple data centers/sites and consists primarily of HP ProLiant servers (G5-G7) running Linux. The mix is 30% RHEL/CentOS, the rest are Gentoo :(. I also have a few dozen virtual machines running back-office and Windows servers on VMWare ESX hosts. I run OpenNMS to pull SNMP data from the various server nodes and networking devices. While OpenNMS works wonderfully for up/down, thresholds and notifications, it's native handling of traps is a little rough and the graphs are not particularly pretty. I use Orca/RRD graphs for performance trending and nice graphs. I'm tasked with inventorying the environment and wanted to come up with a clean way to organize server information. Since my environment is mostly HP, I've been playing with HP Systems Insight Manager as a way to extract server data and to deploy HP health/monitoring packages and firmware. The Gentoo systems eventually have to be converted to CentOS, so getting a quick assessment of what hardware is where would be great. Although I've read through a few hundred pages of HP manuals, I'm having a difficult time understanding how to get HP SIM to do what I want, though. My main problems are: I have about 40 subnets to deal with; 98% connected with private lines to facilities across the globe. I don't want to initiate an HP SIM discovery only to pull back every piece of intermediate networking hardware and equipment from all of the locations. I'd like this to focus on the servers. I have OpenNMS configured to accept traps. I don't want HP SIM to duplicate that effort. It seems like the built-in software deployment tool wants to overwrite the trapsink parameters for the systems it encounters during discovery. I have about 10 administrative username/password combinations in use across this infrastructure. Is there a more efficient way to get HP SIM to do the discovery or break discovery into manageable chunks? In terms of general workflow, do people typically install the HP Management Agents during the initial OS deployment (e.g. kickstart post script) or afterwards from HP SIM? Is HP SIM too thick/fat to be an inventory tool? I can't tell if it's meant to be used standalone or alongside other monitoring products. Since the majority of the systems I'm trying to track are those running Gentoo (in order to plan the move to CentOS), is there any way for HP SIM to extract system model information from them ( like dmidecode)? I have systems here where I may have an SSH key established, but not direct user or login access. Is there a way for me to import an SSH private/public key pair into HP SIM to reach out to the servers that can't accept standard credentials? There are a handful of sites where I have inconsistent access or have a double-NAT situation. I may be able to poke a server, but it may not be able to find its way back to the management system. Is there a workaround for this? The certificate configuration for HP SIM seems complicated. What is the preferred setup for trust between systems? I'd also appreciate any notes or recommendations to using this product. Or if there's a better way to do this, I'd like to know.

    Read the article

  • Does your organization still use the term "screens" to describe a user interface?

    - by bit-twiddler
    I have been in the field long enough to remember when the term "screen" entered our lexicon. As difficult as it is to believe, the early systems on which I worked had no user interface (UI), that is, unless one counts a keypunch machine and job listings as a user interface. These systems ran as "card image" production jobs back in a day when being a computer operator required a reasonably deep understanding of how computers worked. Flashing forward to today: I cringe every time I hear a systems practitioner use the term "screen." The metaphor no longer fits the medium. The term somewhat fit back when the user dialog consumed 100% of available monitor real estate; however, the term lost its relevance the moment we moved to windowed environments. With the above said, does your organization still use the term "screens" to describe an application's UI? Has anyone successfully purged the term from an organization? For those who do not use the term to describe UI dialog elements, what term do you use in place of “screen.”

    Read the article

  • TestDriven.Net 3.0 – All Systems Go

    - by Jamie Cansdale
    I’m pleased to announce that TestDriven.Net 3.0 is now available. Finally! I know many of you will already be using the Beta and RC versions, but if you look at the release notes you’ll see there’s been many refinements since then, so I highly recommend you install the RTM version. Here is a quick summary of a few new features: Visual Studio 2010 supports targeting multiple versions of the .NET framework (multi-targeting). This means you can easily upgrade your Visual Studio 2005/2008 solutions without necessarily converting them to use .NET 4.0. TestDriven.Net will execute your tests using the .NET version your test project is targeting (see ‘Properties > Application > Target framework’). There is now first class support for MSTest when using Visual Studio 2008 & 2010. Previous versions of TestDriven.Net had support for a limited number of MSTest attributes. This version supports virtually all MSTest unit testing related attributes, including support for deployment item and data driven test attributes. You should also find this test runner is quick. ;) There is a new ‘Go To Test/Code’ command on the code context menu. You can think of this as Ctrl-Tab for test driven developers; it will quickly flip back and forth between your tests and code under test. I recommend assigning a keyboard shortcut to the ‘TestDriven.NET.GoToTestOrCode’ command. NCover can now be used for code coverage on .NET 4.0. This is only officially supported since NCover 3.2 (your mileage may vary if you’re using the 1.5.8 version). Rather than clutter the ‘Output’ window, ignored or skipped tests will be placed on the ‘Task List’. You can double-click on these items to navigate to the offending test (or assign a keyboard shortcut to ‘View.NextTask’). If you’re using a Team, Premium or Ultimate edition of Visual Studio 2005-2010, a new ‘Test With > Performance’ command will be available. This command will perform instrumented performance profiling on your target code. A particular focus of this version has been to make it more keyboard friendly. Here’s a list of commands you will probably want to assign keyboard shortcuts to: Name Default What I use TestDriven.NET.RunTests Run tests in context   Alt + T TestDriven.NET.RerunTests Repeat test run   Alt + R TestDriven.NET.GoToTestOrCode Flip between tests and code   Alt + G TestDriven.NET.Debugger Run tests with debugger   Alt + D View.Output Show the ‘Output’ window Ctrl+ Alt + O   Edit.BreakLine Edit code in stack trace Enter   View.NextError Jump to next failed test Ctrl + Shift + F12   View.NextTask Jump to next skipped test   Alt + S   By default the ‘Output’ window will automatically activate when there is test output or a failed test (this is an option). The cursor will be positioned on the stack trace of the last failed test, ready for you to hit ‘Enter’ to jump to the fail point or ‘Esc’ to return to your source (assuming your ‘Output’ window is set to auto-hide).  If your ‘Output’ window isn’t set to auto-hide, you’ll need to hit ‘Ctrl + Alt + O’ then ‘Enter’. Alternatively you can use ‘Ctrl + Shift + F12’ (View.NextError) to navigate between all failed tests.   For more frequent updates or to give feedback, you can find me on twitter here. I hope you enjoy this version. Let me know how you get on. :)

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 17 18 19 20 21 22 23 24 25 26 27 28  | Next Page >