Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 211/330 | < Previous Page | 207 208 209 210 211 212 213 214 215 216 217 218  | Next Page >

• Get latest sql rows based on latest date and per user

  - by Umair

  I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

  Read the article

• Are Blogengine.net support posts in other language like Hindi when they written through unicode font

  - by steven spielberg

  when i test a post written in Hindi that i got the error that "Url : http://localhost:50263/BlogEngine.Web/admin/Pages/Add_entry.aspx?id=c3b7497c-60e7-41c7-ac10-36f21999f82f Raw Url : /BlogEngine.Web/admin/Pages/Add_entry.aspx?id=c3b7497c-60e7-41c7-ac10-36f21999f82f Message : A potentially dangerous Request.Form value was detected from the client (ctl00$cphAdmin$txtContent$TinyMCE1$txtContent=" ..."). Source : System.Web StackTrace : at System.Web.HttpRequest.ValidateString(String value, String collectionKey, RequestValidationSource requestCollection) at System.Web.HttpRequest.ValidateNameValueCollection(NameValueCollection nvc, RequestValidationSource requestCollection) at System.Web.HttpRequest.get_Form() at System.Web.HttpRequest.get_Item(String key) at BlogEngine.Core.Web.HttpModules.CompressionModule.context_PostReleaseRequestState(Object sender, EventArgs e) in D:\Projects\Be-1610\BlogEngine\DotNetSlave.BusinessLogic\Web\HttpModules\CompressionModule.cs:line 62 at System.Web.HttpApplication.SyncEventExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) " what is meaning of this error. are this support unicode ?

  Read the article

• Double-Escaped Unicode Javascript Issue

  - by Jeffrey Winter

  I am having a problem displaying a Javascript string with embedded Unicode character escape sequences (\uXXXX) where the initial "\" character is itself escaped as "&#92;" What do I need to do to transform the string so that it properly evaluates the escape sequences and produces output with the correct Unicode character? For example, I am dealing with input such as: "this is a &#92;u201ctest&#92;u201d"; attempting to decode the "&#92;" using a regex expression, e.g.: var out = text.replace('/&#92;/g','\'); results in the output text: "this is a \u201ctest\u201d"; that is, the Unicode escape sequences are displayed as actual escape sequences, not the double quote characters I would like.

  Read the article

• Android: TabActivity, Creating Menu

  - by Waqas

  Hi, i have created 3 tabs using the TabActivity. The class declaration is like this. public class ABTM extends TabActivity { ........ some code .......... } now i want to create a Menu with three menu items. but the problem is that the **@Override public boolean OnCreateOptionsMenu(Menu menu){ }** gives error. It says that i should remove the @Override. When i remove the @Override the error is gone and the application runs fine but pressing the menu button does nothing. What am i doing wrong here?

  Read the article

• Reg : Contact changes in Android

  - by Laxman

  Hi, I am using ContentObserver on contacts. But here my problem is atleast once i have to launch my application other wise i am unable to get notification chages. My code like this ContactsContentObserver cco = new ContactsContentObserver(handler); ContentResolver contentResolver = getContentResolver(); contentResolver.registerContentObserver(RawContacts.CONTENT_URI, true, cco); } private class ContactsContentObserver extends ContentObserver { public ContactsContentObserver(Handler h) { super(h); } public void onChange(boolean selfChange) { System.out.println("##########SOMEBODAY CHANGED ANYTHING AT THE CONTACTS"); Toast.makeText(getApplication(),"####Updated####",Toast.LENGTH_LONG).show(); } .... Adv thanks. u can contact on [email protected]

  Read the article

• Using Regex groups in bash

  - by AlexeyMK

  Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

  Read the article

• regex to format a float in php

  - by Itamar Bar-Lev

  I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

  Read the article

• Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

  - by lmonson

  I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

  Read the article

• How to check if a variable exists in a FreeMarker template?

  - by Don

  Hi, I have a Freemarker template which contains a bunch of placeholders for which values are supplied when the template is processed. I want to conditionally include part of the template if the userName variable is supplied, something like: [#if_exists userName] Hi ${userName}, How are you? [/#if_exists] However, the FreeMarker manual seems to indicate that if_exists is deprecated, but I can't find another way to achieve this. Of course, I could simple providing an additional boolean variable isUserName and use that like this: [#if isUserName] Hi ${userName}, How are you? [/#if] But if there's a way of checking whether userName exists then I can avoid adding this extra variable. Cheers, Don

  Read the article

• problem with null column

  - by Iulian

  One column in my database (of type double) has some null values. I am executing a sored procedure to get the data in my app wipDBTableAdapters.XLSFacturiTableAdapter TAFacturi = new wipDBTableAdapters.XLSFacturiTableAdapter(); var dtfacturi = TAFacturi.GetData(CodProiect); Then i try to do something like this: if (dtfacturi[i].CANTITATE == null) { //do something } this is giving a warning : The result of the expression is always 'false' since a value of type 'double' is never equal to 'null' of type 'double? However when i run my code i get the following exception: StrongTypingException The value for column 'CANTITATE' in table 'XLSFacturi' is DBNull. How am I supposed to resolve this ?

  Read the article

• Scala 2.8: use Java annotation with an array parameter

  - by yournamehere

  I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

  Read the article

• Riddle: Spot the serious bug in this bubble sort implementation

  - by ripper234

  (No, this isn't a homework assignment, I just found the bug and thought it might be useful to share it here) import java.util.List; public class BubbleSorter { public <T extends Comparable<T>> void sort(List<T> list) { while (true) { boolean didWork = false; for (int i = 0; i < list.size() - 1; ++i) { if (list.get(i).compareTo(list.get(i + 1)) > 0) { swap(list, i, i + 1); didWork = true; break; } } if (!didWork) return; } } private static <T> void swap(List<T> list, int i, int j) { T tmp = list.get(i); list.set(i, list.get(j)); list.set(j, tmp); } }

  Read the article

• Iserializable to serialize readonly methods to be sent through webservice

  - by george9170

  I am sending an object through a webservice with readonly methods. I am using the Iserializable interface, assuming that I would no longer need a parameterless constructor. This is not true and I still cannot send my object over the wire. public class Foo: ISerializable { public boolean IsBusy { get; private set;} protected Foo(SerializationInfo info, StreamingContext context) { this.IsBusy = info.GetBoolean("IsBusy"); } void ISerializable.GetObjectData(SerializationInfo info, StreamingContext context) { .AddValue("IsBusy", this.IsBusy); }

  Read the article

• How to use Visual Studio debugger visualizers built against a different framework version?

  - by michielvoo

  I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

  Read the article

• What logic operator to use, as3?

  - by VideoDnd

  What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Using attr_accessible in a join model with has_many :through relationship

  - by Paulo Oliveira

  I have a USER that creates a COMPANY and become an EMPLOYEE in the process. The employees table has an :user_id and a :company_id. class User has_many :employees has_many :companies, :through => :employees class Employee belongs_to :user belongs_to :company attr_accessible :active class Company has_many :employees has_many :users, :through => employees Pretty basic. But here's the thing, the resource EMPLOYEE has other attributes than its foreign keys, like the boolean :active. I would like to use attr_accessible, but this causes some problems. The attribute :user_id is set right, but :company_id is nil. @user.companies << Company.new(...) Employee id:1 user_id:1 company_id:nil So my question is: if :user_id is set right, despite it is not an attr_accessible, why :company_id isn't set right just the same? It shouldn't be an attr_accessible. I'm using Rails 3.0.8, and have also tested with 3.0.7.

  Read the article

• How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

  - by Shahar Evron

  I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

  Read the article

• Cant create 2nd textbox

  - by okinaw55

  Having problems with this code and cant figure out why. It works fine the first time through but crashes with a Parameter is not Valid error the 2nd time on this line. Dim tbx As TextBox = New Windows.Forms.TextBox Any help is appreciated. Dim tbx As TextBox = New Windows.Forms.TextBox tbx.Name = tbxName tbx.Size = New System.Drawing.Size(55, 12) tbx.BorderStyle = BorderStyle.None tbx.TextAlign = HorizontalAlignment.Center Using f As Font = tbx.Font tbx.Font = New Font(f.FontFamily, 8, FontStyle.Bold) End Using tbx.Location = New System.Drawing.Point(xCords, 44) Select Case tbx.Name Case "tbxBulk01" : tbx.Text = Bulk01Label Case "tbxBulk02" : tbx.Text = Bulk02Label End Select Me.Controls.Add(tbx) Stack trace as follows. at System.Drawing.Font.GetHeight(Graphics graphics) at System.Drawing.Font.GetHeight() at System.Drawing.Font.get_Height() at System.Windows.Forms.Control.get_FontHeight() at System.Windows.Forms.TextBoxBase.get_PreferredHeight() at System.Windows.Forms.TextBoxBase.get_DefaultSize() at System.Windows.Forms.Control..ctor(Boolean autoInstallSyncContext) at System.Windows.Forms.TextBoxBase..ctor() at System.Windows.Forms.TextBox..ctor()

  Read the article

• Daylight saving time of current tz

  - by spam2

  Hi, in my c++ software I've used Boost in some parts and also for the local time. OK, now my problem is to make a check if in my machine is active or not the DST. With the follow part of code I can know only the difference from the UTC time. In my case the difference is 2 hours because is active the DST ptime tLoc = second_clock::local_time(); ptime tUTC = second_clock::universal_time(); time_duration tDiff = tUTC - tLoc; local_time_zone = tDiff.hours(); I think that the boolean funcion has_dst() can help, right? My system is Debian GNU/Linux. Thanks

  Read the article

• jQuery 1.4.x and the @ symbol

  - by David

  I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

  Read the article

• Understanding the workings of equals and hashCode in a HashMap

  - by andandandand

  I have this test code: import java.util.*; class MapEQ { public static void main(String[] args) { Map<ToDos, String> m = new HashMap<ToDos, String>(); ToDos t1 = new ToDos("Monday"); ToDos t2 = new ToDos("Monday"); ToDos t3 = new ToDos("Tuesday"); m.put(t1, "doLaundry"); m.put(t2, "payBills"); m.put(t3, "cleanAttic"); System.out.println(m.size()); } } class ToDos{ String day; ToDos(String d) { day = d; } public boolean equals(Object o) { return ((ToDos)o).day == this.day; } // public int hashCode() { return 9; } } When // public int hashCode() { return 9; } is uncommented m.size() returns 2, when it's left commented it returns three. Why?

  Read the article

• How to convert an arbitrary object to String with JSTL? (calling toString())

  - by hstoerr

  Is there any way to call toString() on an object with the JSTL? (I need the String representation of an enum as index in a map in a JSP EL expression.) I hoped something like ${''+object} would work like in java, but JSTL isn't that nice, and there does not seem to be any function that does it. Clarification: I have a variable somemap that maps Strings to Strings, and I have a variable someenum that is an enumeration. I'd like to do something like ${somemap[someenum.toString()]}. (Of course .toString() does not work, but what does?)

  Read the article

• Does AS3 show cacheasbitmap in preview?

  - by Fahim Akhter

  The following code shows me that cacheasbitmap is turning on and off like it is suppose to but, I never get to see it visually like I did in AS2. Is this a error or a change in actionscript? package { import flash.display.Sprite; import flash.events.MouseEvent; public class Bitmapascache extends Sprite { private var isOn:Boolean=false; private var box:mainBox; public function Bitmapascache() { box = new mainBox() box.addEventListener(MouseEvent.MOUSE_DOWN,click); this.addChild(box); } public function click(e:MouseEvent):void { trace("click :"+box.cacheAsBitmap); if(isOn){ box.cacheAsBitmap = false; isOn = false; } else{ box.cacheAsBitmap = true; isOn = true; } } } }

  Read the article

• Returning in a static class constructor

  - by Martijn Courteaux

  Hello, This isn't valid code: public class MyClass { private static boolean yesNo = false; static { if (yesNo) { System.out.println("Yes"); return; // The return statement is the problem } System.exit(0); } } This is a stupid example, but in a static class constructor we can't return;. Why? Are there good reasons for this? Does someone know something more about this? So the reason why I should do return is to end constructing there. Thanks

  Read the article

< Previous Page | 207 208 209 210 211 212 213 214 215 216 217 218  | Next Page >