Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 211/330 | < Previous Page | 207 208 209 210 211 212 213 214 215 216 217 218  | Next Page >

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • Riddle: Spot the serious bug in this bubble sort implementation

    - by ripper234
    (No, this isn't a homework assignment, I just found the bug and thought it might be useful to share it here) import java.util.List; public class BubbleSorter { public <T extends Comparable<T>> void sort(List<T> list) { while (true) { boolean didWork = false; for (int i = 0; i < list.size() - 1; ++i) { if (list.get(i).compareTo(list.get(i + 1)) > 0) { swap(list, i, i + 1); didWork = true; break; } } if (!didWork) return; } } private static <T> void swap(List<T> list, int i, int j) { T tmp = list.get(i); list.set(i, list.get(j)); list.set(j, tmp); } }

    Read the article

  • Scrapy Could not find spider Error

    - by Nacari
    I have been trying to get a simple spider to run with scrapy, but keep getting the error: Could not find spider for domain:stackexchange.com when I run the code with the expression scrapy-ctl.py crawl stackexchange.com. The spider is as follow: from scrapy.spider import BaseSpider from __future__ import absolute_import class StackExchangeSpider(BaseSpider): domain_name = "stackexchange.com" start_urls = [ "http://www.stackexchange.com/", ] def parse(self, response): filename = response.url.split("/")[-2] open(filename, 'wb').write(response.body) SPIDER = StackExchangeSpider()` Another person posted almost the exact same problem months ago but did not say how they fixed it, http://stackoverflow.com/questions/1806990/scrapy-spider-is-not-working I have been following the turtorial exactly at http://doc.scrapy.org/intro/tutorial.html, and cannot figure out why it is not working.

    Read the article

  • In OpenRasta is it possible to Pattern match multiple key/value pairs?

    - by Scott Littlewood
    Is it possible in OpenRasta to have a Uri pattern that allows for an array of values of the same key to be submitted and mapped to a handler method accepting an array of the query parameters. Example: Return all the contacts named Dave Smith from a collection. HTTP GET /contacts?filterBy=first&filterValue=Dave&filterBy=last&filterValue=Smith With a configuration of: What syntax would be best for the Uri string pattern matching? (Suggestions welcome) ResourceSpace.Has.ResourcesOfType<List<ContactResource>>() .AtUri("/contacts") .And.AtUri("/contacts?filterBy[]={filterBy}[]&filterValue[]={fv}[]") // Option 1 .And.AtUri("/contacts?filterBy={filterBy}[]&fv={fv}[]") // Option 2 Would map to a Handler method of: public object Get(params Filter[] filters) { /* create a Linq Expression based on the filters using dynamic linq query the repository using the Linq */ return Query.All<Contact>().Where(c => c.First == "Dave" && c.Last == "Smith").ToResource() } where Filter is defined by public class Filter { public string FilterBy { get; set; } public string FilterValue { get; set; } }

    Read the article

  • Using attr_accessible in a join model with has_many :through relationship

    - by Paulo Oliveira
    I have a USER that creates a COMPANY and become an EMPLOYEE in the process. The employees table has an :user_id and a :company_id. class User has_many :employees has_many :companies, :through => :employees class Employee belongs_to :user belongs_to :company attr_accessible :active class Company has_many :employees has_many :users, :through => employees Pretty basic. But here's the thing, the resource EMPLOYEE has other attributes than its foreign keys, like the boolean :active. I would like to use attr_accessible, but this causes some problems. The attribute :user_id is set right, but :company_id is nil. @user.companies << Company.new(...) Employee id:1 user_id:1 company_id:nil So my question is: if :user_id is set right, despite it is not an attr_accessible, why :company_id isn't set right just the same? It shouldn't be an attr_accessible. I'm using Rails 3.0.8, and have also tested with 3.0.7.

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • count of distinct acyclic paths from A[a,b] to A[c,d]?

    - by Sorush Rabiee
    I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Are Blogengine.net support posts in other language like Hindi when they written through unicode font

    - by steven spielberg
    when i test a post written in Hindi that i got the error that "Url : http://localhost:50263/BlogEngine.Web/admin/Pages/Add_entry.aspx?id=c3b7497c-60e7-41c7-ac10-36f21999f82f Raw Url : /BlogEngine.Web/admin/Pages/Add_entry.aspx?id=c3b7497c-60e7-41c7-ac10-36f21999f82f Message : A potentially dangerous Request.Form value was detected from the client (ctl00$cphAdmin$txtContent$TinyMCE1$txtContent=" ..."). Source : System.Web StackTrace : at System.Web.HttpRequest.ValidateString(String value, String collectionKey, RequestValidationSource requestCollection) at System.Web.HttpRequest.ValidateNameValueCollection(NameValueCollection nvc, RequestValidationSource requestCollection) at System.Web.HttpRequest.get_Form() at System.Web.HttpRequest.get_Item(String key) at BlogEngine.Core.Web.HttpModules.CompressionModule.context_PostReleaseRequestState(Object sender, EventArgs e) in D:\Projects\Be-1610\BlogEngine\DotNetSlave.BusinessLogic\Web\HttpModules\CompressionModule.cs:line 62 at System.Web.HttpApplication.SyncEventExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) " what is meaning of this error. are this support unicode ?

    Read the article

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • How to check if a variable exists in a FreeMarker template?

    - by Don
    Hi, I have a Freemarker template which contains a bunch of placeholders for which values are supplied when the template is processed. I want to conditionally include part of the template if the userName variable is supplied, something like: [#if_exists userName] Hi ${userName}, How are you? [/#if_exists] However, the FreeMarker manual seems to indicate that if_exists is deprecated, but I can't find another way to achieve this. Of course, I could simple providing an additional boolean variable isUserName and use that like this: [#if isUserName] Hi ${userName}, How are you? [/#if] But if there's a way of checking whether userName exists then I can avoid adding this extra variable. Cheers, Don

    Read the article

  • Correct Use of .NET Exception

    - by destructo_gold
    What is the correct exception to throw in the following instance? If, for example, I have a class: Album with a collection of Songs: List<Song> And a method within Album to add a Song: public void AddSong(Song song) { songs.Add(song); } Should I throw an exception of a user attempts to add a song that already exists? If so, what type of exception? I have heard the phrase: "Only use exceptions in exceptional circumstances", but I want to tell the client implementing Album exactly what has gone wrong (not just return a Boolean value).

    Read the article

  • Getting an odd error, MSSQL Query using `WITH` clause

    - by Aren B
    The following query: WITH CteProductLookup(ProductId, oid) AS ( SELECT p.ProductID, p.oid FROM [dbo].[ME_CatalogProducts] p ) SELECT rel.Name as RelationshipName, pl.ProductId as FromProductId, pl2.ProductId as ToProductId FROM ( [dbo].[ME_CatalogRelationships] rel INNER JOIN CteProductLookup pl ON pl.oid = rel.from_oid ) INNER JOIN CteProductLookup pl2 ON pl2.oid = rel.to_oid WHERE rel.Name = 'BundleItem' AND pl.ProductId = 'MX12345'; Is generating this error: Msg 319, Level 15, State 1, Line 5 Incorrect syntax near the keyword 'with'. If this statement is a common table expression, an xmlnamespaces clause or a change tracking context clause, the previous statement must be terminated with a semicolon. On execution only. There are no errors/warnings in the sql statement in the managment studio. Any ideas?

    Read the article

  • Is Valid IMAGE_DOS_SIGNATURE

    - by iira
    I want to check a file has a valid IMAGE_DOS_SIGNATURE (MZ) function isMZ(FileName : String) : boolean; var Signature: Word; fexe: TFileStream; begin result:=false; try fexe := TFileStream.Create(FileName, fmOpenRead or fmShareDenyNone); fexe.ReadBuffer(Signature, SizeOf(Signature)); if Signature = $5A4D { 'MZ' } then result:=true; finally fexe.free; end; end; I know I can use some code in Windows unit to check the IMAGE_DOS_SIGNATURE. The problem is I want the fastest way to check IMAGE_DOS_SIGNATURE (for a big file). I need your some suggestion about my code or maybe a new code? Thanks

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • How to disable all hardware keys programatically in android?

    - by Raghu Rami Reddy
    I am developing android application with lock functionality. please suggest me how to disable all the hard keys programatically. here i am using beleow code to disable back button. i want like this functionality for all hard keys like home,search,camera, shortcut keys here is my code: @Override public boolean onKey(View v, int keyCode, KeyEvent event) { if (keyCode == KeyEvent.KEYCODE_SEARCH) { Log.d("KeyPress", "search"); return true; } return false; } Thanks in advance.

    Read the article

  • How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

    - by Shahar Evron
    I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

    Read the article

  • Iserializable to serialize readonly methods to be sent through webservice

    - by george9170
    I am sending an object through a webservice with readonly methods. I am using the Iserializable interface, assuming that I would no longer need a parameterless constructor. This is not true and I still cannot send my object over the wire. public class Foo: ISerializable { public boolean IsBusy { get; private set;} protected Foo(SerializationInfo info, StreamingContext context) { this.IsBusy = info.GetBoolean("IsBusy"); } void ISerializable.GetObjectData(SerializationInfo info, StreamingContext context) { .AddValue("IsBusy", this.IsBusy); }

    Read the article

  • Dynamic scoping in Clojure?

    - by j-g-faustus
    Hi, I'm looking for an idiomatic way to get dynamically scoped variables in Clojure (or a similar effect) for use in templates and such. Here is an example problem using a lookup table to translate tag attributes from some non-HTML format to HTML, where the table needs access to a set of variables supplied from elsewhere: (def *attr-table* ; Key: [attr-key tag-name] or [boolean-function] ; Value: [attr-key attr-value] (empty array to ignore) ; Context: Variables "tagname", "akey", "aval" '( ; translate :LINK attribute in <a> to :href [:LINK "a"] [:href aval] ; translate :LINK attribute in <img> to :src [:LINK "img"] [:src aval] ; throw exception if :LINK attribute in any other tag [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules ; ignore string keys, used for internal bookkeeping [(string? akey)] [] )) ; ignore I want to be able to evaluate the rules (left hand side) as well as the result (right hand side), and need some way to put the variables in scope at the location where the table is evaluated. I also want to keep the lookup and evaluation logic independent of any particular table or set of variables. I suppose there are similar issues involved in templates (for example for dynamic HTML), where you don't want to rewrite the template processing logic every time someone puts a new variable in a template. Here is one approach using global variables and bindings. I have included some logic for the table lookup: ;; Generic code, works with any table on the same format. (defn rule-match? [rule-val test-val] "true if a single rule matches a single argument value" (cond (not (coll? rule-val)) (= rule-val test-val) ; plain value (list? rule-val) (eval rule-val) ; function call :else false )) (defn rule-lookup [test-val rule-table] "looks up rule match for test-val. Returns result or nil." (loop [rules (partition 2 rule-table)] (when-not (empty? rules) (let [[select result] (first rules)] (if (every? #(boolean %) (map rule-match? select test-val)) (eval result) ; evaluate and return result (recur (rest rules)) ))))) ;; Code specific to *attr-table* (def tagname) ; need these globals for the binding in html-attr (def akey) (def aval) (defn html-attr [tagname h-attr] "converts to html attributes" (apply hash-map (flatten (map (fn [[k v :as kv]] (binding [tagname tagname akey k aval v] (or (rule-lookup [k tagname] *attr-table*) kv))) h-attr )))) (defn test-attr [] "test conversion" (prn "a" (html-attr "a" {:LINK "www.google.com" "internal" 42 :title "A link" })) (prn "img" (html-attr "img" {:LINK "logo.png" }))) user=> (test-attr) "a" {:href "www.google.com", :title "A link"} "img" {:src "logo.png"} This is nice in that the lookup logic is independent of the table, so it can be reused with other tables and different variables. (Plus of course that the general table approach is about a quarter of the size of the code I had when I did the translations "by hand" in a giant cond.) It is not so nice in that I need to declare every variable as a global for the binding to work. Here is another approach using a "semi-macro", a function with a syntax-quoted return value, that doesn't need globals: (defn attr-table [tagname akey aval] `( [:LINK "a"] [:href ~aval] [:LINK "img"] [:src ~aval] [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules [(string? ~akey)] [] ))) Only a couple of changes are needed to the rest of the code: In rule-match?, when syntax-quoted the function call is no longer a list: - (list? rule-val) (eval rule-val) + (seq? rule-val) (eval rule-val) In html-attr: - (binding [tagname tagname akey k aval v] - (or (rule-lookup [k tagname] *attr-table*) kv))) + (or (rule-lookup [k tagname] (attr-table tagname k v)) kv))) And we get the same result without globals. (And without dynamic scoping.) Are there other alternatives to pass along sets of variable bindings declared elsewhere, without the globals required by Clojure's binding? Is there an idiomatic way of doing it, like Ruby's binding or Javascript's function.apply(context)?

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • Scala 2.8: use Java annotation with an array parameter

    - by yournamehere
    I'm trying to implement an JavaEE Session Bean with Scala 2.8. Because it's a Remote Session Bean, i have to annotate it with the following Java Annotation: @Target({ElementType.TYPE}) @Retention(RetentionPolicy.RUNTIME) public @interface Remote { Class[] value() default {}; } I only found this example for scala 2.7. In Scala 2.7, its possible to define the session bean like this: @Remote {val value = Array(classOf[ITest])} class MyEJB ... How can i use this annotation the same way with Scala 2.8? I already tried many different versions, all resulting in "annotation argument needs to be a constant", "illegal start of simple expression". All of these definitions don't work: @Remote{val value = Array(classOf[PersonScalaEJB])} @Remote(val value = Array(classOf[PersonScalaEJB])) @Remote(Array(classOf[PersonScalaEJB]))

    Read the article

  • Android: TabActivity, Creating Menu

    - by Waqas
    Hi, i have created 3 tabs using the TabActivity. The class declaration is like this. public class ABTM extends TabActivity { ........ some code .......... } now i want to create a Menu with three menu items. but the problem is that the **@Override public boolean OnCreateOptionsMenu(Menu menu){ }** gives error. It says that i should remove the @Override. When i remove the @Override the error is gone and the application runs fine but pressing the menu button does nothing. What am i doing wrong here?

    Read the article

  • Using DateDiff in Entity Framwork on a SQL CE database

    - by deverop
    I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

    Read the article

< Previous Page | 207 208 209 210 211 212 213 214 215 216 217 218  | Next Page >