Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 212/330 | < Previous Page | 208 209 210 211 212 213 214 215 216 217 218 219  | Next Page >

• Problem with nested lambda expressions.

  - by Lehto

  Hey I'm trying to do a nested lambda expression like to following: textLocalizationTable.Where( z => z.SpokenLanguage.Any( x => x.FromCulture == "en-GB") ).ToList(); but i get the error: Member access 'System.String FromCulture' of 'DomainModel.Entities.SpokenLanguage' not legal on type 'System.Data.Linq.EntitySet`1[DomainModel.Entities.SpokenLanguage]. TextLocalization has this relation to spokenlanguage: [Association(OtherKey = "LocalizationID", ThisKey = "LocalizationID", Storage = "_SpokenLanguage")] private EntitySet<SpokenLanguage> _SpokenLanguage = new EntitySet<SpokenLanguage>(); public EntitySet<SpokenLanguage> SpokenLanguage { set { _SpokenLanguage = value; } get { return _SpokenLanguage; } } Any idea what is wrong?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Returning in a static class constructor

  - by Martijn Courteaux

  Hello, This isn't valid code: public class MyClass { private static boolean yesNo = false; static { if (yesNo) { System.out.println("Yes"); return; // The return statement is the problem } System.exit(0); } } This is a stupid example, but in a static class constructor we can't return;. Why? Are there good reasons for this? Does someone know something more about this? So the reason why I should do return is to end constructing there. Thanks

  Read the article

• Dynamic scoping in Clojure?

  - by j-g-faustus

  Hi, I'm looking for an idiomatic way to get dynamically scoped variables in Clojure (or a similar effect) for use in templates and such. Here is an example problem using a lookup table to translate tag attributes from some non-HTML format to HTML, where the table needs access to a set of variables supplied from elsewhere: (def *attr-table* ; Key: [attr-key tag-name] or [boolean-function] ; Value: [attr-key attr-value] (empty array to ignore) ; Context: Variables "tagname", "akey", "aval" '( ; translate :LINK attribute in <a> to :href [:LINK "a"] [:href aval] ; translate :LINK attribute in <img> to :src [:LINK "img"] [:src aval] ; throw exception if :LINK attribute in any other tag [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules ; ignore string keys, used for internal bookkeeping [(string? akey)] [] )) ; ignore I want to be able to evaluate the rules (left hand side) as well as the result (right hand side), and need some way to put the variables in scope at the location where the table is evaluated. I also want to keep the lookup and evaluation logic independent of any particular table or set of variables. I suppose there are similar issues involved in templates (for example for dynamic HTML), where you don't want to rewrite the template processing logic every time someone puts a new variable in a template. Here is one approach using global variables and bindings. I have included some logic for the table lookup: ;; Generic code, works with any table on the same format. (defn rule-match? [rule-val test-val] "true if a single rule matches a single argument value" (cond (not (coll? rule-val)) (= rule-val test-val) ; plain value (list? rule-val) (eval rule-val) ; function call :else false )) (defn rule-lookup [test-val rule-table] "looks up rule match for test-val. Returns result or nil." (loop [rules (partition 2 rule-table)] (when-not (empty? rules) (let [[select result] (first rules)] (if (every? #(boolean %) (map rule-match? select test-val)) (eval result) ; evaluate and return result (recur (rest rules)) ))))) ;; Code specific to *attr-table* (def tagname) ; need these globals for the binding in html-attr (def akey) (def aval) (defn html-attr [tagname h-attr] "converts to html attributes" (apply hash-map (flatten (map (fn [[k v :as kv]] (binding [tagname tagname akey k aval v] (or (rule-lookup [k tagname] *attr-table*) kv))) h-attr )))) (defn test-attr [] "test conversion" (prn "a" (html-attr "a" {:LINK "www.google.com" "internal" 42 :title "A link" })) (prn "img" (html-attr "img" {:LINK "logo.png" }))) user=> (test-attr) "a" {:href "www.google.com", :title "A link"} "img" {:src "logo.png"} This is nice in that the lookup logic is independent of the table, so it can be reused with other tables and different variables. (Plus of course that the general table approach is about a quarter of the size of the code I had when I did the translations "by hand" in a giant cond.) It is not so nice in that I need to declare every variable as a global for the binding to work. Here is another approach using a "semi-macro", a function with a syntax-quoted return value, that doesn't need globals: (defn attr-table [tagname akey aval] `( [:LINK "a"] [:href ~aval] [:LINK "img"] [:src ~aval] [:LINK] (throw (RuntimeException. (str "No match for " tagname))) ; ... more rules [(string? ~akey)] [] ))) Only a couple of changes are needed to the rest of the code: In rule-match?, when syntax-quoted the function call is no longer a list: - (list? rule-val) (eval rule-val) + (seq? rule-val) (eval rule-val) In html-attr: - (binding [tagname tagname akey k aval v] - (or (rule-lookup [k tagname] *attr-table*) kv))) + (or (rule-lookup [k tagname] (attr-table tagname k v)) kv))) And we get the same result without globals. (And without dynamic scoping.) Are there other alternatives to pass along sets of variable bindings declared elsewhere, without the globals required by Clojure's binding? Is there an idiomatic way of doing it, like Ruby's binding or Javascript's function.apply(context)?

  Read the article

• Get latest sql rows based on latest date and per user

  - by Umair

  I have the following table: RowId, UserId, Date 1, 1, 1/1/01 2, 1, 2/1/01 3, 2, 5/1/01 4, 1, 3/1/01 5, 2, 9/1/01 I want to get the latest records based on date and per UserId but as a part of the following query (due to a reason I cannot change this query as this is auto generated by a tool but I can write pass any thing starting with AND...): SELECT RowId, UserId, Date FROM MyTable WHERE 1 = 1 AND ( // everything which needs to be done goes here . . . ) I have tried similar query, but get an error: Only one expression can be specified in the select list when the subquery is not introduced with EXISTS.

  Read the article

• Understanding the workings of equals and hashCode in a HashMap

  - by andandandand

  I have this test code: import java.util.*; class MapEQ { public static void main(String[] args) { Map<ToDos, String> m = new HashMap<ToDos, String>(); ToDos t1 = new ToDos("Monday"); ToDos t2 = new ToDos("Monday"); ToDos t3 = new ToDos("Tuesday"); m.put(t1, "doLaundry"); m.put(t2, "payBills"); m.put(t3, "cleanAttic"); System.out.println(m.size()); } } class ToDos{ String day; ToDos(String d) { day = d; } public boolean equals(Object o) { return ((ToDos)o).day == this.day; } // public int hashCode() { return 9; } } When // public int hashCode() { return 9; } is uncommented m.size() returns 2, when it's left commented it returns three. Why?

  Read the article

• How can I capture multiple matches from the same Perl regex?

  - by Sho Minamimoto

  I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like: $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

  Read the article

• How do I create regex groups for replacement?

  - by resting

  I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

  Read the article

• Is Valid IMAGE_DOS_SIGNATURE

  - by iira

  I want to check a file has a valid IMAGE_DOS_SIGNATURE (MZ) function isMZ(FileName : String) : boolean; var Signature: Word; fexe: TFileStream; begin result:=false; try fexe := TFileStream.Create(FileName, fmOpenRead or fmShareDenyNone); fexe.ReadBuffer(Signature, SizeOf(Signature)); if Signature = $5A4D { 'MZ' } then result:=true; finally fexe.free; end; end; I know I can use some code in Windows unit to check the IMAGE_DOS_SIGNATURE. The problem is I want the fastest way to check IMAGE_DOS_SIGNATURE (for a big file). I need your some suggestion about my code or maybe a new code? Thanks

  Read the article

• Function Pointer from base class

  - by camelord

  Hi there, i need a Function Pointer from a base class. Here is the code: class CActionObjectBase { ... void AddResultStateErrorMessage( const char* pcMessage , ULONG iResultStateCode); ... } CActionObjectCalibration( ): CActionObjectBase() { ... m_Calibration = new CCalibration(&CActionObjectBase::AddResultStateErrorMessage); } class CCalibration { ... CCalibration(void (CActionObjectBase::* AddErrorMessage)(const char*, ULONG )); ... void (CActionObjectBase::* m_AddErrorMessage)(const char*, ULONG ); } Inside CCalibration in a Function occurs the Error. I try to call the Function Pointer like this: if(m_AddErrorMessage) { ... m_AddErrorMessage("bla bla", RSC_FILE_ERROR); } The Problem is, that I cannot compile. The Error Message says something like: error C2064: Expression is no Function, that takes two Arguments. What is wrong? regards camelord

  Read the article

• Numbering Regex Submatches

  - by gentlylisped

  Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

  Read the article

• (type theoretical) How is ([] ==) [] typed in haskell?

  - by Ingo

  It sounds silly, but I can't get it. Why can the expression [] == [] be typed at all? More specifically, which type (in class Eq) is inferred to the type of list elements? In a ghci session, I see the following: Prelude> :t (==[]) (==[]) :: (Eq [a]) => [a] -> Bool But the constraint Eq [a] implies Eq a also, as is shown here: Prelude> (==[]) ([]::[IO ()]) <interactive>:1:1: No instance for (Eq (IO ())) arising from use of `==' at <interactive>:1:1-2 Probable fix: add an instance declaration for (Eq (IO ())) In the definition of `it': it = (== []) ([] :: [IO ()]) Thus, in []==[], the type checker must assume that the list element is some type a that is in class Eq. But which one? The type of [] is just [a], and this is certainly more general than Eq a = [a].

  Read the article

• Perl Regex Multiple Items in Single String

  - by Sho Minamimoto

  I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

  Read the article

• Some unclear PHP syntax

  - by serhio

  I am a PHP beginner and saw on the forum this PHP expression: $regex = <<<'END' / ( [\x00-\x7F] # single-byte sequences 0xxxxxxx | [\xC0-\xDF][\x80-\xBF] # double-byte sequences 110xxxxx 10xxxxxx | [\xE0-\xEF][\x80-\xBF]{2} # triple-byte sequences 1110xxxx 10xxxxxx * 2 | [\xF0-\xF7][\x80-\xBF]{3} # quadruple-byte sequence 11110xxx 10xxxxxx * 3 ) | ( [\x80-\xBF] ) # invalid byte in range 10000000 - 10111111 | ( [\xC0-\xFF] ) # invalid byte in range 11000000 - 11111111 /x END; Is this code correct? What do these strange (for me) constructions like <<<, 'END', /, /x, and END; mean? I recieve: Parse error: syntax error, unexpected T_SL in /home/vhosts/mysite.com/public_html/mypage.php on line X Thanks

  Read the article

• Check for default value of attribute in XPath

  - by iref

  Hi, i have XML schema: <xsd:complexType name="contactsType"> <xsd:sequence> <xsd:element name="contact" type="contactType" minOccurs="0" maxOccurs="unbounded"/> </xsd:sequence> <xsd:attribute name="visible" type="xsd:boolean" default="true"/> </xsd:complexType> and i want to find all contacts which have @visible=true, //contacts[@visible='true'] but this expression doesn' t return nodes without set @visible like this: <contacts /> so i want to know if there is any function in XPath which returns also default values of attributes Thanks Jan

  Read the article

• Using DateDiff in Entity Framwork on a SQL CE database

  - by deverop

  I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

  Read the article

• Does Google App Engine allow creation of files and folders on the server ?

  - by Frank

  I know Google App Engine offers free space, but I wonder if it's for storing data in it's database only or does it also allow me to create files and directories on the server side to store my data ? For instance can I use the following method to save file ? public static void saveFile(String File_Path,StringBuffer Str_Buf,boolean Append) { FileOutputStream fos=null; BufferedOutputStream bos=null; try { fos=new FileOutputStream(File_Path,Append); bos=new BufferedOutputStream(fos); for (int j=0;j<Str_Buf.length();j++) bos.write(Str_Buf.charAt(j)); } catch (Exception e) { e.printStackTrace(); } finally { try { if (bos!=null) { bos.close(); bos=null; } if (fos!=null) { fos.close(); fos=null; } } catch (Exception ex) { ex.printStackTrace(); } } } Frank

  Read the article

• Does AS3 show cacheasbitmap in preview?

  - by Fahim Akhter

  The following code shows me that cacheasbitmap is turning on and off like it is suppose to but, I never get to see it visually like I did in AS2. Is this a error or a change in actionscript? package { import flash.display.Sprite; import flash.events.MouseEvent; public class Bitmapascache extends Sprite { private var isOn:Boolean=false; private var box:mainBox; public function Bitmapascache() { box = new mainBox() box.addEventListener(MouseEvent.MOUSE_DOWN,click); this.addChild(box); } public function click(e:MouseEvent):void { trace("click :"+box.cacheAsBitmap); if(isOn){ box.cacheAsBitmap = false; isOn = false; } else{ box.cacheAsBitmap = true; isOn = true; } } } }

  Read the article

• Copy constructor demo (crashing... case 2)

  - by AKN

  Please have a glance at this program: class CopyCon { public: char *name; CopyCon() { name = new char[20]; name = "Hai";//_tcscpy(name,"Hai"); } CopyCon(const CopyCon &objCopyCon) { name = new char[_tcslen(objCopyCon.name)+1]; _tcscpy(name,objCopyCon.name); } ~CopyCon() { if( name != NULL ) { delete[] name; name = NULL; } } }; int main() { CopyCon obj1; CopyCon obj2(obj1); cout<<obj1.name<<endl; cout<<obj2.name<<endl; } This program crashes on execution. Error: "Expression: _BLOCK_TYPE_IS_VALID(pHead-nBlockUse)" If I assign "Hai" to name using aasignment operator, its crashing. Where as when I use string func _tcscpy to assign "Hai" to name, its working perfectly. Can some one explain why so?

  Read the article

• Complex sound handling (I.E. pitch change while looping)

  - by Matthew

  Hi everyone I've been meaning to learn Java for a while now (I usually keep myself in languages like C and Lua) but buying an android phone seems like an excellent time to start. now after going through the lovely set of tutorials and a while spent buried in source code I'm beginning to get the feel for it so what's my next step? well to dive in with a fully featured application with graphics, sound, sensor use, touch response and a full menu. hmm now there's a slight conundrum since i can continue to use cryptic references to my project or risk telling you what the application is but at the same time its going to make me look like a raving sci-fi nerd so bare with me for the brief... A semi-working sonic screwdriver (oh yes!) my grand idea was to make an animated screwdriver where sliding the controls up and down modulate the frequency and that frequency dictates the sensor data it returns. now I have a semi-working sound system but its pretty poor for what its designed to represent and I just wouldn't be happy producing a sub-par end product whether its my first or not. the problem : sound must begin looping when the user presses down on the control the sound must stop when the user releases the control when moving the control up or down the sound effect must change pitch accordingly if the user doesn't remove there finger before backing out of the application it must plate the casing of there device with gold (Easter egg ;P) now I'm aware of how monolithic the first 3 look and that's why I would really appreciate any help I can get. sorry for how bad this code looks but my general plan is to create the functional components then refine the code later, no good painting the walls if the roofs not finished. here's my user input, he set slide stuff is used in the graphics for the control @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); @Override public boolean onTouchEvent(MotionEvent event) { //motion event for the screwdriver view if(event.getAction() == MotionEvent.ACTION_DOWN) { //make sure the users at least trying to touch the slider if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { //power setup, im using 1.5 to help out the rate on soundpool since it likes 0.5 to 1.5 SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); //just goes into a method which sets a private variable in my sound pool class thing mSonicAudio.setPower(1, SonicPower); //this handles the slides graphics setSlideY ( (int) event.getY() ); //this is from my latest attempt at loop pitch change, look for this in my soundPool class mSonicAudio.startLoopedSound(); } } if(event.getAction() == MotionEvent.ACTION_MOVE) { if (event.getY() > SonicSlideYTop && event.getY() < SonicSlideYBottom) { SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); setSlideY ( (int) event.getY() ); } } if(event.getAction() == MotionEvent.ACTION_UP) { mSonicAudio.stopLoopedSound(); SonicPower = 1.5f - ((event.getY() - SonicSlideYTop) / SonicSlideLength); mSonicAudio.setPower(1, SonicPower); } return true; } and here's where those methods end up in my sound pool class its horribly messy but that's because I've been trying a ton of variants to get this to work, you will also notice that I begin to hard code the index, again I was trying to get the methods to work before making them work well. package com.mattster.sonicscrewdriver; import java.util.HashMap; import android.content.Context; import android.media.AudioManager; import android.media.SoundPool; public class SoundManager { private float mPowerLvl = 1f; private SoundPool mSoundPool; private HashMap mSoundPoolMap; private AudioManager mAudioManager; private Context mContext; private int streamVolume; private int LoopState; private long mLastTime; public SoundManager() { } public void initSounds(Context theContext) { mContext = theContext; mSoundPool = new SoundPool(2, AudioManager.STREAM_MUSIC, 0); mSoundPoolMap = new HashMap<Integer, Integer>(); mAudioManager = (AudioManager)mContext.getSystemService(Context.AUDIO_SERVICE); streamVolume = mAudioManager.getStreamVolume(AudioManager.STREAM_MUSIC); } public void addSound(int index,int SoundID) { mSoundPoolMap.put(1, mSoundPool.load(mContext, SoundID, 1)); } public void playUpdate(int index) { if( LoopState == 1) { long now = System.currentTimeMillis(); if (now > mLastTime) { mSoundPool.play(mSoundPoolMap.get(1), streamVolume, streamVolume, 1, 0, mPowerLvl); mLastTime = System.currentTimeMillis() + 250; } } } public void stopLoopedSound() { LoopState = 0; mSoundPool.setVolume(mSoundPoolMap.get(1), 0, 0); mSoundPool.stop(mSoundPoolMap.get(1)); } public void startLoopedSound() { LoopState = 1; } public void setPower(int index, float mPower) { mPowerLvl = mPower; mSoundPool.setRate(mSoundPoolMap.get(1), mPowerLvl); } } ah ha! I almost forgot, that looks pretty ineffective but I omitted my thread which actuality updates it, nothing fancy it just calls : mSonicAudio.playUpdate(1); thanks in advance, Matthew

  Read the article

• How to disable all hardware keys programatically in android?

  - by Raghu Rami Reddy

  I am developing android application with lock functionality. please suggest me how to disable all the hard keys programatically. here i am using beleow code to disable back button. i want like this functionality for all hard keys like home,search,camera, shortcut keys here is my code: @Override public boolean onKey(View v, int keyCode, KeyEvent event) { if (keyCode == KeyEvent.KEYCODE_SEARCH) { Log.d("KeyPress", "search"); return true; } return false; } Thanks in advance.

  Read the article

• Whats the best way to stop this app crash when buttons rapidly pressed iphone obj-c

  - by dubbeat

  Hi, I'm not entirely sure why this crash is happening and I'd like to get advice on the best way to deal with it. My app has 3 buttons. Each button requests a different XML file from a server which is used to populate a table view. If I rapidly press the buttons in sequence , button 1 button 2 button3 button 1 button 2 button3 button 1 button 2 button3 the application quits. What could be causing this. Would id be in the NSURLRequest side of things or the table view population side? How would you suggest I stop this behaviour? I was going to just set a boolean "isRequesting" to true when a button is pressed and set it to false when the table view is finished populating. If any button is pressed while isRequesting is True they do nothing. Does that sound wise or is there a better way? Thanks, dub

  Read the article

• Adding an overlay to Google maps with path taken

  - by user341652

  Hi, I am trying to write a class to track a person's location(s), and to draw the path they've taken on a MapView. This feature of the program is for the user to track their speed, distance, path, etc. while running/cycling (or whatever else) using their Android phone. This is my first Android application, and I am not sure how to do the Overlay object for the MapView. I also wanted to see if anyone had opinions on the GPS-Tracking part I have written (if it would work, if there is a better way of doing it, code examples would be helpful). I currently have this for my GPSTrackerService: package org.drexel.itrain.logic; import java.util.Vector; import org.drexel.itrain.Constants; import android.app.Notification; import android.app.NotificationManager; import android.app.Service; import android.content.Context; import android.content.Intent; import android.content.SharedPreferences; import android.location.GpsSatellite; import android.location.GpsStatus; import android.location.Location; import android.location.LocationListener; import android.location.LocationManager; import android.location.GpsStatus.Listener; import android.os.Binder; import android.os.Bundle; import android.os.IBinder; import android.preference.PreferenceManager; public class GPSTrackingService extends Service { private static final int MAX_REASONABLE_SPEED = 60; private static final String TAG = "OGT.TrackingService"; private Context mContext; private LocationManager mLocationManager; private NotificationManager mNotificationManager; private Notification mNotification; private int mSatellites = 0; private int mTrackingState = Constants.GPS_TRACKING_UNKNOWN; private float mCurrentSpeed = 0; private float mTotalDistance = 0; private Location mPreviousLocation; private Vector<Location> mTrackedLocations; private LocationListener mLocationListener = null; private Listener mStatusListener = null; private IBinder binder = null; @Override public void onCreate() { super.onCreate(); this.mContext = getApplicationContext(); this.mLocationManager = (LocationManager) this.mContext.getSystemService( Context.LOCATION_SERVICE ); this.mNotificationManager = (NotificationManager) this.mContext.getSystemService( Context.NOTIFICATION_SERVICE ); this.mTrackedLocations = new Vector<Location>(); this.binder = new Binder(); SharedPreferences sharedPreferences = PreferenceManager.getDefaultSharedPreferences(this.mContext); binder = new Binder(); if(mTrackingState != Constants.GPS_TRACKING_UNKNOWN) { createListeners(); } } @Override public void onDestroy() { destroyListeneres(); } @Override public IBinder onBind(Intent intent) { return binder; } @Override public boolean onUnbind(Intent intent) { return true; } public boolean acceptLocation(Location proposedLocation) { if(!(proposedLocation.hasSpeed() || proposedLocation.hasAccuracy())) { return false; } else if(proposedLocation.getSpeed() >= MAX_REASONABLE_SPEED) { return false; } return true; } public void updateNotification() { //TODO Alert that no GPS sattelites are available (or are available) } public void startTracking() { this.mTrackingState = Constants.GPS_TRACKING_STARTED; this.mTotalDistance = 0; this.mCurrentSpeed = 0; this.mTrackedLocations = new Vector<Location>(); this.mPreviousLocation = null; createListeners(); } public void pauseTracking() { this.mTrackingState = Constants.GPS_TRACKING_PAUSED; this.mPreviousLocation = null; this.mCurrentSpeed = 0; } public void resumeTracking() { if(this.mTrackingState == Constants.GPS_TRACKING_STOPPED){ this.startTracking(); } this.mTrackingState = Constants.GPS_TRACKING_STARTED; } public void stopTracking() { this.mTrackingState = Constants.GPS_TRACKING_STOPPED; destroyListeneres(); } private void createListeners() { /** * LocationListener receives locations from */ this.mLocationListener = new LocationListener() { @Override public void onStatusChanged(String provider, int status, Bundle extras) { // TODO Auto-generated method stub } @Override public void onProviderEnabled(String provider) { // TODO Auto-generated method stub } @Override public void onProviderDisabled(String provider) { // TODO Auto-generated method stub } @Override public void onLocationChanged(Location location) { if(mTrackingState == Constants.GPS_TRACKING_STARTED && acceptLocation(location)) { if(mPreviousLocation != null) { //Add the distance between the new location and the previous location mTotalDistance += mPreviousLocation.distanceTo(location); } if(location.hasSpeed()) { mCurrentSpeed = location.getSpeed(); } else { mCurrentSpeed = -1; //-1 means speed N/A } mPreviousLocation = location; mTrackedLocations.add(location); } } }; /** * Receives updates reguarding the GPS Status */ this.mStatusListener = new GpsStatus.Listener() { @Override public synchronized void onGpsStatusChanged(int event) { switch( event ) { case GpsStatus.GPS_EVENT_SATELLITE_STATUS: { GpsStatus status = mLocationManager.getGpsStatus( null ); mSatellites = 0; Iterable<GpsSatellite> list = status.getSatellites(); for( GpsSatellite satellite : list ) { if( satellite.usedInFix() ) { mSatellites++; } } updateNotification(); break; } default: break; } } }; } /** * Destroys the LocationListenere and the GPSStatusListener */ private void destroyListeneres() { this.mLocationListener = null; this.mStatusListener = null; } /** * Gets the total distance traveled by the * * @return the total distance traveled (in meters) */ public float getDistance() { return mTotalDistance; } /** * Gets the current speed of the last good location * * @return the current speed (in meters/second) */ public float getSpeed() { return mCurrentSpeed; } } Any assistance would be much appreciated. This is my group's first Android app, and we are a little pressed for time at the moment. The project is for a class, and is available from SourceForge (currently called iTrain, soon to be renamed). Thanks in Advance, Steve

  Read the article

• Need a .NET Dictionary<string,object> with just a little more functionality.

  - by Ronnie Overby

  I need a dictionary but I also need to store a boolean value about the object in the dictionary. What's the best way for this. Something like Dictonary<string,object,bool> would be ideal, but doesn't exist. My first idea was: public class SomeObject { public object Value { get; set; } public bool Flag { get; set; } } // and then use: Dictionary<string,SomeObject> myDictionary; My 2nd idea was to implement IDictionary and contain two dictionaries within that were manipulated by the implemented methods and property accessors. My 3rd idea was to see what the folks at StackOverflow would do.

  Read the article

• Some help with basic Sound functions in actionscript 3

  - by danwoods

  Hello all. I'm working on a mp3 player and I'm super new at all things flash so there are lots of questions. Currently I'm getting stuck on the track change. My variable declaration look like this: var index:int = -1; var music:Sound = new Sound(new URLRequest("moe2008-05-24d02t02_vbr.mp3")); var sc:SoundChannel; var isPlaying:Boolean = false; and my change track function looks like this: function changeTrack(newTrack){ sc.stop(); isPlaying = false; music = new Sound(new URLRequest(newTrack)); sc = music.play(); isPlaying = true; index++; } Does anyone see any obvious errors??? Thanks

  Read the article

< Previous Page | 208 209 210 211 212 213 214 215 216 217 218 219  | Next Page >