Search Results

Search found 17715 results on 709 pages for 'regular language'.

Page 214/709 | < Previous Page | 210 211 212 213 214 215 216 217 218 219 220 221  | Next Page >

  • Why is "int + string" possible in statically-typed C# but not in dynamically-typed Python?

    - by Salvador Dali
    While studying C# I found it really strange, that dynamically typed Python will rise an error in the following code: i = 5 print i + " " whereas statically typed C# will normally proceed the similar code: int i = 5; Console.Write(i + " "); I would expect other way around (in python I would be able to do this without any casting, but C# would require me to cast int to string or string to int). Just to highlight, I am not asking what language is better, I am curious what was the reason behind implementing the language this way.

    Read the article

  • Inspiration and influence of the else clause of loop statements in Python?

    - by Aristide
    Python offers an optional else clause in loop statements, which is executed if and only if the loop is not terminated by a break. For an interesting discussion about this neglected commodity, see this question. Here, I just wanted to know: if the very concept of this loop-else construct originates from another language (either theoretical or actually implemented), conversely, if it was taken up in any newer language. May be I should ask the former to Guido, but he surely is a too busy guy for such a futile inquiry. ;-)

    Read the article

  • How many hours of use before I need to clean a tape drive?

    - by codeape
    I do backups to a HP Ultrium 2 tape drive (HP StorageWorks Ultrium 448). The drive has a 'Clean' LED that supposedly will light up or blink when the drive needs to be cleaned. The drive has been in use since october 2005, and still the 'Clean' light has never been lit. The drive statistics are: Total hours in use: 1603 Total bytes written: 19.7 TB Total bytes read: 19.3 TB My question is: How many hours of use can I expect before I need to clean the drive? Edit: I have not encountered any errors using the drive. I do restore tests every two months, and every backup is verified. Edit 2: The user manual says: "HP StorageWorks Ultrium tape drives do not require regular cleaning. An Ultrium universal cleaning cartridge should only be used when the orange Clean LED is flashing." Update: It is now May 2010 (4.5 years of use), and the LED is still off, I have not cleaned, backups verify and regular restore tests are done.

    Read the article

  • Why did you decide "against" using Erlang?

    - by Zubair
    Have you actually "tried" (means programmed in, not just read an article on it) Erlang and decided against it for a project? If so, why? Also, if you have opted to go back to your old language, or to use another functional language like F#, Haskell, Clojure, Scala, or something else then this counts too, and state why.

    Read the article

  • C++ code which is slower than its C equivalent?

    - by user997112
    Are there any aspects to the C++ programming language where the code is known to be slower than the equivalent C language? Obviously this would be excluding the OO features like virtual functions and vtable features etc. I am wondering whether, when you are programming in a latency-critical area (and you aren't worried about OO features) whether you could stick with basic C++ or would C be better?

    Read the article

  • How to send HTTP POST request and recieve response?

    - by Maxim Kachurovskiy
    For example, I need to make the following Client C - Server S conversation and get XIMSS.nonce node value: C:GET /ximsslogin/ HTTP/1.1 Host: myserver.com Content-Type: text/xml Content-Length: 42 <XIMSS><listFeatures id="list" /><XIMSS> S:HTTP/1.1 200 OK Content-Length: 231 Connection: keep-alive Content-Type: text/xml;charset=utf-8 Server: CommuniGatePro/5.3 <XIMSS><nonce>2C3E575E5498CE63574D40F18D00C873</nonce><language>german</language><response id="s"/></XIMSS>

    Read the article

  • Do you think Microsoft is finally on the right track with its Windows 7?

    - by Saif Bechan
    It has been a while now since Windows 7 has been released. So far I didn't hear of many major complaints about it. I can remember the time that Windows Vista hist the shelves. There were major complaints from both experts and just regular users. I do a lot of OS installs for just regular users. These are mostly family and friends, and sometimes there are some customers. Up till now I mostly still use Windows XP SP3, because it is stable and most people are familiar with it. I did Vista for some users but they always call me back with all sorts of questions and in the end I had to downgrade them to XP. Do you think it is safe now to recommend Windows 7 as a good operating system? Offcourse their hardware has to support it, but let's say that is the case. If you install Windows 7 a lot for people, what are the complaints about if you get them?

    Read the article

  • Frequent connection drops when playing online games (StarCraft 2, Battlefield 3) and behind NAT - how to diagnose?

    - by Moshev
    I am having some trouble with (I suspect) my wireless router. It's connected to the internet with a regular lan cable and has a static, public IP address. Our two home PCs connect to the router with regular lan cables, plus there's a laptop which connects over wifi. diagram: Internet | | <- isp-supplied cat5 ethernet cable | D-Link D300 ...wifi... laptop / \ / <- cable -> \ PC1 PC2 The PCs and laptop are behind NAT and share the router's public IP. The router is a D-Link D300. PC1 is used for online gaming and I'm experiencing frequent "connection dropped" errors when playing Battlefield 3, StarCraft 2 and the Diablo 3 beta; but not with TeamFortress 2 or the Tribes Ascend beta. The issue goes away when I remove the router and connect PC1 directly to the ISP's cable. I have also tried disconnecting PC2 and the laptop, leaving PC1 as the only machine connected to the router - doesn't help. How can I diagnose what precisely the issue is?

    Read the article

  • hook up resource manager in windows form

    - by peterchen0303
    In Visual Studio 2008, develop legacy windows form (not wpf), I wrote customized resource manager which fetched data from sql server rather than assembly. In windows form, there is property related to language setting. Once I change language, I want to form being updated automatically. Is there any elegant way to hook up my resource manager?

    Read the article

  • Using c# to manipulate Word Documents

    - by gre3ns0ul
    Hi guys. I'm trying to do the next: I have a word document, than contains the languages of a copyrights: English, Portuguese, French, ... initialy all hidden(the text) And in the top of the document i have Checkboxs, 1 for each language, than the objective is when i choose of them the text of the language than i selected apppears (by an handler or something) It's is possible to do that? thanks

    Read the article

  • Defined variables and arrays vs functions in php

    - by Frank Presencia Fandos
    Introduction I have some sort of values that I might want to access several times each page is loaded. I can take two different approaches for accessing them but I'm not sure which one is 'better'. Three already implemented examples are several options for the Language, URI and displaying text that I describe here: Language Right now it is configured in this way: lang() is a function that returns different values depending on the argument. Example: lang("full") returns the current language, "English", while lang() returns the abbreviation of the current language, "en". There are many more options, like lang("select"), lang("selectact"), etc that return different things. The code is too long and irrelevant for the case so if anyone wants it just ask for it. Url The $Url array also returns different values depending on the request. The whole array is fully defined in the beginning of the page and used to get shorter but accurate links of the current page. Example: $Url['full'] would return "http://mypage.org/path/to/file.php?page=1" and $Url['file'] would return "file.php". It's useful for action="" within the forms and many other things. There are more values for $Url['folder'], $Url['file'], etc. Same thing about the code, if wanted, just request it. Text [You can skip this section] There's another array called $Text that is defined in the same way than $Url. The whole array is defined at the beginning, making a mysql call and defining all $Text[$i] for current page with a while loop. I'm not sure if this is more efficient than multiple calls for a single mysql cell. Example: $Text['54'] returns "This is just a test array!" which this could perfectly be implemented with a function like text(54). Question With the 3 examples you can see that I use different methods to do almost the same function (no pun intended), but I'm not sure which one should become the standard one for my code. I could create a function called url() and other called text() to output what I want. I think that working with functions in those cases is better, but I'm not sure why. So I'd really appreciate your opinions and advice. Should I mix arrays and functions in the way I described or should I just use funcions? Please, base your answer in this: The source needs to be readable and reusable by other developers Resource consumption (processing, time and memory). The shorter the code the better. The more you explain the reasons the better. Thank you PS, now I know the differences between $Url and $Uri.

    Read the article

  • NullReferenceException at Microsoft.Silverlight.Build.Tasks.CompileXaml.LoadAssemblies(ITaskItem[] R

    - by Eugene Larchick
    Hi, I updated my Visual Studio 2010 to the version 10.0.30319.1 RTM Rel and start getting the following exception during the build: System.NullReferenceException: Object reference not set to an instance of an object. at Microsoft.Silverlight.Build.Tasks.CompileXaml.LoadAssemblies(ITaskItem[] ReferenceAssemblies) at Microsoft.Silverlight.Build.Tasks.CompileXaml.get_GetXamlSchemaContext() at Microsoft.Silverlight.Build.Tasks.CompileXaml.GenerateCode(ITaskItem item, Boolean isApplication) at Microsoft.Silverlight.Build.Tasks.CompileXaml.Execute() at Bohr.Silverlight.BuildTasks.BohrCompileXaml.Execute() The code of BohrCompileXaml.Execute is the following: public override bool Execute() { List<TaskItem> pages = new List<TaskItem>(); foreach (ITaskItem item in SilverlightPages) { string newFileName = getGeneratedName(item.ItemSpec); String content = File.ReadAllText(item.ItemSpec); String parentClassName = getParentClassName(content); if (null != parentClassName) { content = content.Replace("<UserControl", "<" + parentClassName); content = content.Replace("</UserControl>", "</" + parentClassName + ">"); content = content.Replace("bohr:ParentClass=\"" + parentClassName + "\"", ""); } File.WriteAllText(newFileName, content); pages.Add(new TaskItem(newFileName)); } if (null != SilverlightApplications) { foreach (ITaskItem item in SilverlightApplications) { Log.LogMessage(MessageImportance.High, "Application: " + item.ToString()); } } foreach (ITaskItem item in pages) { Log.LogMessage(MessageImportance.High, "newPage: " + item.ToString()); } CompileXaml xamlCompiler = new CompileXaml(); xamlCompiler.AssemblyName = AssemblyName; xamlCompiler.Language = Language; xamlCompiler.LanguageSourceExtension = LanguageSourceExtension; xamlCompiler.OutputPath = OutputPath; xamlCompiler.ProjectPath = ProjectPath; xamlCompiler.RootNamespace = RootNamespace; xamlCompiler.SilverlightApplications = SilverlightApplications; xamlCompiler.SilverlightPages = pages.ToArray(); xamlCompiler.TargetFrameworkDirectory = TargetFrameworkDirectory; xamlCompiler.TargetFrameworkSDKDirectory = TargetFrameworkSDKDirectory; xamlCompiler.BuildEngine = BuildEngine; bool result = xamlCompiler.Execute(); // HERE we got the error! And the definition of the task: <BohrCompileXaml LanguageSourceExtension="$(DefaultLanguageSourceExtension)" Language="$(Language)" SilverlightPages="@(Page)" SilverlightApplications="@(ApplicationDefinition)" ProjectPath="$(MSBuildProjectFullPath)" RootNamespace="$(RootNamespace)" AssemblyName="$(AssemblyName)" OutputPath="$(IntermediateOutputPath)" TargetFrameworkDirectory="$(TargetFrameworkDirectory)" TargetFrameworkSDKDirectory="$(TargetFrameworkSDKDirectory)" > <Output ItemName="Compile" TaskParameter="GeneratedCodeFiles" /> <!-- Add to the list list of files written. It is used in Microsoft.Common.Targets to clean up for a next clean build --> <Output ItemName="FileWrites" TaskParameter="WrittenFiles" /> <Output ItemName="_GeneratedCodeFiles" TaskParameter="GeneratedCodeFiles" /> </BohrCompileXaml> What can be the reason? And how can I get more info what's happening inside CompileXaml class?

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Interpreter typing in C

    - by typus
    I'm developing an interpreter and I have some questions to it. I recently saw a small C interpreter that used a very simple struct like the below for all its objects/values in the language: struct Object { ubyte type; ubyte value; }; This struct can hold strings, integers, bools and lists (I think) used in the language the interpreter is working with. How can you get this Object struct to hold all these types?

    Read the article

  • Making web server in C with native scripting support

    - by guitar-
    I'm an intermediate C developer, trying to get better. I want to make a very basic and lightweight HTTP server with its own scripting language. Could I use something like Lua for scripting? If not, what? I don't want to use CGI/FastCGI like Apache does for PHP in most cases, I want my server to natively support my scripting language.

    Read the article

  • Switching from PHP to Ruby - is it the answer to performance?

    - by Industrial
    Hi everyone, I get more often the answer, when asking performance related stuff regarding PHP applications, that PHP really isn't the language for high-performance applications, and that a compiled language really is the way to go. The only thing holding me back to PHP is that it's what I have learned to work with for some while now and the development is quite rapid. So, is PHP a thing of the past and should be put aside in web applications in favour of Ruby, for instance? Thanks

    Read the article

  • Where can I find Python tutorials aimed at people who are already programmers?

    - by Chris R
    I'm a reasonably skilled programmer, and I'm interested in branching out into some new languages -- python, specifically -- but frankly I do NOT want to go through a tutorial that assumes I know nothing about programming. I want a tutorial -- again, preferably for python -- that assumes I'm just unfamiliar with the language itself and describes the ways I can use the language to solve problems. Does such a beast exist? I mean, other than the Python wiki?

    Read the article

  • Ideas for a TLA+ project

    - by luvieere
    Please give me some suggestions regarding a project topic in the TLA+ language. I'm taking a course on the language, it's the first year I'm learning about specification and verification and I have no clue what to choose to implement in two weeks time. Any ideas?

    Read the article

  • Lots of bugs in SourceForge, maybe?

    - by Delirium tremens
    http://sourceforge.net/develop/ - Project Finder - Programming Language - Python ( * 16596 * ) - even so, All Anys - Go - Programming Language - Python ( * 11,847 * ) - Desktop ( * 572 * ) - All Desktop Categories (7 + 1 + 67 + 35 + 286 = * 396 * ) Does anybody know what is going on there?

    Read the article

  • custom google image bug?

    - by serhio
    Somethimes, google has custom images like this: but I observed that if I set the Google in an other language that the domain one it does not show the custom image. By e.g. I am in France (=google.fr) I set the language from French = English. And see the usual google picture, but not the custom one...

    Read the article

  • Framework Question

    - by Johhny
    I need a language and web framework that is really easy to use, that only has 12 or so commands, that is in one language all the way through (front/middle/back) and takes 15 minutes to master. Something like this: 10 CreateWEBFormAndCreateRequiredDBTablesAndSaveToDatabase("First Name", "Last Name") 20 CreateWEBPageThankingUser() 30 MakeAllWEBPagesPrettyByExaminingWebSitesOnTheInterWebAndMakingADecision() 40 GOTO 10 Oh, and it has to be written in C#

    Read the article

  • Calling a C function in a pro*C file

    - by Sachin Chourasiya
    I have these line in my pro*C program. The function initAerage is defined in a C language and I am trying to call this function in a .pcc (pro C++) file. I am getting an error Error: initAverage(int i);was declared before with a different language extern "C" { int initAverage(int i); } Please help

    Read the article

< Previous Page | 210 211 212 213 214 215 216 217 218 219 220 221  | Next Page >