Search Results

Search found 1821 results on 73 pages for 'inline formset'.

Page 23/73 | < Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • to change the style of div

    - by ramyatk06
    hi guys, I have 2 buttons and 2 divs div1 and div2.On click button1 div1 is made visible and div2 invisible,On clicking button2 div2 is made visible and div1 is invisible. For that i used javascript. function showdiv2() { document.getElementById("div2").style.visibility="visible"; document.getElementById("div2").style.display="inline"; document.getElementById("div1").style.visibility="hidden"; document.getElementById("div1").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } function showdiv1() { document.getElementById("div1").style.visibility="visible"; document.getElementById("div1").style.display="inline"; document.getElementById("div2").style.visibility="hidden"; document.getElementById("div2").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } In div2 i have a gridview in which i have a linkbutton named lnkDelete.In its click control is going to div1.In click of lnkDelete,i want to make div1 invisible,but on clicking button1 div1 should be visible.Can anybody help to make div1 invisible in clickevent of lnkDelete in codebehind?

    Read the article

  • Why would the assignment operator ever do something different than its matching constructor?

    - by Neil G
    I was reading some boost code, and came across this: inline sparse_vector &assign_temporary(sparse_vector &v) { swap(v); return *this; } template<class AE> inline sparse_vector &operator=(const sparse_vector<AE> &ae) { self_type temporary(ae); return assign_temporary(temporary); } It seems to be mapping all of the constructors to assignment operators. Great. But why did C++ ever opt to make them do different things? All I can think of is scoped_ptr?

    Read the article

  • How to achieve table like rows within container using CSS

    - by Barry
    I'm helping an artist maintain her website and have inherited some pretty outdated code. Have moved lots of redundant common code to include files and am now working on moving from inline styles to more CSS-driven styles. For the gallery pages, e.g. http://artistsatlaketahoe.com/abstract.html, a lot of inline styling is used to force the current layout. My preference would be to replace this entirely with CSS that presents the following table-like layout within the "content" div: [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] I'd like to middle-align the image descriptives & purchase button relative to the image if possible. And then apply some padding above and below each row to stop using tags for vertical spacing. Any ideas how to create a div that I can use to get this kind of layout? Thanks!

    Read the article

  • Endianness conversion and g++ warnings

    - by SuperBloup
    I've got the following C++ code : template <int isBigEndian, typename val> struct EndiannessConv { inline static val fromLittleEndianToHost( val v ) { union { val outVal __attribute__ ((used)); uint8_t bytes[ sizeof( val ) ] __attribute__ ((used)); } ; outVal = v; std::reverse( &bytes[0], &bytes[ sizeof(val) ] ); return outVal; } inline static void convertArray( val v[], uint32_t size ) { // TODO : find a way to map the array for (uint32_t i = 0; i < size; i++) for (uint32_t i = 0; i < size; i++) v[i] = fromLittleEndianToHost( v[i] ); } }; Which work and has been tested (without the used attributes). When compiling I obtain the following errors from g++ (version 4.4.1) || g++ -Wall -Wextra -O3 -o t t.cc || t.cc: In static member function 'static val EndiannessConv<isBigEndian, val>::fromLittleEndianToHost(val)': t.cc|98| warning: 'used' attribute ignored t.cc|99| warning: 'used' attribute ignored || t.cc: In static member function 'static val EndiannessConv<isBigEndian, val>::fromLittleEndianToHost(val) [with int isBigEndian = 1, val = double]': t.cc|148| instantiated from here t.cc|100| warning: unused variable 'outVal' t.cc|100| warning: unused variable 'bytes' I've tried to use the following code : template <int size, typename valType> struct EndianInverser { /* should not compile */ }; template <typename valType> struct EndianInverser<4, valType> { static inline valType reverseEndianness( const valType &val ) { uint32_t castedVal = *reinterpret_cast<const uint32_t*>( &val ); castedVal = (castedVal & 0x000000FF << (3 * 8)) | (castedVal & 0x0000FF00 << (1 * 8)) | (castedVal & 0x00FF0000 >> (1 * 8)) | (castedVal & 0xFF000000 >> (3 * 8)); return *reinterpret_cast<valType*>( &castedVal ); } }; but it break when enabling optimizations due to the type punning. So, why does my used attribute got ignored? Is there a workaround to convert endianness (I rely on the enum to avoid type punning) in templates?

    Read the article

  • How to preserve sibling element position when one sibling is absolutely positioned?

    - by Casey
    In the snippet below, the child div is normally positioned until it is :hovered , when it becomes absolutely positioned. The reasoning behind this markup is to simulate a popup style in a limited environment where I can't use a <select> (among other limitations). When child is hovered, the sibling elements jump around, which is expected, as the contents of the block have changed. But how can I preserve their positioning? That is, what CSS can I add to prevent the siblings from jumping around when child is hovered. Javascript is also not allowed, so please no answers using JS. HTML: <div class="container"> <div class="child"> <span class="d4"></span> <label><input type="radio" name="radio" value="1"/>One</label> <label><input type="radio" name="radio" value="2"/>Two</label> </div> <input type="text" name="sibling"/> <button name="sibling2">Button</button> </div> CSS: .container, .child, button { display:inline-block; } .child { vertical-align: middle; width: 35px; height: 35px; } .child:hover { background: gray; position:absolute; width: 100px; height: auto; } .child:hover > .d4 { display: none; } .child label { display:none; } .child:hover label { display: inline-block; } .d4 { background-position: -411px -1px; width: 35px; height: 35px; background-image: url("https://i.imgur.com/zkgyBOi.png"); background-repeat: no-repeat; color: transparent; display: inline-block; } Here's a fiddle: http://jsfiddle.net/cpctZ/1/

    Read the article

  • I'm new to C++. Please Help me with the Linked List (What functions to add)?

    - by Igal
    DEAR All; Hi, I'm just beginner to C++; Please help me to understand: What functions should be in the Linked list class ? I think there should be overloaded operators << and ; Please help me to improve the code (style, errors, etc,) Thanks for advance. Igal. Please review the small code for the integer List (enclosed MyNODE.h and ListDriver1.cpp); MyNODE.h // This is my first attempt to write linked list. Igal Spector, June 2010. #include <iostream.h> #include <assert.h> //Forward Declaration of the classes: class ListNode; class TheLinkedlist; // Definition of the node (WITH IMPLEMENTATION !!!, without test drive): class ListNode{ friend class TheLinkedlist; public: // constructor: ListNode(const int& value, ListNode *next= 0); // note: no destructor, as this handled by TheLinkedList class. // accessor: return data in the node. // int Show() const {return theData;} private: int theData; //the Data ListNode* theNext; //points to the next node in the list. }; //Implementations: //constructor: inline ListNode::ListNode(const int &value,ListNode *next) :theData(value),theNext(next){} //end of ListNode class, now for the LL class: class TheLinkedlist { public: //constructors: TheLinkedlist(); virtual ~TheLinkedlist(); // Accessors: void InsertAtFront(const &); void AppendAtBack(const &); // void InOrderInsert(const &); bool IsEmpty()const;//predicate function void Print() const; private: ListNode * Head; //pointer to first node ListNode * Tail; //pointer to last node. }; //Implementation: //Default constructor inline TheLinkedlist::TheLinkedlist():Head(0),Tail(0) {} //Destructor inline TheLinkedlist::~TheLinkedlist(){ if(!IsEmpty()){ //list is not empty cout<<"\n\tDestroying Nodes"<<endl; ListNode *currentPointer=Head, *tempPtr; while(currentPointer != 0){ //Delete remaining Nodes. tempPtr=currentPointer; cout<<"The node: "<<tempPtr->theData <<" is Destroyed."<<endl<<endl; currentPointer=currentPointer->theNext; delete tempPtr; } Head=Tail = 0; //don't forget this, as it may be checked one day. } } //Insert the Node to the beginning of the list: void TheLinkedlist::InsertAtFront(const int& value){ ListNode *newPtr = new ListNode(value,Head); assert(newPtr!=0); if(IsEmpty()) //list is empty Head = Tail = newPtr; else { //list is NOT empty newPtr->theNext = Head; Head = newPtr; } } //Insert the Node to the beginning of the list: void TheLinkedlist::AppendAtBack(const int& value){ ListNode *newPtr = new ListNode(value, NULL); assert(newPtr!=0); if(IsEmpty()) //list is empty Head = Tail = newPtr; else { //list is NOT empty Tail->theNext = newPtr; Tail = newPtr; } } //is the list empty? inline bool TheLinkedlist::IsEmpty() const { return (Head == 0); } // Display the contents of the list void TheLinkedlist::Print()const{ if ( IsEmpty() ){ cout << "\n\t The list is empty!!"<<endl; return; } ListNode *tempPTR = Head; cout<<"\n\t The List is: "; while ( tempPTR != 0 ){ cout<< tempPTR->theData <<" "; tempPTR = tempPTR->theNext; } cout<<endl<<endl; } ////////////////////////////////////// The test Driver: //Driver test for integer Linked List. #include <iostream.h> #include "MyNODE.h" // main Driver int main(){ cout<< "\n\t This is the test for integer LinkedList."<<endl; const int arraySize=11, ARRAY[arraySize]={44,77,88,99,11,2,22,204,50,58,12}; cout << "\n\tThe array is: "; //print the numbers. for (int i=0;i<arraySize; i++) cout<<ARRAY[i]<<", "; TheLinkedlist list; //declare the list for(int index=0;index<arraySize;index++) list.AppendAtBack( ARRAY[index] );//create the list cout<<endl<<endl; list.Print(); //print the list return 0; //end of the program. }

    Read the article

  • Lining up Divs, while using JQuery

    - by user630581
    I am trying to create a flash header like element in JQuery, that has three images that fade to other images. I have each group of images in a div, but the divs line up vertically down the page, I want them to line up horizontally in a row. Currently my css code is: div#demos{ width:940px; border:0; } .s1{ float:left; display:inline; background-color:#000000; width:225px; margin:0; } .s2{ float:right; display:inline; background-color:#000000; width:225px; margin:0; } .s3{ float:left; display:inline; background-color:#000000; width:225px; margin:0; } and my markup is: <div id="demos"> <div id="s1" class="pics"> <img src="Image1.jpeg" width="200" height="200" /> <img src="Image2.jpeg" width="200" height="200" /> <img src="Image3.jpeg" width="200" height="200" /> </div> <div id="s2" class="pics"> <img src="Image4.jpeg" width="200" height="200" /> <img src="Image5.jpeg" width="200" height="200" /> <img src="Image6.jpeg" width="200" height="200" /> </div> <div id="s3" class="pics"> <img src="Image7.jpeg" width="200" height="200" /> <img src="Image8.jpeg" width="200" height="200" /> <img src="Image9.jpeg" width="200" height="200" /> </div> <div style="clear:both"></div> </div>

    Read the article

  • Applying styles for custom TextArea in ActionScript 3

    - by Vijay Dev
    I have the following code to create and apply a few styles for a custom TextArea in ActionScript 3. public class MyCustomTextArea extends TextArea { override protected function createChildren():void { super.createChildren(); this.styleSheet.setStyle("sup", { display: "inline", fontFamily: "ArialSup", fontSize:"12"}); this.styleSheet.setStyle("sub", { display: "inline", fontFamily: "ArialSub", fontSize:"12"}); this.setStyle("fontFamily", "Arial"); } } I have two problems with this code. this.styleSheet is always null when I create an instance of the class. If this.styleSheet is initialized to new StyleSheet() to avoid this issue, then the TextArea instance does not seem to recognize any of the HTML tags that can be used with the htmlText property. Can anyone help in fixing these two issues? Thanks.

    Read the article

  • How to make negate_unary work with any type?

    - by Chan
    Hi, Following this question: How to negate a predicate function using operator ! in C++? I want to create an operator ! can work with any functor that inherited from unary_function. I tried: template<typename T> inline std::unary_negate<T> operator !( const T& pred ) { return std::not1( pred ); } The compiler complained: Error 5 error C2955: 'std::unary_function' : use of class template requires template argument list c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 223 1 Graphic Error 7 error C2451: conditional expression of type 'std::unary_negate<_Fn1>' is illegal c:\program files\microsoft visual studio 10.0\vc\include\ostream 529 1 Graphic Error 3 error C2146: syntax error : missing ',' before identifier 'argument_type' c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 222 1 Graphic Error 4 error C2065: 'argument_type' : undeclared identifier c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 222 1 Graphic Error 2 error C2039: 'argument_type' : is not a member of 'std::basic_ostream<_Elem,_Traits>::sentry' c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 222 1 Graphic Error 6 error C2039: 'argument_type' : is not a member of 'std::basic_ostream<_Elem,_Traits>::sentry' c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 230 1 Graphic Any idea? Update Follow "templatetypedef" solution, I got new error: Error 3 error C2831: 'operator !' cannot have default parameters c:\visual studio 2010 projects\graphic\graphic\main.cpp 39 1 Graphic Error 2 error C2808: unary 'operator !' has too many formal parameters c:\visual studio 2010 projects\graphic\graphic\main.cpp 39 1 Graphic Error 4 error C2675: unary '!' : 'is_prime' does not define this operator or a conversion to a type acceptable to the predefined operator c:\visual studio 2010 projects\graphic\graphic\main.cpp 52 1 Graphic Update 1 Complete code: #include <iostream> #include <functional> #include <utility> #include <cmath> #include <algorithm> #include <iterator> #include <string> #include <boost/assign.hpp> #include <boost/assign/std/vector.hpp> #include <boost/assign/std/map.hpp> #include <boost/assign/std/set.hpp> #include <boost/assign/std/list.hpp> #include <boost/assign/std/stack.hpp> #include <boost/assign/std/deque.hpp> struct is_prime : std::unary_function<int, bool> { bool operator()( int n ) const { if( n < 2 ) return 0; if( n == 2 || n == 3 ) return 1; if( n % 2 == 0 || n % 3 == 0 ) return 0; int upper_bound = std::sqrt( static_cast<double>( n ) ); for( int pf = 5, step = 2; pf <= upper_bound; ) { if( n % pf == 0 ) return 0; pf += step; step = 6 - step; } return 1; } }; /* template<typename T> inline std::unary_negate<T> operator !( const T& pred, typename T::argument_type* dummy = 0 ) { return std::not1<T>( pred ); } */ inline std::unary_negate<is_prime> operator !( const is_prime& pred ) { return std::not1( pred ); } template<typename T> inline void print_con( const T& con, const std::string& ms = "", const std::string& sep = ", " ) { std::cout << ms << '\n'; std::copy( con.begin(), con.end(), std::ostream_iterator<typename T::value_type>( std::cout, sep.c_str() ) ); std::cout << "\n\n"; } int main() { using namespace boost::assign; std::vector<int> nums; nums += 1, 3, 5, 7, 9; nums.erase( remove_if( nums.begin(), nums.end(), !is_prime() ), nums.end() ); print_con( nums, "After remove all primes" ); } Thanks, Chan Nguyen

    Read the article

  • strange results with /fp:fast

    - by martinus
    We have some code that looks like this: inline int calc_something(double x) { if (x > 0.0) { // do something return 1; } else { // do something else return 0; } } Unfortunately, when using the flag /fp:fast, we get calc_something(0)==1 so we are clearly taking the wrong code path. This only happens when we use the method at multiple points in our code with different parameters, so I think there is some fishy optimization going on here from the compiler (Microsoft Visual Studio 2008, SP1). Also, the above problem goes away when we change the interface to inline int calc_something(const double& x) { But I have no idea why this fixes the strange behaviour. Can anyone explane this behaviour? If I cannot understand what's going on we will have to remove the /fp:fastswitch, but this would make our application quite a bit slower.

    Read the article

  • Pylons and Pisa (xhtml2pdf): blank page in IE

    - by Utaal
    I'm using pylons to serve a dynamically generated pdf document for reporting: my approach works in firefox & chrome (it displays the pdf inline if the plugin is available or otherwise downloads it) but IE (7 & 8) only show a blank page and doesn't prompt for download. IE correctly shows PDFs generated by other websites, though. Don't know if it matters but the page is accessed through HTTPS. My controller does the following: renders the source page through mako converts the html to pdf using pisa adds these headers to the response: Content-type: application/pdf and Content-disposition: inline; filename=file.pdf Do you have any suggestion? I seem to be stuck and cannot think of anything else to try.

    Read the article

  • Is calling of overload operator-> resolved at compile time?

    - by Brent
    when I tried to compile the code: (note: func and func2 is not typo) struct S { void func2() {} }; class O { public: inline S* operator->() const; private: S* ses; }; inline S* O::operator->() const { return ses; } int main() { O object; object->func(); return 0; } there is a compile error reported: D:\code>g++ operatorp.cpp -S -o operatorp.exe operatorp.cpp: In function `int main()': operatorp.cpp:27: error: 'struct S' has no member named 'func' it seems that invoke the overloaded function of "operator-" is done during compile time? I'd added "-S" option for compile only.

    Read the article

  • How do I get my text to be direction from right to left without using a p tag?

    - by smfoote
    I have a dynamically appearing div on a page. I would like to be able to hide the div with a button at the top right corner of the div. One way I have found to do this is to use a p tag, like so: <p dir="RTL">button</p> If this is the first line of HTML within the div, it will put the button in the upper right hand corner of the div. However, it gives me a new line above and a new line below, so, the button isn't really where I want it to be. The "dir" attribute doesn't seem to work with a span tag, and if I display the p tag inline using css p { display:inline; } the button is no longer right aligned. Instead it stays in the left hand corner. Is there a way to get this button in the upper right hand corner without two unnecessary new lines and without a bunch of  ?

    Read the article

  • how can I get jquery.sIFR plugin to display sIFR-alternate text for print?

    - by apeBoy
    I'm struggling with this. I've used the jquery sIFR plugin as opposed to sIFR it prevented conflicts with other jquery I am using on my pages. It works fine in its prime function: replacing html text with Flash. However, the .sIFR-alternate class is given an inline style of 'opacity: 0' which persists when flashblock is on. So alternate text does not appear. Neither does it appear when printng the page (yes I have included styles for sIFR-print). I've tried replacing the opacity:0 inline style with display: none but this causes height issues with the output flash. Any one else had this or have any ideas?

    Read the article

  • How do I bind a click to an anchor without a framework (javascript)

    - by Stomped
    I know this is easily done in jQuery or any other framework, but that's not really the point. How do I go about 'properly' binding a click event in pure javascript? I know how to do it inline (I know this is terrible) <a href="doc.html" onclick="myFunc(); return false">click here</a> and this causes my javascript to execute for a JS enabled browser, and the link to behave normally for those without javascript? Now, how do I do the same thing in a non-inline manner?

    Read the article

  • Rails: Generic form actions, cancel link losing `:back` on validation failure

    - by Patrick Connor
    I am trying to create a generic set of Submit, Cancel, and Destroy actions for forms. At this point, it appears that everything is working, except that I lose :back functionality then a form reloads due to validation errors. Is there a way to catch the fact that validation has failed, and in that case, keep the request.env['HTTP_REFERER'] or :back value the same without having to edit every controller? = simple_form_for @announcement do |f| = f.error_notification = f.input :message = f.input :starts_at = f.input :ends_at #submit = f.button :submit = "or " = link_to("cancel", url_for(:back)) .right - if !f.object.new_record? - resource = (f.object.class.name).downcase = link_to "destroy", url_for(:action => 'destroy'), :confirm => "Are you sure that you want to delete this #{resource}?", :method => :delete .clear .non_input #post_back_msg #indicator.inline = image_tag "indicator.gif" .inline = "Please wait..." .non_input

    Read the article

  • Do validations still fire in ASP.NET even if the controls are hidden?

    - by Josh
    I have a form that uses ASP.NET validations. I am using some inline C# in the aspx to show/hide certain controls depending on a user's role. I would use the Visible property, but there are so many of them, I just decided to do inline C# to show and hide (I know, not best practice, but bear with me for a second). I am having an issue where Page.IsValid is always set to False when I submit my form (when certain fields are being hidden). Will the validations still fire off even if the controls are not even rendered on the pag? Also, if this is not the case, is there an effective way of breaking down Page.IsValid to find out what is setting it to False? Thanks.

    Read the article

  • Pretty photo ibox doesn't trigger after appending new element in HTML

    - by user1469133
    I'm trying to get prettyPhoto or some other jquery plugin to work after I append new element to the HTML page: to be specific I have this: $(document).ready(function() { $(window).scroll(function() { if($(window).scroll) { $('div#loadMoreComments').show(); $.ajax({ type : "POST", url : "getvariables.php", dataType: "json", data : { webid: $(".posts:last").attr('id') } }).done(function( msg ) { jQuery.each(msg , function(index, value){ $("#posts").append(value); }); // $("#posts").append(msg); $('div#loadmore').hide(); }); } }); }); Then I have something like this that has to trigger the popup <p><a href="#inline-1" rel="ibox">Trigger popup.</a></p> <div id="inline-1" style="display: none;"> Content to show up after the link is triggered </div> Will appreciate any help over this. Thanks.

    Read the article

< Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >