Search Results

Search found 1903 results on 77 pages for 'inline verbatim'.

Page 23/77 | < Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >

  • Turn off enclosing <p> tags in CKEditor 3.0

    - by Kosi2801
    Is there a possibility to turn off the automatic enclosing of all written content within <p></p> in CKEditor 3.x? I tried CKEDITOR.config.enterMode = CKEDITOR.ENTER_BR; but this just changes the inline linebreaks to <br /> while leaving the enclosing paragraph. Currently writing "Test" produces this output <p> Test</p> but I want it to be simply Test Is there a configuration property for this or would another inline editor to be better suited for this?

    Read the article

  • JQGrid and JQuery Autocomplete

    - by Neff
    When implementing JQGrid 4.3.0, Jquery 1.6.2, and JQuery UI 1.8.16 Ive come across an issue with the Inline edit. When the inline edit is activated, some of the elements get assigned an auto complete. When the inline edit is canceld or saved, the auto complete does not always go away (selecting text by double clicking it then hitting delete, then hitting escape to exit row edit). Leaving the auto complete controls in edit mode when the row is no longer considered in edit mode. Perhaps you can tell me if there is a problem with the initialization or if I you are aware of an event post-"afterrestorefunc" that the fields can be returned to their "original" state. Original state being displayed as data in the JQGrid row. I've tried removing the DOM after row close, .remove() and .empty(): ... "afterrestorefunc": function(){ $('.ui-autocomplete-input').remove(); } ... but that causes other issues, such as the jqgrid is not able to find the cell when serializing the row for data or edit, and requires a refresh of the page, not just jqgrid, to be able to once again see the data from that row. Auto complete functionality for the element is created on the double click of the row: function CreateCustomSearchElement(value, options, selectiontype) { ... var el; el = document.createElement("input"); ... $(el).autocomplete({ source: function (request, response) { $.ajax({ url: '<%=ResolveUrl("~/Services/AutoCompleteService.asmx/GetAutoCompleteResponse") %>', data: "{ 'prefixText': '" + request.term + "', 'contextKey': '" + options.name + "'}", dataType: "json", type: "POST", contentType: "application/json; charset=utf-8", success: function (data) { response($.map(data.d, function (item) { return { label: Trim(item), value: Trim(item), searchVal: Trim(item) } })) } }); }, select: function (e, item) { //Select is on the event of selection where the value and label have already been determined. }, minLength: 1, change: function (event, ui) { //if the active element was not the search button //... } }).keyup(function (e) { if (e.keyCode == 8 || e.keyCode == 46) { //If the user hits backspace or delete, check the value of the textbox before setting the searchValue //... } }).keydown(function (e) { //if keycode is enter key and there is a value, you need to validate the data through select or change(onblur) if (e.keyCode == '13' && ($(el).val())) { return false; } if (e.keyCode == '220') { return false } }); } Other Sources: http://www.trirand.com/jqgridwiki/doku.php?id=wiki:inline_editing http://api.jqueryui.com/autocomplete/ Update: I tried only creating the autocomplete when the element was focused, and removing it when onblur. That did not resolve the issue either. It seems to just need the autocomplete dropdown to be triggered.

    Read the article

  • pure-specifier on function-definition

    - by bebul
    While compiling on GCC I get the error: pure-specifier on function-definition, but not when I compile the same code using VS2005. class Dummy { //error: pure-specifier on function-definition, VS2005 compiles virtual void Process() = 0 {}; }; But when the definition of this pure virtual function is not inline, it works: class Dummy { virtual void Process() = 0; }; void Dummy::Process() {} //compiles on both GCC and VS2005 What does the error means? Why cannot I do it inline? Is it legal to evade the compile issue as shown in the second code sample?

    Read the article

  • JQuery .html() method and external scripts

    - by Marco
    Hi, i'm loading, using the JQuery ajax() method, an external page with both html and javascript code: <script type="text/javascript" src="myfile.js"></script> <p>This is some HTML</p> <script type="text/javascript"> alert("This is inline JS"); </script> and setting the results into a div element, using the html() method. While the html() method properly evaluates the inline JS code, it doesn't download and evaluate the external JS file "myfile.js". Any tip for this issue?

    Read the article

  • Wordpress css and ie6

    - by marc-andre menard
    my website : http://www.equipe94.com have a two column layout and in ie6 the right column is flushed at the button... it look like and inline problem, but even WITH the inline widget.. it's still at the bottom.. any idea to fix a wordpress template to play well with ie6 ? thanks in advance n.b. As mentioned in the comment... my page don't validate... after fixing the multiples problems now I validate in XHTML 1.0 Strict... but the problem is still there !

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Does changing the order of class private data members breaks ABI

    - by Dmitry Yudakov
    I have a class with number of private data members (some of them static), accessed by virtual and non-virtual member functions. There's no inline functions and no friend classes. class A { int number; string str; static const int static_const_number; public: // got virtual and non-virtual functions, working with these memebers virtual void func1(); void func2(); // no inline functions or friends }; Does changing the order of private data members breaks ABI in this case? class A { string str; static const int static_const_number; int number; // <-- integer member moved here ... };

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • Filezilla won't connect to my server!

    - by Reece
    Hey guys! I'm awful with computers! I'm trying to use Filezilla to connect to my server. When I do this, this is the message it give me verbatim: Protocol error: Unknown protocol identifier (0x50 0x50 0x48). Most likely connected to the wrong port. Connection to server closed. but it's not the wrong port!... what am I doing wrong?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • to change the style of div

    - by ramyatk06
    hi guys, I have 2 buttons and 2 divs div1 and div2.On click button1 div1 is made visible and div2 invisible,On clicking button2 div2 is made visible and div1 is invisible. For that i used javascript. function showdiv2() { document.getElementById("div2").style.visibility="visible"; document.getElementById("div2").style.display="inline"; document.getElementById("div1").style.visibility="hidden"; document.getElementById("div1").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } function showdiv1() { document.getElementById("div1").style.visibility="visible"; document.getElementById("div1").style.display="inline"; document.getElementById("div2").style.visibility="hidden"; document.getElementById("div2").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } In div2 i have a gridview in which i have a linkbutton named lnkDelete.In its click control is going to div1.In click of lnkDelete,i want to make div1 invisible,but on clicking button1 div1 should be visible.Can anybody help to make div1 invisible in clickevent of lnkDelete in codebehind?

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • Why would the assignment operator ever do something different than its matching constructor?

    - by Neil G
    I was reading some boost code, and came across this: inline sparse_vector &assign_temporary(sparse_vector &v) { swap(v); return *this; } template<class AE> inline sparse_vector &operator=(const sparse_vector<AE> &ae) { self_type temporary(ae); return assign_temporary(temporary); } It seems to be mapping all of the constructors to assignment operators. Great. But why did C++ ever opt to make them do different things? All I can think of is scoped_ptr?

    Read the article

  • How to achieve table like rows within container using CSS

    - by Barry
    I'm helping an artist maintain her website and have inherited some pretty outdated code. Have moved lots of redundant common code to include files and am now working on moving from inline styles to more CSS-driven styles. For the gallery pages, e.g. http://artistsatlaketahoe.com/abstract.html, a lot of inline styling is used to force the current layout. My preference would be to replace this entirely with CSS that presents the following table-like layout within the "content" div: [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] I'd like to middle-align the image descriptives & purchase button relative to the image if possible. And then apply some padding above and below each row to stop using tags for vertical spacing. Any ideas how to create a div that I can use to get this kind of layout? Thanks!

    Read the article

  • How to preserve sibling element position when one sibling is absolutely positioned?

    - by Casey
    In the snippet below, the child div is normally positioned until it is :hovered , when it becomes absolutely positioned. The reasoning behind this markup is to simulate a popup style in a limited environment where I can't use a <select> (among other limitations). When child is hovered, the sibling elements jump around, which is expected, as the contents of the block have changed. But how can I preserve their positioning? That is, what CSS can I add to prevent the siblings from jumping around when child is hovered. Javascript is also not allowed, so please no answers using JS. HTML: <div class="container"> <div class="child"> <span class="d4"></span> <label><input type="radio" name="radio" value="1"/>One</label> <label><input type="radio" name="radio" value="2"/>Two</label> </div> <input type="text" name="sibling"/> <button name="sibling2">Button</button> </div> CSS: .container, .child, button { display:inline-block; } .child { vertical-align: middle; width: 35px; height: 35px; } .child:hover { background: gray; position:absolute; width: 100px; height: auto; } .child:hover > .d4 { display: none; } .child label { display:none; } .child:hover label { display: inline-block; } .d4 { background-position: -411px -1px; width: 35px; height: 35px; background-image: url("https://i.imgur.com/zkgyBOi.png"); background-repeat: no-repeat; color: transparent; display: inline-block; } Here's a fiddle: http://jsfiddle.net/cpctZ/1/

    Read the article

  • Endianness conversion and g++ warnings

    - by SuperBloup
    I've got the following C++ code : template <int isBigEndian, typename val> struct EndiannessConv { inline static val fromLittleEndianToHost( val v ) { union { val outVal __attribute__ ((used)); uint8_t bytes[ sizeof( val ) ] __attribute__ ((used)); } ; outVal = v; std::reverse( &bytes[0], &bytes[ sizeof(val) ] ); return outVal; } inline static void convertArray( val v[], uint32_t size ) { // TODO : find a way to map the array for (uint32_t i = 0; i < size; i++) for (uint32_t i = 0; i < size; i++) v[i] = fromLittleEndianToHost( v[i] ); } }; Which work and has been tested (without the used attributes). When compiling I obtain the following errors from g++ (version 4.4.1) || g++ -Wall -Wextra -O3 -o t t.cc || t.cc: In static member function 'static val EndiannessConv<isBigEndian, val>::fromLittleEndianToHost(val)': t.cc|98| warning: 'used' attribute ignored t.cc|99| warning: 'used' attribute ignored || t.cc: In static member function 'static val EndiannessConv<isBigEndian, val>::fromLittleEndianToHost(val) [with int isBigEndian = 1, val = double]': t.cc|148| instantiated from here t.cc|100| warning: unused variable 'outVal' t.cc|100| warning: unused variable 'bytes' I've tried to use the following code : template <int size, typename valType> struct EndianInverser { /* should not compile */ }; template <typename valType> struct EndianInverser<4, valType> { static inline valType reverseEndianness( const valType &val ) { uint32_t castedVal = *reinterpret_cast<const uint32_t*>( &val ); castedVal = (castedVal & 0x000000FF << (3 * 8)) | (castedVal & 0x0000FF00 << (1 * 8)) | (castedVal & 0x00FF0000 >> (1 * 8)) | (castedVal & 0xFF000000 >> (3 * 8)); return *reinterpret_cast<valType*>( &castedVal ); } }; but it break when enabling optimizations due to the type punning. So, why does my used attribute got ignored? Is there a workaround to convert endianness (I rely on the enum to avoid type punning) in templates?

    Read the article

  • Interpolation not working on Rails generator

    - by Tom
    For some reason the code I have included below does not interpolate the variables into the template. It simply copies the file over verbatim. I cannot figure out why. https://gist.github.com/60484f7b57b06b6eb3e3 The Rails version is 2.3.4. Thanks in advance!

    Read the article

  • Lining up Divs, while using JQuery

    - by user630581
    I am trying to create a flash header like element in JQuery, that has three images that fade to other images. I have each group of images in a div, but the divs line up vertically down the page, I want them to line up horizontally in a row. Currently my css code is: div#demos{ width:940px; border:0; } .s1{ float:left; display:inline; background-color:#000000; width:225px; margin:0; } .s2{ float:right; display:inline; background-color:#000000; width:225px; margin:0; } .s3{ float:left; display:inline; background-color:#000000; width:225px; margin:0; } and my markup is: <div id="demos"> <div id="s1" class="pics"> <img src="Image1.jpeg" width="200" height="200" /> <img src="Image2.jpeg" width="200" height="200" /> <img src="Image3.jpeg" width="200" height="200" /> </div> <div id="s2" class="pics"> <img src="Image4.jpeg" width="200" height="200" /> <img src="Image5.jpeg" width="200" height="200" /> <img src="Image6.jpeg" width="200" height="200" /> </div> <div id="s3" class="pics"> <img src="Image7.jpeg" width="200" height="200" /> <img src="Image8.jpeg" width="200" height="200" /> <img src="Image9.jpeg" width="200" height="200" /> </div> <div style="clear:both"></div> </div>

    Read the article

  • latex computer output segments

    - by Flavius
    I have a verbatim environment containing computer output as text. This text is sematically made of two sections, each section being separated from the other by an empty line. The number of sections and their content is known, so I don't need to parse the text, but the line between the sections is very important (as it gives semantics to the "text"). Each segment is made of multiple lines. How could I write (1) and (2) on the left handside at the centre of each segment?

    Read the article

  • How to make negate_unary work with any type?

    - by Chan
    Hi, Following this question: How to negate a predicate function using operator ! in C++? I want to create an operator ! can work with any functor that inherited from unary_function. I tried: template<typename T> inline std::unary_negate<T> operator !( const T& pred ) { return std::not1( pred ); } The compiler complained: Error 5 error C2955: 'std::unary_function' : use of class template requires template argument list c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 223 1 Graphic Error 7 error C2451: conditional expression of type 'std::unary_negate<_Fn1>' is illegal c:\program files\microsoft visual studio 10.0\vc\include\ostream 529 1 Graphic Error 3 error C2146: syntax error : missing ',' before identifier 'argument_type' c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 222 1 Graphic Error 4 error C2065: 'argument_type' : undeclared identifier c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 222 1 Graphic Error 2 error C2039: 'argument_type' : is not a member of 'std::basic_ostream<_Elem,_Traits>::sentry' c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 222 1 Graphic Error 6 error C2039: 'argument_type' : is not a member of 'std::basic_ostream<_Elem,_Traits>::sentry' c:\program files\microsoft visual studio 10.0\vc\include\xfunctional 230 1 Graphic Any idea? Update Follow "templatetypedef" solution, I got new error: Error 3 error C2831: 'operator !' cannot have default parameters c:\visual studio 2010 projects\graphic\graphic\main.cpp 39 1 Graphic Error 2 error C2808: unary 'operator !' has too many formal parameters c:\visual studio 2010 projects\graphic\graphic\main.cpp 39 1 Graphic Error 4 error C2675: unary '!' : 'is_prime' does not define this operator or a conversion to a type acceptable to the predefined operator c:\visual studio 2010 projects\graphic\graphic\main.cpp 52 1 Graphic Update 1 Complete code: #include <iostream> #include <functional> #include <utility> #include <cmath> #include <algorithm> #include <iterator> #include <string> #include <boost/assign.hpp> #include <boost/assign/std/vector.hpp> #include <boost/assign/std/map.hpp> #include <boost/assign/std/set.hpp> #include <boost/assign/std/list.hpp> #include <boost/assign/std/stack.hpp> #include <boost/assign/std/deque.hpp> struct is_prime : std::unary_function<int, bool> { bool operator()( int n ) const { if( n < 2 ) return 0; if( n == 2 || n == 3 ) return 1; if( n % 2 == 0 || n % 3 == 0 ) return 0; int upper_bound = std::sqrt( static_cast<double>( n ) ); for( int pf = 5, step = 2; pf <= upper_bound; ) { if( n % pf == 0 ) return 0; pf += step; step = 6 - step; } return 1; } }; /* template<typename T> inline std::unary_negate<T> operator !( const T& pred, typename T::argument_type* dummy = 0 ) { return std::not1<T>( pred ); } */ inline std::unary_negate<is_prime> operator !( const is_prime& pred ) { return std::not1( pred ); } template<typename T> inline void print_con( const T& con, const std::string& ms = "", const std::string& sep = ", " ) { std::cout << ms << '\n'; std::copy( con.begin(), con.end(), std::ostream_iterator<typename T::value_type>( std::cout, sep.c_str() ) ); std::cout << "\n\n"; } int main() { using namespace boost::assign; std::vector<int> nums; nums += 1, 3, 5, 7, 9; nums.erase( remove_if( nums.begin(), nums.end(), !is_prime() ), nums.end() ); print_con( nums, "After remove all primes" ); } Thanks, Chan Nguyen

    Read the article

  • I'm new to C++. Please Help me with the Linked List (What functions to add)?

    - by Igal
    DEAR All; Hi, I'm just beginner to C++; Please help me to understand: What functions should be in the Linked list class ? I think there should be overloaded operators << and ; Please help me to improve the code (style, errors, etc,) Thanks for advance. Igal. Please review the small code for the integer List (enclosed MyNODE.h and ListDriver1.cpp); MyNODE.h // This is my first attempt to write linked list. Igal Spector, June 2010. #include <iostream.h> #include <assert.h> //Forward Declaration of the classes: class ListNode; class TheLinkedlist; // Definition of the node (WITH IMPLEMENTATION !!!, without test drive): class ListNode{ friend class TheLinkedlist; public: // constructor: ListNode(const int& value, ListNode *next= 0); // note: no destructor, as this handled by TheLinkedList class. // accessor: return data in the node. // int Show() const {return theData;} private: int theData; //the Data ListNode* theNext; //points to the next node in the list. }; //Implementations: //constructor: inline ListNode::ListNode(const int &value,ListNode *next) :theData(value),theNext(next){} //end of ListNode class, now for the LL class: class TheLinkedlist { public: //constructors: TheLinkedlist(); virtual ~TheLinkedlist(); // Accessors: void InsertAtFront(const &); void AppendAtBack(const &); // void InOrderInsert(const &); bool IsEmpty()const;//predicate function void Print() const; private: ListNode * Head; //pointer to first node ListNode * Tail; //pointer to last node. }; //Implementation: //Default constructor inline TheLinkedlist::TheLinkedlist():Head(0),Tail(0) {} //Destructor inline TheLinkedlist::~TheLinkedlist(){ if(!IsEmpty()){ //list is not empty cout<<"\n\tDestroying Nodes"<<endl; ListNode *currentPointer=Head, *tempPtr; while(currentPointer != 0){ //Delete remaining Nodes. tempPtr=currentPointer; cout<<"The node: "<<tempPtr->theData <<" is Destroyed."<<endl<<endl; currentPointer=currentPointer->theNext; delete tempPtr; } Head=Tail = 0; //don't forget this, as it may be checked one day. } } //Insert the Node to the beginning of the list: void TheLinkedlist::InsertAtFront(const int& value){ ListNode *newPtr = new ListNode(value,Head); assert(newPtr!=0); if(IsEmpty()) //list is empty Head = Tail = newPtr; else { //list is NOT empty newPtr->theNext = Head; Head = newPtr; } } //Insert the Node to the beginning of the list: void TheLinkedlist::AppendAtBack(const int& value){ ListNode *newPtr = new ListNode(value, NULL); assert(newPtr!=0); if(IsEmpty()) //list is empty Head = Tail = newPtr; else { //list is NOT empty Tail->theNext = newPtr; Tail = newPtr; } } //is the list empty? inline bool TheLinkedlist::IsEmpty() const { return (Head == 0); } // Display the contents of the list void TheLinkedlist::Print()const{ if ( IsEmpty() ){ cout << "\n\t The list is empty!!"<<endl; return; } ListNode *tempPTR = Head; cout<<"\n\t The List is: "; while ( tempPTR != 0 ){ cout<< tempPTR->theData <<" "; tempPTR = tempPTR->theNext; } cout<<endl<<endl; } ////////////////////////////////////// The test Driver: //Driver test for integer Linked List. #include <iostream.h> #include "MyNODE.h" // main Driver int main(){ cout<< "\n\t This is the test for integer LinkedList."<<endl; const int arraySize=11, ARRAY[arraySize]={44,77,88,99,11,2,22,204,50,58,12}; cout << "\n\tThe array is: "; //print the numbers. for (int i=0;i<arraySize; i++) cout<<ARRAY[i]<<", "; TheLinkedlist list; //declare the list for(int index=0;index<arraySize;index++) list.AppendAtBack( ARRAY[index] );//create the list cout<<endl<<endl; list.Print(); //print the list return 0; //end of the program. }

    Read the article

< Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >