Search Results

Search found 15408 results on 617 pages for 'import module'.

Page 251/617 | < Previous Page | 247 248 249 250 251 252 253 254 255 256 257 258  | Next Page >

  • How to properly close a process with NppExec?

    - by Sam the Great
    I'm not sure what's going on here, but the following code continues running even after I end the process in the NppExec console with Ctrl-C (during the execution of the while loop). I restarted my computer to stop the Ctrl key sends. However, if I run the script in Window's cmd prompt, Ctrl-C ends the script just fine. import time import win32com.client shell = win32com.client.Dispatch("WScript.Shell") time.sleep(2) while True: shell.SendKeys('^') # Ctrl key time.sleep(0.5) The NppExec run command I used was: cmd /C python -u "$(FULL_CURRENT_PATH)" Let me know if there is any more information I can provide. Thanks.

    Read the article

  • How to automate configurating DotNetNuke settings for several environments?

    - by Joosh21
    Are there any recommended methods for automating configuring DotnetNuke settings? We will have several instances of our DNN application (prod, beta, qa, dev, local, etc) and need to be able to configure them all the same and be able to make updates to them all with our future releases. The settings currently needed to be configured include Host Settings, Portal Settings and User Profile Definitions. Here are some approaches I have come up with so far: 1) Create a Configuration module and use SQL scripts for all the settings? Is it generally safe to manipulate the DNN tables directly? Often it is recommended to use APIs with many frameworks. 2) Create a Configuration module and implement IUpgradeable.UpgradeModule and programatically set the settings? 3) Create a PortalTemplate from a portal with the settings all set. I believe this will only work for creating new portals. I will not be able to update existing portals.

    Read the article

  • Silence output from SimpleXMLRPCServer

    - by Corey Goldberg
    I am running an xml-rpc server using SimpleXMLRPCServer from the stdlib. My code looks something like this: import SimpleXMLRPCServer import socket class RemoteStarter: def start(self): return 'foo' rs = RemoteStarter() host = socket.gethostbyaddr(socket.gethostname())[0] port = 9000 server = SimpleXMLRPCServer.SimpleXMLRPCServer((host, port)) server.register_instance(rs) server.serve_forever() every time the 'start' method gets called remotely, the server prints an access line like this: <server_name> - - [10/Mar/2010 13:06:20] "POST /RPC2 HTTP/1.0" 200 - I can't figure out a way to silence the output so it doesn't print these access lines to stdout. anyone?

    Read the article

  • Error when trying to use hibernate annotations.

    - by Wilhelm
    The error I'm receiving is listed here. That's my HibernateUtil.java package com.rosejapan; import org.hibernate.SessionFactory; import org.hibernate.cfg.AnnotationConfiguration;; public class HibernateUtil { private static final SessionFactory sessionFactory; static { try { // Create the SessionFactory from hibernate.cfg.xml sessionFactory = new AnnotationConfiguration().configure().buildSessionFactory(); } catch(Throwable e) { System.err.println("Initial sessionFactory creation failed. " + e); throw new ExceptionInInitializerError(e); } } public static SessionFactory getSessionFactory() { return sessionFactory; } } Everything looks all right... I've already included log4j-boot.jar in the CLASSPATH, but didn't resolved my problem.

    Read the article

  • Help with pyHook error.

    - by Shady
    Hey, I'm trying to make a global hotkey with pyhook in python that is supposed to work only with the alt key pressed. here is the source: import pyHook import pythoncom hm = pyHook.HookManager() def OnKeyboardEvent(event): if event.Alt == 32 and event.KeyID == 49: print 'HERE WILL BE THE CODE' hm.KeyDown = OnKeyboardEvent hm.HookKeyboard() pythoncom.PumpMessages() but when I execute, only works with the second press of the second key (number 1 = 49)... and give this error: http://img580.imageshack.us/img580/1858/errord.png How can I solve it? For work at the first pressed time.

    Read the article

  • multiline gtk.Label ignores xalign=0.5

    - by thomas
    A gtk.Label can't be aligned in center when line-wrap is turned on. Example code: import pygtk pygtk.require('2.0') import gtk class testwin(gtk.Window): def __init__(self): gtk.Window.__init__(self) width,height = 300,300 self.set_size_request(width,height) self.set_position(gtk.WIN_POS_CENTER) self.set_title("test window") label = gtk.Label("test text") label.set_line_wrap(True) label.set_justify(gtk.JUSTIFY_CENTER) label.set_alignment(0.5,0.5) label.connect("size-allocate",lambda l,s: l.set_size_request(s.width-1, -1)) self.add(label) self.connect("destroy", gtk.main_quit) self.show_all() testwin() gtk.main() It looks like this, that means, it's aligned left: http://m45.img-up.net/?up=pic122x97.png If you comment out line 14 (set_line_wrap) everything is perfectly fine: http://o54.img-up.net/?up=pic2y00p9.png Please note that yalign works fine. So it seems like the first argument in the gtk.Misc.set_alignment-function has no effect when line wrap is turned on. Using Fedora 16, 64bit, gtk 3.2.4, pygtk 2.24.0, python 2.7.2 Question: Is this intended or a bug? How is it supposed to be made or is a workaround available?

    Read the article

  • Java Web Service Client from Microsoft Live Search

    - by trendyy
    I generated java web service from here -- http://api.search.live.net/search.wsdl.. I want to make search and listing the return values. In my opinion i generated client and client is makes research but i can't display result, how i can do that.. Can anyone check my wrote code and help me about displaying result? Thanks... import java.rmi.RemoteException; import com.microsoft.schemas.LiveSearch._2008._03.Search.*; public class searchtry { public static void main(String[] args) throws RemoteException { LiveSearchPortTypeProxy client=new LiveSearchPortTypeProxy(); SearchRequest request=new SearchRequest(); SearchRequestType1 type1=new SearchRequestType1(); sorgu.setAppId("*********************************"); //Windows Live gave this id for using that service sorgu.setSources(new SourceType[]{SourceType.Web}); sorgu.setQuery("Java"); aratip.setParameters(request); SearchResponseType0 answer= client.search(type1); System.out.println(answer.toString()); }

    Read the article

  • Content area not expanding with the content within it!

    - by Caleb
    I have been coding a design I had been working on for a week or so and have core across a snag. While doing the HTML/CSS of one of my right column modules the content within it expands however the bg and bordered area it is within does not. htttp://www.gamefriction.com/Coded/ (url with example) http://www.gamefriction.com/Coded/css/style.css (css stylesheet used on page) This website is purely HTML and CSS at this time all code can be viewed through the View Source option on all browsers. The area that is not working properly is the bullet links in the right module with the blue background that says "League Menu". The content above that will make the module background expand however the linked bullet menu will not.

    Read the article

  • Read entire file in Scala?

    - by Brendan OConnor
    What's a simple and canonical way to read an entire file into memory in Scala? (Ideally, with control over character encoding.) The best I can come up with is: scala.io.Source.fromPath("file.txt").getLines.reduceLeft(_+_) or am I supposed to use one of Java's god-awful idioms, the best of which (without using an external library) seems to be: import java.util.Scanner import java.io.File new Scanner(new File("file.txt")).useDelimiter("\\Z").next() From reading mailing list discussions, it's not clear to me that scala.io.Source is even supposed to be the canonical I/O library. I don't understand what its intended purpose is, exactly. ... I'd like something dead-simple and easy to remember. For example, in these languages it's very hard to forget the idiom ... Ruby open("file.txt").read Ruby File.read("file.txt") Python open("file.txt").read()

    Read the article

  • load a pickle file from a zipfile

    - by eric.frederich
    For some reason I cannot get cPickle.load to work on the file-type object returned by ZipFile.open(). If I call read() on the file-type object returned by ZipFile.open() I can use cPickle.loads though. Example .... import zipfile import cPickle # the data we want to store some_data = {1: 'one', 2: 'two', 3: 'three'} # # create a zipped pickle file # zf = zipfile.ZipFile('zipped_pickle.zip', 'w', zipfile.ZIP_DEFLATED) zf.writestr('data.pkl', cPickle.dumps(some_data)) zf.close() # # cPickle.loads works # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd1 = cPickle.loads(zf.open('data.pkl').read()) zf.close() # # cPickle.load doesn't work # zf = zipfile.ZipFile('zipped_pickle.zip', 'r') sd2 = cPickle.load(zf.open('data.pkl')) zf.close() Note: I don't want to zip just the pickle file but many files of other types. This is just an example.

    Read the article

  • Improving the speed of php

    - by cast01
    I'm currently working on a website in PHP, and I'm wondering what the best practices/methods are to reduce the time requests take. I've build the site in a modular way, so a page would consist of a number of modules, and each of these would need to request information. For example, I have a cart module, that (if a cart is set) will fetch the cart with the id (stored in a session variable) from the database and return its contents. I have another module that lists categories and this needs to fetch the categories from the database. My system is built with models, and each model might also make a request, for example a category model will make a request to get products in that category.

    Read the article

  • dreamweaver sites

    - by ngreenwood6
    Hello, We have over 500 sites that we host. All of there ftp information is in a database. Whenever one of our programmers have to add a site they have to get all the info and set it up. However, I found that you can export them and it has all the info except for one problem. The password is encrypted. I am not trying to hack anything, I want to know how to encrypt our passwords so that we can import them using dreamweavers import feature. Can anyone tell me what encryption they use or a link on how to encrypt. I am not interested in decrypting at all because we already have all of them so it would not do me any good. Thanks for any help

    Read the article

  • Sending mail from Python using SMTP

    - by Eli Bendersky
    I'm using the following method to send mail from Python using SMTP. Is it the right method to use or are there gotchas I'm missing ? from smtplib import SMTP import datetime debuglevel = 0 smtp = SMTP() smtp.set_debuglevel(debuglevel) smtp.connect('YOUR.MAIL.SERVER', 26) smtp.login('USERNAME@DOMAIN', 'PASSWORD') from_addr = "John Doe <[email protected]>" to_addr = "[email protected]" subj = "hello" date = datetime.datetime.now().strftime( "%d/%m/%Y %H:%M" ) message_text = "Hello\nThis is a mail from your server\n\nBye\n" msg = "From: %s\nTo: %s\nSubject: %s\nDate: %s\n\n%s" % ( from_addr, to_addr, subj, date, message_text ) smtp.sendmail(from_addr, to_addr, msg) smtp.quit()

    Read the article

  • Looking for Reachability (2.0) Use Case Validation

    - by user350243
    There is so much info out there on using Apple's Reachability example, and so much is conflicting. I'm trying to find out of I'm using it (Reachability 2.0) correctly below. My App use case is this: If an internet connection is available through any means (wifi, LAN, Edge, 3G, etc.) a UIButton ("See More") is visible on various views. If no connection, the button is not visible. The "See More" part is NOT critical in any way to the app, it's just an add-on feature. "See More" could be visible or not anytime during the application lifecycle as connection is established or lost. Here's how I did it - Is this correct and/or is there a better way? Any help is Greatly Appreciated! lq // AppDelegate.h #import "RootViewController.h" @class Reachability; @interface AppDelegate : NSObject <UIApplicationDelegate> { UIWindow *window; UINavigationController *navigationController; RootViewController *rootViewController; Reachability* hostReach; // NOT USED: Reachability* internetReach; // NOT USED: Reachability* wifiReach; } @property (nonatomic, retain) IBOutlet UIWindow *window; @property (nonatomic, retain) IBOutlet UINavigationController *navigationController; @property (nonatomic, retain) IBOutlet RootViewController *rootViewController; @end // AppDelegate.m #import "AppDelegate.h" #import "Reachability.h" #define kHostName @"www.somewebsite.com" @implementation AppDelegate @synthesize window; @synthesize navigationController; @synthesize rootViewController; - (void) updateInterfaceWithReachability: (Reachability*) curReach { if(curReach == hostReach) { NetworkStatus netStatus = [curReach currentReachabilityStatus]; BOOL connectionRequired = [curReach connectionRequired]; // Set a Reachability BOOL value flag in rootViewController // to be referenced when opening various views if ((netStatus != ReachableViaWiFi) && (netStatus != ReachableViaWWAN)) { rootViewController.bConnection = (BOOL *)0; } else { rootViewController.bConnection = (BOOL *)1; } } } - (void) reachabilityChanged: (NSNotification* )note { Reachability* curReach = [note object]; NSParameterAssert([curReach isKindOfClass: [Reachability class]]); [self updateInterfaceWithReachability: curReach]; } - (void)applicationDidFinishLaunching:(UIApplication *)application { // NOTE: #DEFINE in Reachability.h: // #define kReachabilityChangedNotification @"kNetworkReachabilityChangedNotification" [[NSNotificationCenter defaultCenter] addObserver: self selector: @selector(reachabilityChanged:) name: kReachabilityChangedNotification object: nil]; hostReach = [[Reachability reachabilityWithHostName: kHostName] retain]; [hostReach startNotifer]; [self updateInterfaceWithReachability: hostReach]; [window addSubview:[navigationController view]]; [window makeKeyAndVisible]; } - (void)dealloc { [navigationController release]; [rootViewController release]; [window release]; [super dealloc]; } @end

    Read the article

  • How can I handle template dependencies in Template Toolkit?

    - by Smack my batch up
    My static web pages are built from a huge bunch of templates which are inter-included using Template Toolkit's "import" and "include", so page.html looks like this: [% INCLUDE top %] [% IMPORT middle %] Then top might have even more files included. I have very many of these files, and they have to be run through to create the web pages in various languages (English, French, etc., not computer languages). This is a very complicated process and when one file is updated I would like to be able to automatically remake only the necessary files, using a makefile or something similar. Are there any tools like makedepend for C files which can parse template toolkit templates and create a dependency list for use in a makefile? Or are there better ways to automate this process?

    Read the article

  • Elegant setup of Python logging in Django

    - by Parand
    I have yet to find a way of setting up Python logging with Django that I'm happy with. My requirements are fairly simple: Different log handlers for different events - that is, I want to be able to log to different files Easy access to loggers in my modules. The module should be able to find its logger with little effort. Should be easily applicable to command-line modules. Parts of the system are stand-alone command line or daemon processes. Logging should be easily usable with these modules. My current setup is to use a logging.conf file and setup logging in each module I log from. It doesn't feel right. Do you have a logging setup that you like? Please detail it: how do you setup the configuration (do you use logging.conf or set it up in code), where/when do you initiate the loggers, and how do you get access to them in your modules, etc.

    Read the article

  • Whats wrong with this code.Runtime error

    - by javacode
    Hi I am writing this application in eclipse I added all the jar files.I am pasting the code and error.Please let me know what changes I should make to run the application properly. import javax.mail.*; import javax.mail.internet.*; import java.util.*; public class SendMail { public static void main(String [] args) { SendMail sm=new SendMail(); try{ sm.postMail(new String[]{"[email protected]"},"hi","hello","[email protected]"); } catch(MessagingException e) { e.printStackTrace(); } } public void postMail( String recipients[ ], String subject, String message , String from) throws MessagingException { boolean debug = false; //Set the host smtp address Properties props = new Properties(); props.put("mail.smtp.starttls.enable","true"); props.put("mail.smtp.host", "smtp.gmail.com"); props.setProperty("mail.smtp.port", "25"); // create some properties and get the default Session Session session = Session.getDefaultInstance(props, null); session.setDebug(debug); // create a message Message msg = new MimeMessage(session); // set the from and to address InternetAddress addressFrom = new InternetAddress(from); msg.setFrom(addressFrom); InternetAddress[] addressTo = new InternetAddress[recipients.length]; for (int i = 0; i < recipients.length; i++) { addressTo[i] = new InternetAddress(recipients[i]); } msg.setRecipients(Message.RecipientType.TO, addressTo); // Optional : You can also set your custom headers in the Email if you Want msg.addHeader("MyHeaderName", "myHeaderValue"); // Setting the Subject and Content Type msg.setSubject(subject); msg.setContent(message, "text/plain"); Transport.send(msg); } } Error: com.sun.mail.smtp.SMTPSendFailedException: 530 5.7.0 Must issue a STARTTLS command first. 13sm646598ewy.13 at com.sun.mail.smtp.SMTPTransport.issueSendCommand(SMTPTransport.java:1829) at com.sun.mail.smtp.SMTPTransport.mailFrom(SMTPTransport.java:1368) at com.sun.mail.smtp.SMTPTransport.sendMessage(SMTPTransport.java:886) at javax.mail.Transport.send0(Transport.java:191) at javax.mail.Transport.send(Transport.java:120) at SendMail.postMail(SendMail.java:54) at SendMail.main(SendMail.java:10)

    Read the article

  • Video with QML Video plays choppy on Mac OS X

    - by avida
    I’m trying to create simple video player with QML. I have QtSdk installed and QtMobility compiled and installed from source. Then I put this simple video playing code to main qml file: import QtQuick 1.0 import QtMultimediaKit 1.1 Item{ width: 400; height: 300 Video { id: video source: "d:/Projects/Serenity - HD DVD Trailer.mp4" anchors.fill: parent MouseArea { anchors.fill: parent onClicked: { video.play() } } } } After compiling and running application, video plays choppy and on exiting application it puts this in log: 2011-06-07 11:13:44.055 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10225ea60 of class NSCFNumber autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x10264f030 of class __NSCFDate autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.007 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a409000 of class NSCFTimer autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a43e550 of class NSCFArray autoreleased with no pool in place - just leaking 2011-06-07 11:13:45.008 video-player[323:903] *** __NSAutoreleaseNoPool(): Object 0x11a462560 of class __NSFastEnumerationEnumerator autoreleased with no pool in place - just leaking If any way to make it playing smoothly and to prevent memory?

    Read the article

  • Why does my program crash when given negative values?

    - by Wayfarer
    Alright, I am very confused, so I hope you friends can help me out. I'm working on a project using Cocos2D, the most recent version (.99 RC 1). I make some player objects and some buttons to change the object's life. But the weird thing is, the code crashes when I try to change their life by -5. Or any negative value for that matter, besides -1. NSMutableArray *lifeButtons = [[NSMutableArray alloc] init]; CCTexture2D *buttonTexture = [[CCTextureCache sharedTextureCache] addImage:@"Button.png"]; LifeChangeButtons *button = nil; //top left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , size.height - 30); [button buttonText:-5]; [lifeButtons addObject:button]; //top right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , size.height - 30); [button buttonText:1]; [lifeButtons addObject:button]; //bottom left button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(50 , 30); [button buttonText:5]; [lifeButtons addObject:button]; //bottom right button = [LifeChangeButtons lifeButton:buttonTexture ]; button.position = CGPointMake(size.width - 50 , 30); [button buttonText:-1]; [lifeButtons addObject:button]; for (LifeChangeButtons *theButton in lifeButtons) { [self addChild:theButton]; } This is the code that makes the buttons. It simply makes 4 buttons, puts them in each corner of the screen (size is the screen) and adds their life change ability, 1,-1,5, or -5. It adds them to the array and then goes through the array at the end and adds all of them to the screen. This works fine. Here is my code for the button class: (header file) // // LifeChangeButtons.h // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "cocos2d.h" @interface LifeChangeButtons : CCSprite <CCTargetedTouchDelegate> { NSNumber *lifeChange; } @property (nonatomic, readonly) CGRect rect; @property (nonatomic, retain) NSNumber *lifeChange; + (id)lifeButton:(CCTexture2D *)texture; - (void)buttonText:(int)number; @end Implementation file: // // LifeChangeButtons.m // Coco2dTest2 // // Created by Ethan Mick on 3/14/10. // Copyright 2010 Wayfarer. All rights reserved. // #import "LifeChangeButtons.h" #import "cocos2d.h" #import "CustomCCNode.h" @implementation LifeChangeButtons @synthesize lifeChange; //Create the button +(id)lifeButton:(CCTexture2D *)texture { return [[[self alloc] initWithTexture:texture] autorelease]; } - (id)initWithTexture:(CCTexture2D *)atexture { if ((self = [super initWithTexture:atexture])) { //NSLog(@"wtf"); } return self; } //Set the text on the button - (void)buttonText:(int)number { lifeChange = [NSNumber numberWithInt:number]; NSString *text = [[NSString alloc] initWithFormat:@"%d", number]; CCLabel *label = [CCLabel labelWithString:text fontName:@"Times New Roman" fontSize:20]; label.position = CGPointMake(35, 20); [self addChild:label]; } - (CGRect)rect { CGSize s = [self.texture contentSize]; return CGRectMake(-s.width / 2, -s.height / 2, s.width, s.height); } - (BOOL)containsTouchLocation:(UITouch *)touch { return CGRectContainsPoint(self.rect, [self convertTouchToNodeSpaceAR:touch]); } - (void)onEnter { [[CCTouchDispatcher sharedDispatcher] addTargetedDelegate:self priority:0 swallowsTouches:YES]; [super onEnter]; } - (void)onExit { [[CCTouchDispatcher sharedDispatcher] removeDelegate:self]; [super onExit]; } - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; if ( ![self containsTouchLocation:touch] ) return NO; NSLog(@"Button touch event was called returning yes. "); //this is where we change the life to each selected player NSLog(@"Test1"); NSMutableArray *tempArray = [[[UIApplication sharedApplication] delegate] selectedPlayerObjects]; NSLog(@"Test2"); for (CustomCCNode *aPlayer in tempArray) { NSLog(@"we change the life by %d.", [lifeChange intValue]); [aPlayer changeLife:[lifeChange intValue]]; } NSLog(@"Test3"); return YES; } - (void)ccTouchMoved:(UITouch *)touch withEvent:(UIEvent *)event { CGPoint touchPoint = [touch locationInView:[touch view]]; touchPoint = [[CCDirector sharedDirector] convertToGL:touchPoint]; NSLog(@"You moved in a button!"); } - (void)ccTouchEnded:(UITouch *)touch withEvent:(UIEvent *)event { NSLog(@"You touched up in a button"); } @end Now, This function: - (BOOL)ccTouchBegan:(UITouch *)touch withEvent:(UIEvent *)event Is where all the shit goes down. It works for all of the buttons except the -5 one. And then, it gets to: NSLog(@"we change the life by %d.", [lifeChange integerValue]); And it crashes at that statement. It only crashes when given anything less than -1. -1 works, but nothing smaller does. Here is the code in the CustomCCNode Class, "changeLife" that is being called. - (void)changeLife:(int)lifeChange { NSLog(@"change life in Custom Class was called"); NSLog(@"wtf is lifechange: %d", lifeChange); life += lifeChange; lifeString = [[NSString alloc] initWithFormat:@"%d",life]; [text setString:lifeString]; } Straight forward, but when the NSnumber is -5, it doesn't even get called, it crashes at the NSlog statement. So... what's up with that?

    Read the article

  • How to draw the "trail" in a maze solving application

    - by snow-spur
    Hello i have designed a maze and i want to draw a path between the cells as the 'person' moves from one cell to the next. So each time i move the cell a line is drawn Also i am using the graphics module The graphics module is an object oriented library Im importing from graphics import* from maze import* my circle which is my cell center = Point(15, 15) c = Circle(center, 12) c.setFill('blue') c.setOutline('yellow') c.draw(win) p1 = Point(c.getCenter().getX(), c.getCenter().getY()) this is my loop if mazez.blockedCount(cloc)> 2: mazez.addDecoration(cloc, "grey") mazez[cloc].deadend = True c.move(-25, 0) p2 = Point(getX(), getY()) line = graphics.Line(p1, p2) cloc.col = cloc.col - 1 Now it says getX not defined every time i press a key is this because of p2???

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • serving files using django - is this a security vulnerability

    - by Tom Tom
    I'm using the following code to serve uploaded files from a login secured view in a django app. Do you think that there is a security vulnerability in this code? I'm a bit concerned about that the user could place arbitrary strings in the url after the upload/ and this is directly mapped to the local filesystem. Actually I don't think that it is a vulnerability issue, since the access to the filesystem is restricted to the files in the folder defined with the UPLOAD_LOCATION setting. UPLOAD_LOCATION = is set to a not publicly available folder on the webserver url(r'^upload/(?P<file_url>[/,.,\s,_,\-,\w]+)', 'aeon_infrastructure.views.serve_upload_files', name='project_detail'), @login_required def serve_upload_files(request, file_url): import os.path import mimetypes mimetypes.init() try: file_path = settings.UPLOAD_LOCATION + '/' + file_url fsock = open(file_path,"r") file_name = os.path.basename(file_path) file_size = os.path.getsize(file_path) print "file size is: " + str(file_size) mime_type_guess = mimetypes.guess_type(file_name) if mime_type_guess is not None: response = HttpResponse(fsock, mimetype=mime_type_guess[0]) response['Content-Disposition'] = 'attachment; filename=' + file_name #response.write(file) except IOError: response = HttpResponseNotFound() return response

    Read the article

  • Maven eclipse does not add a dependency

    - by Calm Storm
    I have the following snippet in my pom.xml <dependency> <groupId>aspectj</groupId> <artifactId>aspectjrt</artifactId> <version>1.5.3</version> </dependency> and in one of my Java files I refer a class org.aspectj.lang.ProceedingJoinPoint. When I do a "mvn clean install" it compiles and builds fine but when I do an eclipse:eclipse, and import the project in eclipse it gives me an error The import org.aspectj cannot be resolved. I checked the .classpath file that was generated and it does not have an entry to this file. I tried a "mvn dependency:tree" and it lists this fine. Can someone tell me what is going wrong here?

    Read the article

  • Handling over-long UTF-8 sequences

    - by Grant McLean
    I've just been reworking my Encoding::FixLatin Perl module to handle over-long utf8 byte sequences and convert them to the shortest normal form. My question is quite simply "is this a bad idea"? A number of sources (including this RFC) suggest that any over-long utf8 should be treated as an error and rejected. They caution against "naive implementations" and leave me with the impression that these things are inherently unsafe. Since the whole purpose of my module is to clean up messy data files with mixed encodings and convert them to nice clean utf8, this seems like just one more thing I can clean up so the application layer doesn't have to deal with it. My code does not concern itself with any semantic meaning the resulting characters might have, it simply converts them into a normalised form. Am I missing something. Is there a hidden danger I haven't considered?

    Read the article

< Previous Page | 247 248 249 250 251 252 253 254 255 256 257 258  | Next Page >