Search Results

Search found 34195 results on 1368 pages for 'try'.

Page 251/1368 | < Previous Page | 247 248 249 250 251 252 253 254 255 256 257 258  | Next Page >

• AppCmd to create a virtual directory in default web site in IIS7

  - by Riri

  I try to create a virtual directory under the "Default Web Site" in IIS 7 using AppCmd. First I however like to see if one already exist. How can I use AppCmd to create a virtual directory under the "Deafult Web Site" and how can I do an if-statement?

  Read the article

• Rsync --backup-dir seems to be ignored

  - by Patrik

  I want to use rsync to backup a directory from a local location to a remote location, and store changed files in another remote location. I did use: rsync -rcvhL --progress --backup [email protected]:/home/user/Changes/`date +%Y.%m.%d` . [email protected]:/home/user/Files/ The --backup-dir stays empty, while it should be filled. Is it possible what I try to accomplish, and am I doing something wrong? Thanks

  Read the article

• Ubuntu 10.04 doesn't accept keyboard input when running under VMware on Windows 7

  - by anwar

  I have just installed Ubuntu for the first time using VMWare on Windows 7. Everything has been installed smoothly but after the installation in the login screen username is coming and when I try to enter password it is not taking any input, keyboard is not working at all. After moving away from Ubuntu keyboard and everthing else is working fine. Does anyone know what's the cause behind this ?

  Read the article

• Intternet Explorer 8 remembering me (keeping cookies) in "New Session"

  - by GJ

  From what I gather (e.g. http://tutorialfeed.blogspot.com/2009/06/ie-8-perk-access-multiple-gmail.html ) one can get a new IE8 window clean from older cookies and independent of what's going on in other windows. Alas, when I try that web sites still remember me in the window of the new session. Any ideas what's wrong in my setup? Thanks!

  Read the article

• Printing Large PDF from Outlook 2003

  - by mrach

  Whenever I try to print an attached oversized PFF sheet (larger then letter sized) from Outlook, the print is cut off. How can I configure Outlook to automatically fit the PDF to page sized with out having to open it up in Adobe Reader?

  Read the article

• Clear Type problem in Windows 7

  - by Florin Sabau

  I try to tune ClearType in Windows 7 x64 using the ClearType Text Tuner. I can choose whatever options I want on the first 3 pages, but on the last page, whatever I choose is reverted as soon as I click finish. Next time I run the tuner I can see that the second option is selected, not the option that I wanted (the last one). Has anybody else found this odd behavior?

  Read the article

• "make menuconfig" throwing cannot find -lc error in my Fedora 11 PC

  - by Sen

  When i try to do a make menuconfig in a Fedora 11 machine it is throwing the following error message: [root@PC04 kernel]# make menuconfig HOSTCC -static scripts/basic/fixdep scripts/basic/fixdep.c: In function âtrapsâ: scripts/basic/fixdep.c:377: warning: dereferencing type-punned pointer will break strict-aliasing rules scripts/basic/fixdep.c:379: warning: dereferencing type-punned pointer will break strict-aliasing rules /usr/bin/ld: cannot find -lc collect2: ld returned 1 exit status make[1]: *** [scripts/basic/fixdep] Error 1 make: *** [scripts_basic] Error 2 Please help me on this issue? How can i solve this? Thanks, Sen

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Can I burn a CD ISO to DVD?

  - by Peter Turner

  Well, I just figured I'd ask because this site is so awesome that it probably is faster to ask than try it and waste a few cents. So can I burn an CD ISO to DVD? We've just got a bunch of DVD-R's lying around and I don't want to bother with torrents to download the new Fedora DVD.

  Read the article

• What setting can cause a monitor to flicker under X11?

  - by BCS

  I've been dinking with the xorg.conf file on my system and now when I try to start X I get a flickering effect and no usable image. I think (and this is just a guess) that it's a settings out of bound error of some kind but I don't know what setting. I'm almost completely sure that the hardware is good given that everything is brand new.and works just fine in text mode. Any ideas?

  Read the article

• Thunderbird loses all settings if PC is being shut down abnormally

  - by Roland

  If my PC shut downs suddenly with power dips etc I loose all my Thunderburd settings and mail in Thunderbird, although the Profiles folder still exists. I had a look in the profiles text file and that file looks unchanged. Are there things I could try to solve this issue? I do not know what do do? Any help will be greaatly appreciated. OS: Win XP Professional SP2 Thunderbird Version: 2.0.0.19

  Read the article

• Problem with bash scripting

  - by eple

  Hi. I terrible with bash scripting, and need some help with the following: #!/bin/bash if [ -e Pretty* ];then ncftpput -R -DD -v -u xbmc -p xbmc 192.168.1.100 /home/xbmc/TV/Pretty_Little_Liars/ Pretty* else echo "No new folders" fi find -depth -type d -empty -exec rmdir {} \; Problem here is the ncftpput line.. if I just do a simple [ echo "working" ] instead, everything is OK, but when I try the ncftpput-line it just gives me [ line 5: [: too many arguments ] the ncftpput command alone works fine.. Any ideas?

  Read the article

• Security System Preference won't open on Macos 10.6 Snow Leopard

  - by adambox

  When I try to open the Security preference pane on my iMac running Mac OS 10.6.6, it says "loading..." and it never opens. I get this in the console: 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetOk: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] Could not connect the action resetLocationWarningsSheetCancel: to target of class AppleSecurity_Pref 3/5/11 4:16:56 PM System Preferences[724] *** -[NSCFDictionary initWithObjects:forKeys:count:]: attempt to insert nil value at objects[0] (key: NSFont)

  Read the article

• Windows 2012 VPN setup without Active Directory

  - by iss42

  I have followed the guide here: http://www.youtube.com/watch?v=9qbpxKRb-94 But my situation differs with respect to there being no AD (Active Directory) setup. When I try to connect I get this in the server event log: "The user xx connected from x.x.x.x but failed an authentication attempt due to the following reason: The account does not have permission to dial in." Is there a way to enable this without AD?

  Read the article

• Troubleshooting a network card on linux. Connected to network, given access point, no connection?

  - by Chris

  I installed the driver for my network card. iwconfig and ifconfig are all responsive to connecting to the network, I'm given an access point address. Then, I try to connect to a website and no dice. ping www.google.com yields no result. What gives?

  Read the article

• Blue screen of death when moving files

  - by kevin

  i just bought a new hp amd II athlon quad core and everytime i try to move file off my desktop to a hard drive or off my hard drive to my desktop of atleast a 1g or more my computer restarts itself and gives me the blue screen of death can someone please tell me why

  Read the article

• Chrooted pygopherd fails to find new directories and files

  - by Carsten R

  I tried to setup a Pygopherd on my server. The default setup works fine, but when I try to change the gophermap to point to a new directory with a new file, I get an error message in my gopher client: --- [1] '/path/to/gopher/newdir' does not exist (no handler found) First I thought this is caused by the chroot in which pygopherd runs as default. But when I disable the chroot, the same error comes up. Did anyone successfully set up pygopherd or knows about a better gopher server?

  Read the article

• Install WAS 7.0 on RHEL 6

  - by Madhur Ahuja

  I am trying to install Websphere 7 x64 on RHEL 6 x64. I am using Developer edition. When I try to execute ./install on the command prompt, it waits for few seconds and then returns to prompt without any error. I have installed all the pre-requisites as listed in this article: http://pic.dhe.ibm.com/infocenter/wasinfo/v7r0/index.jsp?topic=%2Fcom.ibm.websphere.installation.base.doc%2Finfo%2Faes%2Fae%2Ftins_linuxsetup_rhel6.html Any idea how to troubleshoot this ?

  Read the article

• Solver Add-in not loading correctly

  - by Paul

  When I try to open solver from inside excel 2010, I get the error message: "Solver: An unexpected internal error occurred, or available memory was exhausted." The only way I have been able to get Solver to work is by going to "C:\Program Files\Microsoft Office\Office14\Library\SOLVER\", and just opening the file called "SOLVER.xlam". If I open excel through that file, the program works fine. Is there a way to solve this issue?

  Read the article

• Does exists a GTalk working client for linux which supports voice chat?

  - by Andrea Ambu

  Did you try it? Did it work? I tried empathy and jabbin but they don't seem to work for me. Post one client per anwser please.

  Read the article

• Dell E6400 Display issue - "doubling up" intermittently

  - by alex

  I've got a Dell E6400 It's suddenly developed an intermittent fault with the display Every now and again, it seems to boot up with "double vision" By that I mean, its split horizontally, with each half showing the same thing, but with low resolution, and looks grainy - if that makes sense (I will try to get a couple of pictures if I can) I haven't changed any hardware or anything. I have re-built windows, to see if that fixed the problem, it didn't. I've upgraded the BIOS to see if that would help, still same problem. I'm out of ideas :-(

  Read the article

• Hell: NTFS "Restore previous versions"...

  - by ttsiodras

  The hell I have experienced these last 24h: Windows 7 installation hosed after bluetooth driver install. Attempting to recover using restore points via "Repair" on the bootable Win7 installation CD. Attempting to go back one day in the restore points. No joy. Attempting to go back two days in the restore points. No joy. Attempting to go back one week in the restore points. Stil no joy. Windows won't boot. Apparently something is REALLY hosed. And then it hits me - PANIC - the restore points somehow reverted DATA files to their older versions! Word, Powerpoint, SPSS, etc document versions are all one week old now. Using the "freshest" restore point. Failed to restore yesterday's restore point!!! I am stuck at old versions of the data!!! Booting KNOPPIX, mounting NTFS partition as read-only under KNOPPIX. Checking. Nope, the data files are still the one week old versions. Booting Win7 CD, Recovery console - Cmd prompt - navigating - yep, data files are still one week old. Removing the drive, mounting it under other Win7 installation. Still old data. Running NTFS undelete on the drive (read-only scan), searching for file created yesterday. Not found. Despair. At this point, idea: I will install a brand new Windows installation, keeping the old one in Windows.old (default behaviour of Windows installs). I boot the new install, I go to my C:\Data\ folder, I choose "Restore previous versions", click on yesterday's date, and click open... YES! It works! I can see the latest versions of my files (e.g. from yesterday). Thank God. And then, I try to view the files under the "yesterday snapshot-version" of c:\Users\MyAccount\Desktop ... And I get "Permission Denied" as soon as I try to open "Users\MyAccount". I make sure I am an administrator. No joy. Apparently, the new Windows installation does not have access to read the "NTFS snapshots" or "Volume Shadow Snapshots" of my old Windows account! Cross-installation permissions? I need to somehow tell the new Windows install that I am the same "old" user... So that I will be able to access the "Users\MyAccount" folder of the snapshot of my old user account. Help?

  Read the article

• Can you mount a sysprep image using DISM

  - by Tester123

  I created a script to mount a sysprepped Windows 7 image to a directory so I can edit a specific file in the image and then unmount it. The script seems to work just fine however, each time I try I seem to be getting some sort of error about the Image. Errors such as: The image is supposedly damaged or corrupted The image mounts but nothing appears in the directory So I guess the overall question is it possible to mount an syprepped Windows 7 Wim Image into a directory?

  Read the article

• How to setup Int. connection through Airport Express on Mac using broadband cable?

  - by Sabir

  I have a Mac, airport express, and a broadband cable which works when i use it with PC. when I plug it into Aorport express and try setting it up using automatic settings it doesnt connect. what do i need to do??

  Read the article

• Explorer: programmatically select file/directory with space in the path

  - by Mike L.

  When I try to select a file or directory which has a space in its path in the Windows Explorer, it selects a completely different directory: explorer.exe "/select,C:\Program Files\foobar" I've tried it from Java with Runtime.getRuntime().exec(new String[] { "explorer.exe", "/select," + filePath }); and with the above command line. In both cases, the same result. What can I do to solve the problem?

  Read the article

< Previous Page | 247 248 249 250 251 252 253 254 255 256 257 258  | Next Page >