Search Results

Search found 6651 results on 267 pages for 'description'.

Page 256/267 | < Previous Page | 252 253 254 255 256 257 258 259 260 261 262 263  | Next Page >

  • "Randomly" occurring errors...

    - by ClarkeyBoy
    Hi, My website has a setup whereby when the application starts a module called SiteContent is "created". This runs a clearup function which basically deletes any irrelevant data from the database, in case any has been left in there from previously run functions. The module has instances of Manager classes - namely RangeManager, CollectionManager, DesignManager. There are others but I will just use these as an example. Each Manager class contains an array of items - items may be of type Range, Collection or Design, whichever one is relevant. Data for each range is then read into an instance of Range, Collection or Design. I know this is basically duplicating data - not very efficient but its my final year project at the moment so I can always change it to use Linq or something similar later, when I am not pressured by the one month deadline. I have a form which, on clicking the Save button, saves data by calling SiteContent.RangeManager.Create(vars) or SiteContent.RangeManager.Update(Range As Range, vars) (or the equivalent for other manager classes, whichever one happens to be relevant). These functions call a stored procedure to insert or update in the relevant table. Classes Range, Collection and Design all have attributes such as Name, Description, Display and several others. When the Create or Update function is called, the Manager loops through all the other items to check if an item with the same name already exists. The Update function ensures that it does not compare the item being updated to itself. A custom exception (ItemAlreadyExistsException) is thrown if another item with the same name is found. For some weird reason, if I go into a Range, Collection or Design in edit mode, change something and try to update it, it occasionally doesnt update the item. When I say occasionally I mean every 3 - 4 page loads, sometimes more. I see absolutely no pattern in when or why it occurs. I have a try-catch statement which catches ItemAlreadyExistsException, and outputs "An item with this name already exists" when caught. Occasionally it will output this; other times it will not. Does anyone have any idea why this could happen? Maybe a mistake which someone has made and solved before? I used to have regular expressions in place that the names were compared to - I believe it was [a-zA-Z]{1, 100} (between 1 and 100 lower- or upper-case characters). For some reason the customer who I am developing the site for used to get errors saying its not in the correct format. Yet he could try the same text 5 minutes later and it would work fine. I am thinking this could well be the same problem, since both problems occur at random. Many thanks in advance. Regards, Richard Clarke Edit: After much time spent narrowing down the code, I have decided to wait till my brother, who has been a programmer for at least 8 years more than I have, to come down over Easter and get him to have a look at it. If he cant solve it then I will zip the files up and put them somewhere for people to access and have a go at. I narrowed it down literally to the minimum number of files possible, and it still occurs. It seems to be about every 10th time. Having said that, I force the manager classes to refresh every 10 page loads or 5 minutes (whichever one is sooner). I may look into this - this could be causing a problem. Basically each Manager contains an array of an object. This array is populated using data from the database. The Update function takes an instance of the item and the new values to be set for the object. If it happens to be a page load where the array is reset (ie the data is loaded freshly from the database) then the object instance with the same ID wont be the same instance as the one being passed in. This explains the fact that it throws an ItemAlreadyExistsException now and then. It all makes sense now the more I think about it. If I were to pass in the ID of the object to be altered, rather than the object itself, then it should work perfectly. I will answer the question if I solve it..

    Read the article

  • Giving an Error Object Expected Line 48 Char 1

    - by Leslie Peer
    Giving an Error Object Expected Line 48 Char 1------What did I do wrong??? *Note Line # are for reference only not on Original Web page****** <HTML><HEAD><TITLE></TITLE> <META http-equiv=Content-Type content="text/html; charset=utf-8"> <META content="Leslie Peer" name=author> <META content="Created with Trellian WebPage" name=description> <META content="MSHTML 6.00.6000.16809" name=GENERATOR> <META content=Index name=keywords> <STYLE type=text/css>BODY { COLOR: #000000; BACKGROUND-REPEAT: repeat; FONT-FAMILY: Accent SF, Arial, Arial Black, Arial Narrow, Century Gothic, Comic Sans MS, Courier, Courier New, Georgia, Microsoft Sans Serif, Monotype Corsiva, Symbol, Tahoma, Times New Roman; BACKGROUND-COLOR: #666666 } A { FONT-SIZE: 14px; FONT-FAMILY: Arial Black, Bookman Old Style, DnD4Attack, Lucida Console, MS Serif, MS Outlook, MS Sans Serif, Rockwell Extra Bold, Roman, Star Time JL, Tahoma, Terminal, Times New Roman, Verdana, Wingdings 2, Wingdings 3, Wingdings } A:link { COLOR: #9966cc; TEXT-DECORATION: underline } A:visited { COLOR: #66ff66; TEXT-DECORATION: underline } A:hover { COLOR: #ffff00; TEXT-DECORATION: underline } A:active { COLOR: #ff0033; TEXT-DECORATION: underline } H1 { FONT-SIZE: 25px; COLOR: #9966cc; FONT-FAMILY: Century Gothic } H2 { FONT-SIZE: 20px; COLOR: #ff33cc; FONT-FAMILY: Century Gothic } H3 { FONT-SIZE: 18px; COLOR: #6666cc; FONT-FAMILY: Century Gothic } H4 { FONT-SIZE: 15px; COLOR: #00cc33; FONT-FAMILY: Century Gothic } H5 { FONT-SIZE: 10px; COLOR: #ffff33; FONT-FAMILY: Century Gothic } H6 { FONT-SIZE: 5px; COLOR: #996666; FONT-FAMILY: Century Gothic } </STYLE> line 46-<SCRIPT> line 47- CharNum=6; line 48-var Character=newArray();Character[0]="Larry Lightfoot";Character[1]="Sam Wrightfield";Character[2]="Gavin Hartfild";Character[3]="Gail Quickfoot";Character[4]="Robert Gragorian";Character[5]="Peter Shain"; line 49-var ExChar=newArray();ExChar[0]="Tabor Bloomfield"; line 50-var Class=newArray();Class[0]="MagicUser";Class[1]="Fighter";Class[2]="Fighter";Class[3]="Thief";Class[4]="Cleric";Class[5]="Fighter"; line 51-line 47var ExClass=newArray();ExClass[0]="MagicUser"; line 52-var Level=newArray();Level[0]="2";Level[1]="1";Level[2]="1";Level[3]="2";Level[4]="2";Level[5]="1"; line 53-var ExLevel=newArray();ExLevel[0]="23"; line 54-var Hpts=newArray();Hpts[0]="6";Hpts[1]="14";Hpts[2]="13";Hpts[3]="8";Hpts[4]="12";Hpts[5]="15"; line 55-var ExHpts=newArray();ExHpts[0]="145"; line 56-var Armor=newArray();Armor[0]="Cloak";Armor[1]="Splinted Armor";Armor[2]="Chain Armor";Armor[3]="Leather Armor";Armor[4]="Chain Armor";Armor[5]="Splinted Armor"; line 57-var ExArmor=newArray();ExArmor[0]="Robe of Protection +5"; line 58-var Ac1=newArray();Ac1[0]="0";Ac1[1]="3";Ac1[2]="3";Ac1[3]="4";Ac1[4]="2";Ac1[5]="3"; line 59-var ExAc=newArray();ExAc[0]="5"; line 60-var Armor1b=newArray();Armor1b[0]="Ring of Protection +1";Armor1b[1]="Small Shield";Armor1b[2]="Small Shield";Armor1b[3]="Wooden Shield";Armor1b[4]="Large Shield";Armor1b[5]="Small Shield"; line 61-var ExArmor1b=newArray();ExArmor1b[0]="Ring of Protection +5"; line 62-var Ac2=newArray();Ac2[0]="1";Ac2[1]="1";Ac2[2]="1";Ac2[3]="1";Ac2[4]="1";Ac2[5]="1"; line 63-var ExAc1b=newArray();ExAc1b[0]="5" line 64-var Str=newArray();Str[0]="15";Str[1]="16";Str[2]="14";Str[3]="13";Str[4]="14";Str[5]="13"; line 65-var ExStr=newArray();ExStr[0]=21; line 66-var Int=newArray();Int[0]="17";Int[1]="11";Int[2]="12";Int[3]="13";Int[4]="14";Int[5]="13"; line 67-var ExInt=newArray();ExInt[0]="19"; line 68-var Wis=newArray();Wis[0]="17";Wis[1]="12";Wis[2]="14";Wis[3]="13";Wis[4]="14";Wis[5]="12"; line 69-var ExWis=newArray();ExWis[0]="18"; line 70-var Dex=newArray();Dex[0]="15";Dex[1]="14";Dex[2]="13";Dex[3]="15";Dex[4]="14";Dex[5]="12"; line 71-var ExDex=newArray();ExDex[0]="19"; line 72-var Con=newArray();Con[0]="16";Con[1]="15";Con[2]="16";Con[3]="13";Con[4]="12";Con[5]="10"; line 73-var ExCon=newArray();ExCon[0]="19"; line 74-var Chr=newArray();Chr[0]="16";Chr[1]="14";Chr[2]="13";Chr[3]="12";Chr[4]="14";Chr[5]="13"; line 75-var ExChr=newArray();ExChr[0]="21"; line 76-var Expt=newArray();Expt[0]="45";Expt[1]="21";Expt[2]="16";Expt[3]="18";Expt[4]="22";Expt[5]="34"; line 77-var ExExpt=newArray();ExExpt[0]="245678"; line 78-var ExBp=newArray();ExBp[0]="Unknown";ExBp[1]="Extrademensional Plane World of Amborsia";ExBp[2]="Evil Wizard Banished for Mass Geniocodes"; line 79-</SCRIPT> line 80-</HEAD> line 81-<BODY> Giving an Error Object Expected Line 48 Char 1------What did I do wrong??? *Note Line # are for reference only not on Original Web page******

    Read the article

  • Why is my WCF RIA Services custom object deserializing with an extra list member?

    - by oasasaurus
    I have been developing a Silverlight WCF RIA Services application dealing with mock financial transactions. To more efficiently send summary data to the client without going overboard with serialized entities I have created a summary class that isn’t in my EDM, and figured out how to serialize and send it over the wire to the SL client using DataContract() and DataMember(). Everything seemed to be working out great, until I tried to bind controls to a list inside my custom object. The list seems to always get deserialized with an extra, almost empty entity in it that I don’t know how to get rid of. So, here are some of the pieces. First the relevant bits from the custom object class: <DataContract()> _ Public Class EconomicsSummary Public Sub New() RecentTransactions = New List(Of Transaction) TotalAccountHistory = New List(Of Transaction) End Sub Public Sub New(ByVal enUser As EntityUser) Me.UserId = enUser.UserId Me.UserName = enUser.UserName Me.Accounts = enUser.Accounts Me.Jobs = enUser.Jobs RecentTransactions = New List(Of Transaction) TotalAccountHistory = New List(Of Transaction) End Sub <DataMember()> _ <Key()> _ Public Property UserId As System.Guid <DataMember()> _ Public Property NumTransactions As Integer <DataMember()> _ <Include()> _ <Association("Summary_RecentTransactions", "UserId", "User_UserId")> _ Public Property RecentTransactions As List(Of Transaction) <DataMember()> _ <Include()> _ <Association("Summary_TotalAccountHistory", "UserId", "User_UserId")> _ Public Property TotalAccountHistory As List(Of Transaction) End Class Next, the relevant parts of the function called to return the object: Public Function GetEconomicsSummary(ByVal guidUserId As System.Guid) As EconomicsSummary Dim objOutput As New EconomicsSummary(enUser) For Each objTransaction As Transaction In (From t As Transaction In Me.ObjectContext.Transactions.Include("Account") Where t.Account.aspnet_User_UserId = guidUserId Select t Order By t.TransactionDate Descending Take 10) objTransaction.User_UserId = objOutput.UserId objOutput.RecentTransactions.Add(objTransaction) Next objOutput.NumTransactions = objOutput.RecentTransactions.Count … Return objOutput End Function Notice that I’m collecting the NumTransactions count before serialization. Should be 10 right? It is – BEFORE serialization. The DataGrid is bound to the data source as follows: <sdk:DataGrid AutoGenerateColumns="False" Height="100" MaxWidth="{Binding ElementName=aciSummary, Path=ActualWidth}" ItemsSource="{Binding Source={StaticResource EconomicsSummaryRecentTransactionsViewSource}, Mode=OneWay}" Name="gridRecentTransactions" RowDetailsVisibilityMode="VisibleWhenSelected" IsReadOnly="True"> <sdk:DataGrid.Columns> <sdk:DataGridTextColumn x:Name="TransactionDateColumn" Binding="{Binding Path=TransactionDate, StringFormat=\{0:d\}}" Header="Date" Width="SizeToHeader" /> <sdk:DataGridTextColumn x:Name="AccountNameColumn" Binding="{Binding Path=Account.Title}" Header="Account" Width="SizeToCells" /> <sdk:DataGridTextColumn x:Name="CurrencyAmountColumn" Binding="{Binding Path=CurrencyAmount, StringFormat=\{0:c\}}" Header="Amount" Width="SizeToHeader" /> <sdk:DataGridTextColumn x:Name="TitleColumn" Binding="{Binding Path=Title}" Header="Description" Width="SizeToCells" /> <sdk:DataGridTextColumn x:Name="ItemQuantityColumn" Binding="{Binding Path=ItemQuantity}" Header="Qty" Width="SizeToHeader" /> </sdk:DataGrid.Columns> </sdk:DataGrid> You might be wondering where the ItemsSource is coming from, that looks like this: <CollectionViewSource x:Key="EconomicsSummaryRecentTransactionsViewSource" Source="{Binding Path=DataView.RecentTransactions, ElementName=EconomicsSummaryDomainDataSource}" /> When I noticed that the DataGrid had the extra row I tried outputting some data after the data source finishes loading, as follows: Private Sub EconomicsSummaryDomainDataSource_LoadedData(ByVal sender As System.Object, ByVal e As System.Windows.Controls.LoadedDataEventArgs) Handles EconomicsSummaryDomainDataSource.LoadedData If e.HasError Then System.Windows.MessageBox.Show(e.Error.ToString, "Load Error", System.Windows.MessageBoxButton.OK) e.MarkErrorAsHandled() End If Dim objSummary As EconomicsSummary = CType(EconomicsSummaryDomainDataSource.Data(0), EconomicsSummary) Dim sb As New StringBuilder("") sb.AppendLine(String.Format("Num Transactions: {0} ({1})", objSummary.RecentTransactions.Count.ToString(), objSummary.NumTransactions.ToString())) For Each objTransaction As Transaction In objSummary.RecentTransactions sb.AppendLine(String.Format("Recent TransactionId {0} dated {1} CurrencyAmount {2} NewBalance {3}", objTransaction.TransactionId.ToString, objTransaction.TransactionDate.ToString("d"), objTransaction.CurrencyAmount.ToString("c"), objTransaction.NewBalance.ToString("c"))) Next txtDebug.Text = sb.ToString() End Sub Output from that looks like this: Num Transactions: 11 (10) Recent TransactionId 2283 dated 6/1/2010 CurrencyAmount $31.00 NewBalance $392.00 Recent TransactionId 2281 dated 5/31/2010 CurrencyAmount $33.00 NewBalance $361.00 Recent TransactionId 2279 dated 5/28/2010 CurrencyAmount $8.00 NewBalance $328.00 Recent TransactionId 2277 dated 5/26/2010 CurrencyAmount $22.00 NewBalance $320.00 Recent TransactionId 2275 dated 5/24/2010 CurrencyAmount $5.00 NewBalance $298.00 Recent TransactionId 2273 dated 5/21/2010 CurrencyAmount $19.00 NewBalance $293.00 Recent TransactionId 2271 dated 5/20/2010 CurrencyAmount $20.00 NewBalance $274.00 Recent TransactionId 2269 dated 5/19/2010 CurrencyAmount $48.00 NewBalance $254.00 Recent TransactionId 2267 dated 5/18/2010 CurrencyAmount $42.00 NewBalance $206.00 Recent TransactionId 2265 dated 5/14/2010 CurrencyAmount $5.00 NewBalance $164.00 Recent TransactionId 0 dated 6/1/2010 CurrencyAmount $0.00 NewBalance $361.00 So I have a few different questions: -First and foremost, where the devil is that extra Transaction entity coming from and how do I get rid of it? Does it have anything to do with the other list of Transaction entities being serialized as part of the EconomicsSummary class (TotalAccountHistory)? Do I need to decorate the EconomicsSummary class members a little more/differently? -Second, where are the peculiar values coming from on that extra entity? PRE-POSTING UPDATE 1: I did a little checking, it looks like that last entry is the first one in the TotalAccountHistory list. Do I need to do something with CollectionDataContract()? PRE-POSTING UPDATE 2: I fixed one bug in TotalAccountHistory, since the objects weren’t coming from the database their keys weren’t unique. So I set the keys on the Transaction entities inside TotalAccountHistory to be unique and guess what? Now, after deserialization RecentTransactions contains all its original items, plus every item in TotalAccountHistory. I’m pretty sure this has to do with the deserializer getting confused by two collections of the same type. But I don’t yet know how to resolve it…

    Read the article

  • display data from json file in datagrid

    - by kayn
    I want to display data from a json files in a data grid using dojo ver 1.0.0. I am able to diplay the data when i declare it on my code but when i store the same data in a json format so i can reference it in my script,i get an empty grid. This is my json file; { data: [ ['10''myfile','Css', 'CS Degree','Dr. Bottoman','This is mine'], ['10'myfile2','CS716', 'CS Degree','Prof Frank', 'This is course'], ['10'myfile3 ','CS714', 'CS Degree', 'Dr. Ree', 'Welcome'], ['14', 'myfile4','CS772', 'CS Degree', 'Mr. Boss', 'This will display content' ], ['18', 'myfile5','CS774', 'CS Degree','Ms. Kirk', 'This is networks.' ] ] } and below is my code; @import "../../../dojo/resources/dojo.css"; @import "../_grid/Grid.css"; body { font-size: 1.0em; } #grid { height: 400px; border: 1px solid silver; } .text-oneline { white-space: nowrap; overflow: hidden; text-overflow: ellipsis; } .text-scrolling { height: 4em; overflow: auto; } .text-scrolling { width: 21.5em; } dojo.require("dojox.grid.Grid"); dojo.require("dojox.grid._data.model"); dojo.require("dojo.parser"); <script type="text/javascript"> /*<span dojoType="dojo.data.ItemFileWriteStore" jsId="myStore" url="course.json"> </span>*/ data = [ ['10''myfile','Css', 'CS Degree','Dr. Bottoman','This is mine'], ['10'myfile2','CS716', 'CS Degree','Prof Frank', 'This is course'], ['10'myfile3 ','CS714', 'CS Degree', 'Dr. Ree', 'Welcome'], ['14', 'myfile4','CS772', 'CS Degree', 'Mr. Boss', 'This will display content' ], ['18', 'myfile5','CS774', 'CS Degree','Ms. Kirk', 'This is networks.' ] ]; getDetailData = function(inRowIndex) { var row = data[this.grid.dataRow % data.length ]; switch (this.index) { case 0: return row[5]; case 1: return row[2]; case 2: return row[0]; case 3: return row[1]; case 4: return row[3]; case 5: return row[4]; default: return row[this.index]; } } getName = function(inRowIndex) { var row = data[inRowIndex % data.length]; return row[1]; } // Main grid structure var gridCells = [ { type: 'dojox.GridRowView', width: '20px' }, { onBeforeRow: function(inDataIndex, inSubRows) { inSubRows[1].hidden = !detailRows[inDataIndex]; }, cells: [[ { name: 'Master', width: 3, get: getCheck, styles: 'text-align: center;' }, { name: 'Detail', get: getName, width: 60 }, ], [ { name: '', get: getDetail, colSpan: 2, styles: 'padding: 0; margin: 0;'} ]] } ]; // html for the +/- cell function getCheck(inRowIndex) { var image = (detailRows[inRowIndex] ? 'open.gif' : 'closed.gif'); var show = (detailRows[inRowIndex] ? 'false' : 'true') return ''; } // provide html for the Detail cell in the master grid function getDetail(inRowIndex) { var cell = this; // we can affect styles and content here, but we have to wait to access actual nodes setTimeout(function() { buildDetailgrid(inRowIndex, cell); }, 1); // look for a Detailgrid var Detailgrid = dijit.byId(makeDetailgridId(inRowIndex)); var h = (Detailgrid ? Detailgrid.cacheHeight : "120") + "px"; // insert a placeholder return ''; } // the Detail cell contains a Detailgrid which we set up below var DetailgridCells = [{ noscroll: true, cells: [ [ {name: "Brief Course Description",width: "auto"}, {name: "Course Code" }, {name: "Credits" }, {name: "Subject" }, {name: "Prerequisite" }, {name: "Lecturer"}], [] ]}]; var DetailgridProps = { structure: DetailgridCells, rowCount: 1, autoHeight: true, autoRender: false, "get": getDetailData }; // identify Detailgrids by their row indices function makeDetailgridId(inRowIndex) { return grid.widgetId + "Detailgrid"/+ inRowIndex/; } // if a Detailgrid exists at inRowIndex, detach it from the DOM function detachDetailgrid(inRowIndex) { var Detailgrid = dijit.byId(makeDetailgridId(inRowIndex)); if (Detailgrid) dojox.grid.removeNode(Detailgrid.domNode); } // render a Detailgrid into inCell at inRowIndex function buildDetailgrid(inRowIndex, inCell) { var n = inCell.getNode(inRowIndex).firstChild; var id = makeDetailgridId(inRowIndex); var Detailgrid = dijit.byId(id); if (Detailgrid) { n.appendChild(Detailgrid.domNode); } else { DetailgridProps.dataRow = inRowIndex; DetailgridProps.widgetId = id; Detailgrid = new dojox.VirtualGrid(DetailgridProps, n); } if (Detailgrid) { Detailgrid.render(); Detailgrid.cacheHeight = Detailgrid.domNode.offsetHeight; inCell.grid.rowHeightChanged(inRowIndex); } } // destroy Detailgrid at inRowIndex function destroyDetailgrid(inRowIndex) { var Detailgrid = dijit.byId(makeDetailgridId(inRowIndex)); if (Detailgrid) Detailgrid.destroy(); } // when user clicks the +/- detailRows = []; function toggleDetail(inIndex, inShow) { if (!inShow) detachDetailgrid(inIndex); detailRows[inIndex] = inShow; grid.updateRow(inIndex); } dojo.addOnLoad(function() { window["grid"] = dijit.byId("grid"); dojo.connect(grid, 'rowRemoved', destroyDetailgrid); }); Test grid

    Read the article

  • Prime Numbers Code Help

    - by andrew
    Hello Everybody, I am suppose to "write a Java program that reads a positive integer n from standard input, then prints out the first n prime number." It's divided into 3 parts. 1st: This function will return true or false according to whether m is prime or composite. The array argument P will contain a sufficient number of primes to do the testing. Specifically, at the time isPrime() is called, array P must contain (at least) all primes p in the range 2 p m . For instance, to test m = 53 for primality, one must do successive trial divisions by 2, 3, 5, and 7. We go no further since 11 53 . Thus a precondition for the function call isPrime(53, P) is that P[0] = 2 , P[1] = 3 , P[2] = 5, and P[3] = 7 . The return value in this case would be true since all these divisions fail. Similarly to test m =143 , one must do trial divisions by 2, 3, 5, 7, and 11 (since 13 143 ). The precondition for the function call isPrime(143, P) is therefore P[0] = 2 , P[1] = 3 , P[2] = 5, P[3] = 7 , and P[4] =11. The return value in this case would be false since 11 divides 143. Function isPrime() should contain a loop that steps through array P, doing trial divisions. This loop should terminate when 2 either a trial division succeeds, in which case false is returned, or until the next prime in P is greater than m , in which case true is returned. Then there is the "main function" • Check that the user supplied exactly one command line argument which can be interpreted as a positive integer n. If the command line argument is not a single positive integer, your program will print a usage message as specified in the examples below, then exit. • Allocate array Primes[] of length n and initialize Primes[0] = 2 . • Enter a loop which will discover subsequent primes and store them as Primes[1] , Primes[2], Primes[3] , ……, Primes[n -1] . This loop should contain an inner loop which walks through successive integers and tests them for primality by calling function isPrime() with appropriate arguments. • Print the contents of array Primes[] to stdout, 10 to a line separated by single spaces. In other words Primes[0] through Primes[9] will go on line 1, Primes[10] though Primes[19] will go on line 2, and so on. Note that if n is not a multiple of 10, then the last line of output will contain fewer than 10 primes. The last function is called "usage" which I am not sure how to execute this! Your program will include a function called Usage() having signature static void Usage() that prints this message to stderr, then exits. Thus your program will contain three functions in all: main(), isPrime(), and Usage(). Each should be preceded by a comment block giving it’s name, a short description of it’s operation, and any necessary preconditions (such as those for isPrime().) And hear is my code, but I am having a bit of a problem and could you guys help me fix it? If I enter the number "5" it gives me the prime numbers which are "6,7,8,9" which doesn't make much sense. import java.util.; import java.io.; import java.lang.*; public class PrimeNumber { static boolean isPrime(int m, int[] P){ int squarert = Math.round( (float)Math.sqrt(m) ); int i = 2; boolean ans=false; while ((i<=squarert) & (ans==false)) { int c= P[i]; if (m%c==0) ans= true; else ans= false; i++; } /* if(ans ==true) ans=false; else ans=true; return ans; } ///****main public static void main(String[] args ) { Scanner in= new Scanner(System.in); int input= in.nextInt(); int i, j; int squarert; boolean ans = false; int userNum; int remander = 0; System.out.println("input: " + input); int[] prime = new int[input]; prime[0]= 2; for(i=1; i ans = isPrime(j,prime); j++;} prime[i] = j; } //prnt prime System.out.println("The first " + input + " prime number(s) are: "); for(int r=0; r }//end of main } Thanks for the help

    Read the article

  • XSLT Escape Character not working

    - by liveek
    I am trying to use escape charaters in my text output, as i would like too surround the output in emailData tags. I am using <xsl:text>&#60;emailData&#62;</xsl:text> In the XSLT to esnure that this works however because i am using a tool called Cast Iron for some reason it is not converting the &#60; into < and just spits out &lt;emailData> You can see am image of it HERE that illustrates the output i am getting. My source code is this. How else could i wrap this in emailData tags? <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/XSL/Transform"> <xsl:output method="text"/> <xsl:template match="header"> <xsl:text>&#60;emailData&#62;</xsl:text> <xsl:text>&#10;</xsl:text> <xsl:text>From: </xsl:text> <xsl:value-of select="from/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text>To: </xsl:text> <xsl:value-of select="to/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text>Subject: </xsl:text> <xsl:value-of select="subject/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text>Content-Type: </xsl:text> <xsl:value-of select="contentType/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text> boundary="</xsl:text> <xsl:value-of select="boundary/text()"/> <xsl:text>"</xsl:text> <xsl:text>&#10;</xsl:text> <xsl:text>MIME-Version: </xsl:text> <xsl:value-of select="mimeVersion/text()"/> </xsl:template> <xsl:template match="email"> <xsl:text>&#10;&#10;</xsl:text> <xsl:text>--</xsl:text> <xsl:value-of select="../header/boundary/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text>Content-Type: </xsl:text> <xsl:value-of select="contentTypeBody/text()"/> <xsl:text> charset="us-ascii"</xsl:text> <xsl:text>&#10;</xsl:text> <xsl:text>Content-Transfer-Encoding: </xsl:text> <xsl:value-of select="contentTransfer/text()"/> <xsl:text>&#10;&#10;</xsl:text> <xsl:value-of select="body/text()"/> </xsl:template> <xsl:template match="Attachment"> <xsl:for-each select="Attachments"> <xsl:text>&#0010;&#0010;</xsl:text> <xsl:value-of select="../../header/boundary/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text>Content-Type: </xsl:text> <xsl:value-of select="attachmentContentType/text()"/> <xsl:text> name="</xsl:text> <xsl:value-of select="attachmentDescription/text()"/> <xsl:text>"</xsl:text> <xsl:text>&#10;</xsl:text> <xsl:text>Content-Description: </xsl:text> <xsl:value-of select="attachmentDescription/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text>Content-Disposition: attachment; filename="</xsl:text> <xsl:value-of select="atachementDisposition/text()"/> <xsl:text>"</xsl:text> <xsl:text>&#10;</xsl:text> <xsl:text>Content-Transfer-Encoding: </xsl:text> <xsl:value-of select="attachmentContentTransfer/text()"/> <xsl:text>&#10;&#10;</xsl:text> <xsl:value-of select="attachementBody/text()"/> <xsl:text>&#10;</xsl:text> <xsl:text>&#60;/emailData&#62;</xsl:text> </xsl:for-each> </xsl:template> <xsl:template match="text()"/> </xsl:stylesheet>

    Read the article

  • ASP.NET MVC - Views location Problem : The view 'Index' or its master was not found

    - by user326873
    Hi all, I've create an asp.net MVC 2 project, it works fine!! I've been asked to integrate the project in an existing web project in classic asp.net (I've add the folder containing the source, and not make a new project, because they have to bee in same project) I've configured my web.config file <pages pageBaseType="System.Web.UI.Page" > <controls> <add tagPrefix="asp" namespace="System.Web.UI" assembly="System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add tagPrefix="asp" namespace="System.Web.UI.WebControls" assembly="System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> </controls> <namespaces> <add namespace="System.Web.Mvc" /> <add namespace="System.Web.Mvc.Ajax" /> <add namespace="System.Web.Mvc.Html" /> <add namespace="System.Web.Routing" /> <add namespace="System.Linq" /> <add namespace="System.Collections.Generic" /> <add namespace="SearchApp.Helpers.CheckBoxList"/> <add namespace="SearchApp.Helpers.Pager"/> </namespaces> </pages> <httpModules> <add name="ScriptModule" type="System.Web.Handlers.ScriptModule, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> <add name="UrlRoutingModule" type="System.Web.Routing.UrlRoutingModule, System.Web.Routing, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35" /> </httpModules> <!--- END MVC config section--> and my global.asax file (I'm working under IIS 5.1) : public static void RegisterRoutes(RouteCollection routes) { routes.IgnoreRoute("{resource}.axd/{*pathInfo}"); routes.MapRoute( "SearchApp", // Route name "SearchApp/{controller}.aspx/{action}/{id}", // URL with parameters new { controller = "Search", action = "Index", id = "" } // Parameter defaults ); } protected void Application_Start(Object sender, EventArgs e) { AreaRegistration.RegisterAllAreas(); RegisterRoutes(RouteTable.Routes); } The hierarchy of the project is (I can’t find how to insert Image in the post): +Project ++MVC2AppFolder +++Controller ++++SearchController.cs +++Views ++++Search +++++Index.aspx ++global.asax ++web.config as you can see the global.asax is not in the MVC App folder when I try to access the page Search/index.aspx using this url http://localhost/cstfwsrv/SearchApp/Search.aspx/Index[^] have the following error : I The view 'Index' or its master was not found. The following locations were searched: ~/Views/Search/Index.aspx ~/Views/Search/Index.ascx ~/Views/Shared/Index.aspx ~/Views/Shared/Index.ascx Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.InvalidOperationException: The view 'Index' or its master was not found. The following locations were searched: ~/Views/Search/Index.aspx ~/Views/Search/Index.ascx ~/Views/Shared/Index.aspx ~/Views/Shared/Index.ascx Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [InvalidOperationException: The view 'Index' or its master was not found. The following locations were searched: ~/Views/Search/Index.aspx ~/Views/Search/Index.ascx ~/Views/Shared/Index.aspx ~/Views/Shared/Index.ascx] System.Web.Mvc.ViewResult.FindView(ControllerContext context) +253553 System.Web.Mvc.ViewResultBase.ExecuteResult(ControllerContext context) +139 System.Web.Mvc.ControllerActionInvoker.InvokeActionResult(ControllerContext controllerContext, ActionResult actionResult) +10 System.Web.Mvc.<>c__DisplayClass14.<InvokeActionResultWithFilters>b__11() +20 System.Web.Mvc.ControllerActionInvoker.InvokeActionResultFilter(IResultFilter filter, ResultExecutingContext preContext, Func`1 continuation) +251 System.Web.Mvc.<>c__DisplayClass16.<InvokeActionResultWithFilters>b__13() +19 System.Web.Mvc.ControllerActionInvoker.InvokeActionResultWithFilters(ControllerContext controllerContext, IList`1 filters, ActionResult actionResult) +178 System.Web.Mvc.ControllerActionInvoker.InvokeAction(ControllerContext controllerContext, String actionName) +314 System.Web.Mvc.Controller.ExecuteCore() +105 System.Web.Mvc.ControllerBase.Execute(RequestContext requestContext) +39 System.Web.Mvc.ControllerBase.System.Web.Mvc.IController.Execute(RequestContext requestContext) +7 System.Web.Mvc.<>c__DisplayClass8.<BeginProcessRequest>b__4() +34 System.Web.Mvc.Async.<>c__DisplayClass1.<MakeVoidDelegate>b__0() +21 System.Web.Mvc.Async.<>c__DisplayClass8`1.<BeginSynchronous>b__7(IAsyncResult _) +12 System.Web.Mvc.Async.WrappedAsyncResult`1.End() +59 System.Web.Mvc.MvcHandler.EndProcessRequest(IAsyncResult asyncResult) +44 System.Web.Mvc.MvcHandler.System.Web.IHttpAsyncHandler.EndProcessRequest(IAsyncResult result) +7 System.Web.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() +8677678 System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) +155 As you can see he search for the Index.aspx page under ~/Views/Search/Index.aspx , wich is under ~/MVC2AppFolder/Views/Search/Index.aspx Is there a way to set in the Route Method, or any where else, the View Path? Thanks’ in advance

    Read the article

  • Having an issue with Onejar-Maven-Plugin

    - by reverendgreen
    I am trying to package a simple maven java project (uses javax.persistence api) into a single jar using the onejar-maven-plugin. I can run the program fine in eclipse; however when execute the onejar I get the exception below. If someone could provide some insight, that would be appreciated. Thanks, RG Exception in thread "main" java.lang.reflect.InvocationTargetException at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(Unknown Source) at java.lang.reflect.Method.invoke(Unknown Source) at com.simontuffs.onejar.Boot.run(Boot.java:306) at com.simontuffs.onejar.Boot.main(Boot.java:159) Caused by: Exception [EclipseLink-30005] (Eclipse Persistence Services - 2.0.0.v20091127-r5931): org.eclipse.persistence.exceptions.PersistenceUnitLoadingExcept Exception Description: An exception was thrown while searching for persistence archives with ClassLoader: com.simontuffs.onejar.JarClassLoader@190d11 Internal Exception: java.lang.ClassCastException: sun.misc.Launcher$AppClassLoader cannot be cast to com.simontuffs.onejar.JarClassLoader at org.eclipse.persistence.exceptions.PersistenceUnitLoadingException.exceptionSearchingForPersistenceResources(PersistenceUnitLoadingException.java:126 at org.eclipse.persistence.jpa.PersistenceProvider.createEntityManagerFactory(PersistenceProvider.java:133) at org.eclipse.persistence.jpa.PersistenceProvider.createEntityManagerFactory(PersistenceProvider.java:65) at javax.persistence.Persistence.createEntityManagerFactory(Persistence.java:78) at javax.persistence.Persistence.createEntityManagerFactory(Persistence.java:54) at com.test.onejartest.App.main(App.java:19) ... 6 more Caused by: java.lang.ClassCastException: sun.misc.Launcher$AppClassLoader cannot be cast to com.simontuffs.onejar.JarClassLoader at com.simontuffs.onejar.JarClassLoader.getByteStream(JarClassLoader.java:753) at com.simontuffs.onejar.Handler$1.getInputStream(Handler.java:50) at java.net.URL.openStream(Unknown Source) at org.eclipse.persistence.internal.jpa.deployment.ArchiveFactoryImpl.isJarInputStream(ArchiveFactoryImpl.java:124) at org.eclipse.persistence.internal.jpa.deployment.ArchiveFactoryImpl.createArchive(ArchiveFactoryImpl.java:106) at org.eclipse.persistence.internal.jpa.deployment.PersistenceUnitProcessor.findPersistenceArchives(PersistenceUnitProcessor.java:213) at org.eclipse.persistence.internal.jpa.deployment.JPAInitializer.findPersistenceUnitInfoInArchives(JPAInitializer.java:134) at org.eclipse.persistence.internal.jpa.deployment.JPAInitializer.findPersistenceUnitInfo(JPAInitializer.java:125) at org.eclipse.persistence.jpa.PersistenceProvider.createEntityManagerFactory(PersistenceProvider.java:98) ... 10 more pom.xml: ... <pluginRepositories> <pluginRepository> <id>onejar-maven-plugin.googlecode.com</id> <url>http://onejar-maven-plugin.googlecode.com/svn/mavenrepo</url> </pluginRepository> </pluginRepositories> ... <build> <plugins> <plugin> <groupId>org.dstovall</groupId> <artifactId>onejar-maven-plugin</artifactId> <version>1.3.0</version> <executions> <execution> <configuration> <mainClass>com.test.onejartest.App</mainClass> </configuration> <goals> <goal>one-jar</goal> </goals> </execution> </executions> </plugin> <plugin> <artifactId>maven-compiler-plugin</artifactId> <version>2.3.1</version> <configuration> <target>1.6</target> <source>1.6</source> </configuration> </plugin> </plugins> </build> ... <dependencies> <dependency> <groupId>javax.persistence</groupId> <artifactId>persistence-api</artifactId> <version>2.0.0</version> </dependency> <dependency> <groupId>org.eclipse.persistence</groupId> <artifactId>eclipselink</artifactId> <version>2.0.0</version> </dependency> <dependency> <groupId>com.microsoft.sqlserver.jdbc</groupId> <artifactId>sqljdbc</artifactId> <version>4.0.0</version> </dependency> </dependencies>

    Read the article

  • Android app in eclipse

    - by Colin
    Hello everybody, i've searched for days but cant find an answer, perhaps you guys can help. I'm creating an android app in eclipse, it all works just one thing is bugging me. this is my main.java: package com.test; import android.app.Activity; import android.content.Intent; import android.os.Bundle; import android.view.View; import android.view.View.OnClickListener; import android.widget.Toast; public class Main extends Activity implements OnClickListener { /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); // Add Click listeners for all buttons View firstButton = findViewById(R.id.btn_rassen); firstButton.setOnClickListener(this); View secondButton = findViewById(R.id.button2); secondButton.setOnClickListener(this); } // Process the button click events @Override public void onClick(View v) { switch(v.getId()){ case R.id.btn_rassen: Intent j = new Intent(this, Webscreen.class); j.putExtra(com.test.Webscreen.URL, "http://www.google.com/"); startActivity(j); break; case R.id.button2: Intent k = new Intent(this, Webscreen.class); k.putExtra(com.test.Webscreen.URL, "http://notworkingurltotest.com"); startActivity(k); break; } } } now when it calls the webview.java the page called shows up but not the buttons i created in the layout xml page. does anybody have any idea why this is? your help is much appreciated! ohw this is my webscreen.java package com.test; import android.app.Activity; import android.app.AlertDialog; import android.app.ProgressDialog; import android.content.DialogInterface; import android.content.Intent; import android.net.Uri; import android.os.Bundle; import android.util.Log; import android.view.Window; import android.webkit.WebSettings; import android.webkit.WebView; import android.webkit.WebViewClient; import android.widget.Toast; public class Webscreen extends Activity { public static final String URL = ""; private static final String TAG = "WebscreenClass"; private WebView webview; private ProgressDialog progressDialog; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); requestWindowFeature(Window.FEATURE_NO_TITLE); setContentView(R.layout.webscreen); this.getIntent().getExtras(); this.webview = (WebView) findViewById(R.string.webview); String turl = getIntent().getStringExtra(URL); Log.i(TAG, " URL = "+turl); WebView webview = new WebView(this); setContentView(webview); final Activity activity = this; webview.setWebViewClient(new WebViewClient() { public boolean shouldOverrideUrlLoading(WebView view, String url) { view.loadUrl(url); return true; } public void onLoadResource (WebView view, String url) { if (progressDialog == null) { progressDialog = new ProgressDialog(activity); progressDialog.setMessage("Bezig met laden..."); progressDialog.show(); } } public void onPageFinished(WebView view, String url) { if (progressDialog.isShowing()) { progressDialog.dismiss(); progressDialog = null; } } public void onReceivedError(WebView view, int errorCode, String description, String failingUrl) { Intent myIntent = new Intent(); myIntent.setClassName("com.test", "com.test.Main"); startActivity(myIntent); Toast.makeText(activity, "Laden van onderdeel mislukt, probeer het later nog eens! ", Toast.LENGTH_LONG).show(); progressDialog.show(); } }); webview.loadUrl(turl); } } webscreen.xml layout: <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent"> <!-- <1> --> <LinearLayout android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content"> <EditText android:id="@+id/url" android:layout_height="wrap_content" android:layout_width="wrap_content" android:lines="1" android:layout_weight="1.0" android:hint="http://" android:visibility="visible" /> <Button android:id="@+id/go_button" android:layout_height="wrap_content" android:layout_width="wrap_content" android:text="go_button" /> </LinearLayout> <!-- <2> --> <WebView android:id="@string/webview" android:layout_width="fill_parent" android:layout_height="0dip" /> </LinearLayout>

    Read the article

  • Drupal: Create custom search

    - by Dr. Hfuhruhurr
    I'm trying to create a custom search but getting stuck. What I want is to have a dropdownbox so the user can choose where to search in. These options can mean 1 or more content types. So if he chooses options A, then the search will look in node-type P,Q,R. But he may not give those results, but only the uid's which will be then themed to gather specific data for that user. To make it a little bit clearer, Suppose I want to llok for people. The what I'm searching in is 2 content profile types. But ofcourse you dont want to display those as a result, but a nice picture of the user and some data. I started with creating a form with a textfield and the dropdown box. Then, in the submit handler, i created the keys and redirected to another pages with those keys as a tail. This page has been defined in the menu hook, just like how search does it. After that I want to call hook_view to do the actual search by calling node_search, and give back the results. Unfortunately, it goes wrong. When i click the Search button, it gives me a 404. But am I on the right track? Is this the way to create a custom search? Thx for your help. Here's the code for some clarity: <?php // $Id$ /* * @file * Searches on Project, Person, Portfolio or Group. */ /** * returns an array of menu items * @return array of menu items */ function vm_search_menu() { $subjects = _vm_search_get_subjects(); foreach ($subjects as $name => $description) { $items['zoek/'. $name .'/%menu_tail'] = array( 'page callback' => 'vm_search_view', 'page arguments' => array($name), 'type' => MENU_LOCAL_TASK, ); } return $items; } /** * create a block to put the form into. * @param $op * @param $delta * @param $edit * @return mixed */ function vm_search_block($op = 'list', $delta = 0, $edit = array()) { switch ($op) { case 'list': $blocks[0]['info'] = t('Algemene zoek'); return $blocks; case 'view': if (0 == $delta) { $block['subject'] = t(''); $block['content'] = drupal_get_form('vm_search_general_form'); } return $block; } } /** * Define the form. */ function vm_search_general_form() { $subjects = _vm_search_get_subjects(); foreach ($subjects as $key => $subject) { $options[$key] = $subject['desc']; } $form['subjects'] = array( '#type' => 'select', '#options' => $options, '#required' => TRUE, ); $form['keys'] = array( '#type' => 'textfield', '#required' => TRUE, ); $form['submit'] = array( '#type' => 'submit', '#value' => t('Zoek'), ); return $form; } function vm_search_general_form_submit($form, &$form_state) { $subjects = _vm_search_get_subjects(); $keys = $form_state['values']['keys']; //the search keys //the content types to search in $keys .= ' type:' . implode(',', $subjects[$form_state['values']['subjects']]['types']); //redirect to the page, where vm_search_view will handle the actual search $form_state['redirect'] = 'zoek/'. $form_state['values']['subjects'] .'/'. $keys; } /** * Menu callback; presents the search results. */ function vm_search_view($type = 'node') { // Search form submits with POST but redirects to GET. This way we can keep // the search query URL clean as a whistle: // search/type/keyword+keyword if (!isset($_POST['form_id'])) { if ($type == '') { // Note: search/node can not be a default tab because it would take on the // path of its parent (search). It would prevent remembering keywords when // switching tabs. This is why we drupal_goto to it from the parent instead. drupal_goto($front_page); } $keys = search_get_keys(); // Only perform search if there is non-whitespace search term: $results = ''; if (trim($keys)) { // Log the search keys: watchdog('vm_search', '%keys (@type).', array('%keys' => $keys, '@type' => $type)); // Collect the search results: $results = node_search('search', $type); if ($results) { $results = theme('box', t('Zoek resultaten'), $results); } else { $results = theme('box', t('Je zoek heeft geen resultaten opgeleverd.')); } } } return $results; } /** * returns array where to look for * @return array */ function _vm_search_get_subjects() { $subjects['opdracht'] = array('desc' => t('Opdracht'), 'types' => array('project') ); $subjects['persoon'] = array('desc' => t('Persoon'), 'types' => array('types_specialisatie', 'smaak_en_interesses') ); $subjects['groep'] = array('desc' => t('Groep'), 'types' => array('Villamedia_groep') ); $subjects['portfolio'] = array('desc' => t('Portfolio'), 'types' => array('artikel') ); return $subjects; }

    Read the article

  • Gallery items become off-center when switching into landscape orientation.

    - by Sandile
    Hey Guys, Thanks for your time. I'm writing an application for android 2.2 and I'm using a gallery to circulate through a list of images that the user can then click to navigate other portions of the application. In portrait orientation, everything is kosher: the images are displaying correctly (completely in the center of the screen as I intended); however, in landscape orientation, all the images in the gallery are strangely displaced a fixed distance to the left of the center of the screen. I've been researching this issue for hours now and haven't found a solution. I'm hoping that some android guru can aid me in the resolution of this bizarre rendering issue. MainMenuActivity.java relevant code snippet (the activity in which the gallery resides) Gallery optionList = (Gallery)findViewById(R.id.mainMenuOptionList); GalleryItem[] optionListItemIdArray = new GalleryItem[] { new GalleryItem(R.drawable.icon_main_menu_option_list_blackboard, "Start Next Lesson", "Start the next planned vocab lesson."), new GalleryItem(R.drawable.icon_main_menu_option_list_index_cards, "Review Words", "Manually look over old words."), new GalleryItem(R.drawable.icon_main_menu_option_list_dice, "Play Vocab Games", "Play games to reinforce knowledge."), new GalleryItem(R.drawable.icon_main_menu_option_list_calendar, "View Lesson Plan", "View the schedule for coming lessons."), new GalleryItem(R.drawable.icon_main_menu_option_list_pie_chart, "View Performance Report", "Evaluate your overall performance statistics."), new GalleryItem(R.drawable.icon_main_menu_option_list_settings, "Manage Settings", "Change and modify application settings.") }; optionList.setAdapter(new GalleryImageAdapter(this, optionListItemIdArray)); NOTE: A GalleryItem is a POJO with an image resource id, title and description. GalleryImageAdapter.java: public class GalleryImageAdapter extends BaseAdapter { private Context context; private GalleryItem[] galleryItemArray; public GalleryImageAdapter(Context context, GalleryItem[] galleryItemArray) { this.context = context; this.galleryItemArray = galleryItemArray; } @Override public int getCount() { return galleryItemArray.length; } @Override public Object getItem(int position) { return position; } @Override public long getItemId(int position) { return position; } @Override public View getView(int position, View convertView, ViewGroup parent) { ImageView imageView = new ImageView(context); imageView.setImageResource(galleryItemArray[position].getImageId()); imageView.setScaleType(ImageView.ScaleType.FIT_START); imageView.setLayoutParams(new Gallery.LayoutParams(Gallery.LayoutParams.WRAP_CONTENT, Gallery.LayoutParams.WRAP_CONTENT)); return imageView; } } Portrait version of main_menu.xml <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/mainMenuLinearLayout" android:background="#3067a8" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:id="@+id/mainMenuHeadingTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:paddingLeft="10dip" android:textColor="#ffffff" android:textSize="50sp" android:text="@string/main_menu_heading" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> <TextView android:id="@+id/mainMenuSubHeadingTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:paddingLeft="15dip" android:textColor="#ffffff" android:textSize="15sp" android:text="@string/main_menu_sub_heading" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> <Gallery xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/mainMenuOptionList" android:layout_width="fill_parent" android:layout_height="wrap_content" android:paddingTop="20dip" android:paddingBottom="10dip" android:spacing="40dip" /> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/mainMenuOptionListDetailLinearLayout" android:gravity="center_vertical|center_horizontal" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:id="@+id/mainMenuOptionListLabelTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:textColor="#ffffff" android:textSize="25sp" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> <TextView android:id="@+id/mainMenuOptionListDescriptionTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:textColor="#ffffff" android:textSize="15sp" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> </LinearLayout> </LinearLayout> Landscape version of main_menu.xml <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/mainMenuLinearLayout" android:background="#3067a8" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:id="@+id/mainMenuHeadingTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:paddingLeft="10dip" android:textColor="#ffffff" android:textSize="50sp" android:text="@string/main_menu_heading" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> <TextView android:id="@+id/mainMenuSubHeadingTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:paddingLeft="15dip" android:textColor="#ffffff" android:textSize="15sp" android:text="@string/main_menu_sub_heading" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> <Gallery xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/mainMenuOptionList" android:layout_width="fill_parent" android:layout_height="128dip" android:paddingLeft="0dip" android:paddingTop="5dip" android:spacing="10dip" /> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/mainMenuOptionListDetailLinearLayout" android:gravity="center_vertical|center_horizontal" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" > <TextView android:id="@+id/mainMenuOptionListLabelTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:textColor="#ffffff" android:textSize="25sp" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> <TextView android:id="@+id/mainMenuOptionListDescriptionTextView" android:layout_width="wrap_content" android:layout_height="wrap_content" android:textColor="#ffffff" android:textSize="15sp" android:shadowColor="#555555" android:shadowDx="0" android:shadowDy="0" android:shadowRadius="2" /> </LinearLayout> </LinearLayout> Thank you for your time!

    Read the article

  • Themes wont work when using Server Side Tags on an ASP.NET Page

    - by Sumit Sharma
    The code for the asp.net page is: <div class="facebox_content"> <% if (CurrentUser.Role == "Free") { %> <table cellpadding="0" cellspacing="0" style="border-collapse:collapse;width:380px;"> <tr> <td> User Name : </td> <td> Membership Cost : </td> </tr> <tr> <td style="width:190px;"> <asp:TextBox ID="txtUserName" Enabled="false" runat="server" Text="<%= CurrentUser.Name %>"/> </td> <td style="width:190px;"> <asp:TextBox ID="txtCost" Enabled="false" runat="server" Text="2000"/> </td> </tr> <tr> <td> <br /> Cheque / Draft No.: </td> <td> <br /> Bank Drawn On : </td> </tr> <tr> <td style="width:190px;"> <asp:TextBox ID="txtChqNo" runat="server"></asp:TextBox> </td> <td style="width:190px;"> <asp:TextBox ID="txtBankName" runat="server"></asp:TextBox> </td> </tr> <tr> <td> <br /> Date : </td> <td> <br /> City : </td> </tr> <tr> <td style="width:190px;"> <asp:TextBox ID="txtDate" runat="server"></asp:TextBox> </td> <td style="width:190px;"> <asp:TextBox ID="txtCity" runat="server"></asp:TextBox> </td> </tr> </table> <% } else if(CurrentUser.Role == "Pending") { %> <p style="text-align:justify;"> Your Request is pending with our Administrators. Please be patient while your request is processed. Usually it takes 2-4 Days for your request to be processed after the payment has been received. </p> <% } else if(CurrentUser.Role == "Paid") { %> <p style="text-align:justify;"> You are already a Paid Member of Website </p> <% } %> The code for the C# file is: protected void Page_PreInit(object sender, EventArgs e) { this.Theme = CurrentUser.Theme; } protected void Page_Load(object sender, EventArgs e) { txtUserName.Text = CurrentUser.Name; ConfirmButton.Attributes.Add("onclick", "javascript:document.getElementById('" + lblMsg.ClientID + "').style.display='none';"); if (CurrentUser.Role != "Free") ConfirmButton.Visible = false; } The code is giving the following error: The Controls collection cannot be modified because the control contains code blocks (i.e. <% ... %>). Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Web.HttpException: The Controls collection cannot be modified because the control contains code blocks (i.e. <% ... %>). Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [HttpException (0x80004005): The Controls collection cannot be modified because the control contains code blocks (i.e. <% ... %>).] System.Web.UI.ControlCollection.Add(Control child) +8678903 System.Web.UI.PageTheme.SetStyleSheet() +478 System.Web.UI.Page.OnInit(EventArgs e) +8699660 System.Web.UI.Control.InitRecursive(Control namingContainer) +333 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +378 Please some one help me out..!!

    Read the article

  • C# MVC: User Password Reset Controller: Issues with email addresses as usernames

    - by 109221793
    Hi guys, I have written the code below for resetting users passwords (am using the aspnet membership api) in an C# MVC application, and tested successfully on a sample tutorial application (MVC Music Store). Skip to the end if you wish to read problem description first. InactiveUsers View (Partial View) <%@ Control Language="C#" Inherits="System.Web.Mvc.ViewUserControl<System.Web.Security.MembershipUserCollection>" %> <table class="normal" style="width: 100%; background-color: White;"> <tr> <th>User Name</th> <th>Last Activity date</th> <th>Locked Out</th> </tr> <%foreach (MembershipUser user in Model){ %> <tr> <td><%: Html.RouteLink(user.UserName, "AdminPassword", new { username = user.UserName }) %></td> <td><%: user.LastActivityDate %></td> <td><%: user.IsLockedOut %></td> </tr> <% }%> </table> InactiveUsers Controller public ActionResult InactiveUsers() { var users = Membership.GetAllUsers(); return View(users); } changeUserPassword GET and POST Controllers public ActionResult changeUserPassword(string username) { ViewData["username"] = username; return View(); } [HttpPost] public ActionResult changeUserPassword(ChangePasswordModel model, FormCollection values) { string username = values["username"]; string password = values["password"]; string confirmPassword = values["confirmPassword"]; MembershipUser mu = Membership.GetUser(username); if (password == confirmPassword) { if (mu.ChangePassword(mu.ResetPassword(), password)) { return RedirectToAction("Index", "ControlPanel"); } else { ModelState.AddModelError("", "The current password does not meet requirements"); } } return View(); } I also modified the Global.asax.cs file to cater for my route in the InactiveUsers partial: // Added in 10/01/11 RouteTable.Routes.MapRoute( "AdminPassword", // routename "ControlPanel/changeUserPassword/{username}", new { controller = "ControlPanel", action = "changeUserPassword", username = UrlParameter.Optional } ); // END Now, when I tested on the MVC Music Store, all of my usernames were just words, e.g. Administrator, User, etc. However now I am applying this code to a situation in my workplace and it's not working out quite as planned. The usernames used in my workplace are actually email addresses and I think this is what is causing the problem. When I click on the RouteLink in the partial InactiveUsers view, it should bring me to the reset password page with a url that looks like this: http://localhost:83/ControlPanel/changeUserPassword/[email protected], HOWEVER, what happens when I click on the RouteLink is an error is thrown to say that the view changeUserPassword cannot be found, and the URL looks like this: http://localhost:83/ControlPanel/changeUserPassword/example1%40gmail.com - See how the '@' symbol gets messed up? I've also debugged through the code, and in my GET changeUserPassword, the username is populating correctly: [email protected], so I'm thinking it's just the URL that's messing it up? If I type in the URL manually, the changeUserPassword view displays, however the password reset function does not work. An 'Object reference not set to an instance of an object' exception is thrown at the if (mu.ChangePassword(mu.ResetPassword(), password)) line. I think if I could solve the first issue (URL '@' symbol problem) it might help me along with my second issue. Any help would be appreciated :) Stack Trace - as requested Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [InvalidOperationException: The view 'changeUserPassword' or its master was not found. The following locations were searched: ~/Views/ControlPanel/changeUserPassword.aspx ~/Views/ControlPanel/changeUserPassword.ascx ~/Views/Shared/changeUserPassword.aspx ~/Views/Shared/changeUserPassword.ascx] System.Web.Mvc.ViewResult.FindView(ControllerContext context) +495 System.Web.Mvc.ViewResultBase.ExecuteResult(ControllerContext context) +208 System.Web.Mvc.ControllerActionInvoker.InvokeActionResult(ControllerContext controllerContext, ActionResult actionResult) +39 System.Web.Mvc.<>c__DisplayClass14.<InvokeActionResultWithFilters>b__11() +60 System.Web.Mvc.ControllerActionInvoker.InvokeActionResultFilter(IResultFilter filter, ResultExecutingContext preContext, Func`1 continuation) +391 System.Web.Mvc.<>c__DisplayClass16.<InvokeActionResultWithFilters>b__13() +61 System.Web.Mvc.ControllerActionInvoker.InvokeActionResultWithFilters(ControllerContext controllerContext, IList`1 filters, ActionResult actionResult) +285 System.Web.Mvc.ControllerActionInvoker.InvokeAction(ControllerContext controllerContext, String actionName) +830 System.Web.Mvc.Controller.ExecuteCore() +136 System.Web.Mvc.ControllerBase.Execute(RequestContext requestContext) +111 System.Web.Mvc.ControllerBase.System.Web.Mvc.IController.Execute(RequestContext requestContext) +39 System.Web.Mvc.<>c__DisplayClass8.<BeginProcessRequest>b__4() +65 System.Web.Mvc.Async.<>c__DisplayClass1.<MakeVoidDelegate>b__0() +44 System.Web.Mvc.Async.<>c__DisplayClass8`1.<BeginSynchronous>b__7(IAsyncResult _) +42 System.Web.Mvc.Async.WrappedAsyncResult`1.End() +141 System.Web.Mvc.Async.AsyncResultWrapper.End(IAsyncResult asyncResult, Object tag) +54 System.Web.Mvc.Async.AsyncResultWrapper.End(IAsyncResult asyncResult, Object tag) +40 System.Web.Mvc.MvcHandler.EndProcessRequest(IAsyncResult asyncResult) +52 System.Web.Mvc.MvcHandler.System.Web.IHttpAsyncHandler.EndProcessRequest(IAsyncResult result) +38 System.Web.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() +8841105 System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) +184

    Read the article

  • Creating a list of most popular posts of the past week - Wordpress

    - by Gary Woods
    I have created a widget for my Wordpress platform that displays the most popular posts of the week. However, there is an issue with it. It counts the most popular posts from Monday, not the past 7 days. For instance, this means that on Tuesday, it will only include posts from Tuesday and Monday. Here is my widget code: <?php class PopularWidget extends WP_Widget { function PopularWidget(){ $widget_ops = array('description' => 'Displays Popular Posts'); $control_ops = array('width' => 400, 'height' => 300); parent::WP_Widget(false,$name='ET Popular Widget',$widget_ops,$control_ops); } /* Displays the Widget in the front-end */ function widget($args, $instance){ extract($args); $title = apply_filters('widget_title', empty($instance['title']) ? 'Popular This Week' : $instance['title']); $postsNum = empty($instance['postsNum']) ? '' : $instance['postsNum']; $show_thisweek = isset($instance['thisweek']) ? (bool) $instance['thisweek'] : false; echo $before_widget; if ( $title ) echo $before_title . $title . $after_title; ?> <?php $additional_query = $show_thisweek ? '&year=' . date('Y') . '&w=' . date('W') : ''; query_posts( 'post_type=post&posts_per_page='.$postsNum.'&orderby=comment_count&order=DESC' . $additional_query ); ?> <div class="widget-aligned"> <h3 class="box-title">Popular Articles</h3> <div class="blog-entry"> <ol> <?php if (have_posts()) : while (have_posts()) : the_post(); ?> <li><h4 class="title"><a href="<?php the_permalink(); ?>"><?php the_title(); ?></a></h4></li> <?php endwhile; endif; wp_reset_query(); ?> </ol> </div> </div> <!-- end widget-aligned --> <div style="clear:both;"></div> <?php echo $after_widget; } /*Saves the settings. */ function update($new_instance, $old_instance){ $instance = $old_instance; $instance['title'] = stripslashes($new_instance['title']); $instance['postsNum'] = stripslashes($new_instance['postsNum']); $instance['thisweek'] = 0; if ( isset($new_instance['thisweek']) ) $instance['thisweek'] = 1; return $instance; } /*Creates the form for the widget in the back-end. */ function form($instance){ //Defaults $instance = wp_parse_args( (array) $instance, array('title'=>'Popular Posts', 'postsNum'=>'','thisweek'=>false) ); $title = htmlspecialchars($instance['title']); $postsNum = htmlspecialchars($instance['postsNum']); # Title echo '<p><label for="' . $this->get_field_id('title') . '">' . 'Title:' . '</label><input class="widefat" id="' . $this->get_field_id('title') . '" name="' . $this->get_field_name('title') . '" type="text" value="' . $title . '" /></p>'; # Number of posts echo '<p><label for="' . $this->get_field_id('postsNum') . '">' . 'Number of posts:' . '</label><input class="widefat" id="' . $this->get_field_id('postsNum') . '" name="' . $this->get_field_name('postsNum') . '" type="text" value="' . $postsNum . '" /></p>'; ?> <input class="checkbox" type="checkbox" <?php checked($instance['thisweek'], 1) ?> id="<?php echo $this->get_field_id('thisweek'); ?>" name="<?php echo $this->get_field_name('thisweek'); ?>" /> <label for="<?php echo $this->get_field_id('thisweek'); ?>"><?php esc_html_e('Popular this week','Aggregate'); ?></label> <?php } }// end AboutMeWidget class function PopularWidgetInit() { register_widget('PopularWidget'); } add_action('widgets_init', 'PopularWidgetInit'); ?> How can I change this script so that it will count the past 7 days rather than posts from last Monday?

    Read the article

  • Help to edit the Recent Posts Wordpress widget to diplay in all 3 languages at once

    - by CreativEliza
    Site link: http://nuestrafrontera.org/wordpress/ I want the feed of recent post titles to show in the sidebar for all 3 languages, separated by language. So, for example, under Recent Posts the sidebar would have "English" and then the latest 3 posts in English, then "Español" and the latest 3 in Spanish and then French. All in a list in the column and appearing on all pages with the sidebar in all languages. I am using the most current version of Wordpress with the WPML plugin. I believe the Wordpress widget for Recent Posts needs to be tweaked to do this. Here is the code (from wp-includes/default-widgets.php): class WP_Widget_Recent_Posts extends WP_Widget { function WP_Widget_Recent_Posts() { $widget_ops = array('classname' => 'widget_recent_entries', 'description' => __( "The most recent posts on your blog") ); $this->WP_Widget('recent-posts', __('Recent Posts'), $widget_ops); $this->alt_option_name = 'widget_recent_entries'; add_action( 'save_post', array(&$this, 'flush_widget_cache') ); add_action( 'deleted_post', array(&$this, 'flush_widget_cache') ); add_action( 'switch_theme', array(&$this, 'flush_widget_cache') ); } function widget($args, $instance) { $cache = wp_cache_get('widget_recent_posts', 'widget'); if ( !is_array($cache) ) $cache = array(); if ( isset($cache[$args['widget_id']]) ) { echo $cache[$args['widget_id']]; return; } ob_start(); extract($args); $title = apply_filters('widget_title', empty($instance['title']) ? __('Recent Posts') : $instance['title']); if ( !$number = (int) $instance['number'] ) $number = 10; else if ( $number < 1 ) $number = 1; else if ( $number > 15 ) $number = 15; $r = new WP_Query(array('showposts' => $number, 'nopaging' => 0, 'post_status' => 'publish', 'caller_get_posts' => 1)); if ($r->have_posts()) : ?> <?php echo $before_widget; ?> <?php if ( $title ) echo $before_title . $title . $after_title; ?> <ul> <?php while ($r->have_posts()) : $r->the_post(); ?> <li><a href="<?php the_permalink() ?>" title="<?php echo esc_attr(get_the_title() ? get_the_title() : get_the_ID()); ?>"><?php if ( get_the_title() ) the_title(); else the_ID(); ?> </a></li> <?php endwhile; ?> </ul> <?php echo $after_widget; ?> <?php wp_reset_query(); // Restore global post data stomped by the_post(). endif; $cache[$args['widget_id']] = ob_get_flush(); wp_cache_add('widget_recent_posts', $cache, 'widget'); } function update( $new_instance, $old_instance ) { $instance = $old_instance; $instance['title'] = strip_tags($new_instance['title']); $instance['number'] = (int) $new_instance['number']; $this->flush_widget_cache(); $alloptions = wp_cache_get( 'alloptions', 'options' ); if ( isset($alloptions['widget_recent_entries']) ) delete_option('widget_recent_entries'); return $instance; } function flush_widget_cache() { wp_cache_delete('widget_recent_posts', 'widget'); } function form( $instance ) { $title = esc_attr($instance['title']); if ( !$number = (int) $instance['number'] ) $number = 5; ?> <p><label for="<?php echo $this->get_field_id('title'); ?>"><?php _e('Title:'); ?></label> <input class="widefat" id="<?php echo $this->get_field_id('title'); ?>" name="<?php echo $this->get_field_name('title'); ?>" type="text" value="<?php echo $title; ?>" /></p> <p><label for="<?php echo $this->get_field_id('number'); ?>"><?php _e('Number of posts to show:'); ?></label> <input id="<?php echo $this->get_field_id('number'); ?>" name="<?php echo $this->get_field_name('number'); ?>" type="text" value="<?php echo $number; ?>" size="3" /><br /> <small><?php _e('(at most 15)'); ?></small></p> <?php } }

    Read the article

  • Ruby erb template- try to change layout- get error

    - by nigel curruthers
    Hi there! I'm working my way through adapting a template I have been given that is basically a list of products for sale. I want to change it from a top-down list into a table layout. I want to end up with something as follows- <div id= 'ladiesproducts'> <% ladies_products = hosting_products.find_all do |product| product.name.match("ladies") end %> <table><tbody> <% [ladies_products].each do | slice | %> <tr> <% slice.each do | product | %> <td> <h4><%= product.name.html %></h4> <p><%= product.description %></p> <% other parts go here %> </td> <% end %> </tr> <% end %> </tbody></table> </div> This works fine for the layout that I am trying to achieve. The problem I have is when I paste back the <% other parts go here % part of the code. I get an internal error message on the page. I am completely new to Ruby so am just bumbling my way through this really. I have a hunch that I'm neglecting something that is probably very simple. The <% other parts go here %> code is as follows: <input type='hidden' name='base_renewal_period-<%= i %>' value="<%= product.base_renewal_period %>" /> <input type='hidden' name='quoted_unit_price-<%= i %>' value="<%= billing.price(product.unit_price) %>" /> <p><input type='radio' name='add-product' value='<%= product.specific_type.html %>:<%= i %>:base_renewal_period,quoted_unit_price,domain' /><%= billing.currency_symbol.html %><%= billing.price(product.unit_price, :use_tax_prefs) %> <% if product.base_renewal_period != 'never' %> every <%= product.unit_period.to_s_short.html %> <% end %> <% if product.setup_fee != 0 %> plus a one off fee of <%= billing.currency_symbol.html %><%= sprintf("%.2f", if billing.include_tax? then billing.price(product.setup_fee) else product.setup_fee end) %> <% end %> <% if product.has_free_products? %> <br /> includes free domains <% product.free_products_list.each do | free_product | %> <%= free_product["free_name"] %> <% end %> <% end %> * </p> <% i = i + 1 %> <% end %> <p><input type='submit' value='Add to Basket'/></p> </form> <% unless basket.nil? or basket.empty? or no_upsell? %> <p><a href='basket?add-no-product=package'>No thank you, please continue with my order ...</a></p> <% end %> <% if not billing.tax_applies? %> <% elsif billing.include_tax? %> <p>* Includes <%= billing.tax_name %></p> <% else %> <p>* Excluding <%= billing.tax_name %></p> <% end %> If anyone can point out what I'm doing wrong or what I'm missing or failing to change I would GREATLY appreciate it! Many thanks in advance. Nigel

    Read the article

  • Click edit button twice in gridview asp.net c# issue

    - by Supriyo Banerjee
    I have a gridview created on a page where I want to provide an edit button for the user to click in. However the issue is the grid view row becomes editable only while clicking the edit button second time. Not sure what is going wrong here, any help would be appreciated. One additional point is my grid view is displayed on the page only on a click of a button and is not there on page_load event hence. Posting the code snippets: //MY Aspx code <Columns> <asp:TemplateField HeaderText="Slice" SortExpression="name"> <ItemTemplate> <asp:Label ID="lblslice" Text='<%# Eval("slice") %>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lblslice" Text='<%# Eval("slice") %>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Metric" SortExpression="Description"> <ItemTemplate> <asp:Label ID="lblmetric" Text='<%# Eval("metric")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lblmetric" Text='<%# Eval("metric")%>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Original" SortExpression="Type"> <ItemTemplate> <asp:Label ID="lbloriginal" Text='<%# Eval("Original")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lbloriginal" Text='<%# Eval("Original")%>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="WOW" SortExpression="Market"> <ItemTemplate> <asp:Label ID="lblwow" Text='<%# Eval("WOW")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:Label ID="lblwow" Text='<%# Eval("WOW")%>' runat="server"></asp:Label> </EditItemTemplate> </asp:TemplateField> <asp:TemplateField HeaderText="Change" SortExpression="Market" > <ItemTemplate> <asp:Label ID="lblChange" Text='<%# Eval("Change")%>' runat="server"></asp:Label> </ItemTemplate> <EditItemTemplate> <asp:TextBox ID="TxtCustomerID" Text='<%# Eval("Change") %> ' runat="server"></asp:TextBox> </EditItemTemplate> </asp:TemplateField> <asp:CommandField HeaderText="Edit" ShowEditButton="True" /> </Columns> </asp:GridView> //My code behind: protected void Page_Load(object sender, EventArgs e) { } public void populagridview1(string slice,string fromdate,string todate,string year) { SqlCommand cmd; SqlDataAdapter da; DataSet ds; cmd = new SqlCommand(); cmd.CommandType = CommandType.StoredProcedure; cmd.CommandText = "usp_geteventchanges"; cmd.Connection = conn; conn.Open(); SqlParameter param1 = new SqlParameter("@slice", slice); cmd.Parameters.Add(param1); SqlParameter param2 = new SqlParameter("@fromdate", fromdate); cmd.Parameters.Add(param2); SqlParameter param3 = new SqlParameter("@todate", todate); cmd.Parameters.Add(param3); SqlParameter param4 = new SqlParameter("@year", year); cmd.Parameters.Add(param4); da = new SqlDataAdapter(cmd); ds = new DataSet(); da.Fill(ds, "Table"); GridView1.DataSource = ds; GridView1.DataBind(); conn.Close(); } protected void ImpactCalc(object sender, EventArgs e) { populagridview1(ddl_slice.SelectedValue, dt_to_integer(Picker1.Text), dt_to_integer(Picker2.Text), Txt_Year.Text); } protected void GridView1_RowEditing(object sender, GridViewEditEventArgs e) { gvEditIndex = e.NewEditIndex; Gridview1.DataBind(); } My page layout This edit screen appears after clicking edit twice.. the grid view gets displayed on hitting the Calculate impact button. The data is from a backend stored procedure which is fired on clicking the Calculate impact button

    Read the article

  • parentNode.parentNode.rowindex to delete a row in a dynamic table

    - by billy85
    I am creating my rows dynamically when the user clicks on "Ajouter". <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <script> function getXhr(){ var xhr = null; if(window.XMLHttpRequest) // Firefox and others xhr = new XMLHttpRequest(); else if(window.ActiveXObject){ // Internet Explorer try { xhr = new ActiveXObject("Msxml2.XMLHTTP"); } catch (e) { xhr = new ActiveXObject("Microsoft.XMLHTTP"); } } else { // XMLHttpRequest not supported by your browser alert("Votre navigateur ne supporte pas les objets XMLHTTPRequest..."); xhr = false; } return xhr } /** * method called when the user clicks on the button */ function go(){ var xhr = getXhr() // We defined what we gonna do with the response xhr.onreadystatechange = function(){ // We do somthing once the server's response is OK if(xhr.readyState == 4 && xhr.status == 200){ //alert(xhr.responseText); var body = document.getElementsByTagName("body")[0]; // Retrieve <table> ID and create a <tbody> element var tbl = document.getElementById("table"); var tblBody = document.createElement("tbody"); var row = document.createElement("tr"); // Create <td> elements and a text node, make the text // node the contents of the <td>, and put the <td> at // the end of the table row var cell_1 = document.createElement("td"); var cell_2 = document.createElement("td"); var cell_3 = document.createElement("td"); var cell_4 = document.createElement("td"); // Create the first cell which is a text zone var cell1=document.createElement("input"); cell1.type="text"; cell1.name="fname"; cell1.size="20"; cell1.maxlength="50"; cell_1.appendChild(cell1); // Create the second cell which is a text area var cell2=document.createElement("textarea"); cell2.name="fdescription"; cell2.rows="2"; cell2.cols="30"; cell_2.appendChild(cell2); var cell3 = document.createElement("div"); cell3.innerHTML=xhr.responseText; cell_3.appendChild(cell3); // Create the fourth cell which is a href var cell4 = document.createElement("a"); cell4.appendChild(document.createTextNode("[Delete]")); cell4.setAttribute("href","javascrit:deleteRow();"); cell_4.appendChild(cell4); // add cells to the row row.appendChild(cell_1); row.appendChild(cell_2); row.appendChild(cell_3); row.appendChild(cell_4); // add the row to the end of the table body tblBody.appendChild(row); // put the <tbody> in the <table> tbl.appendChild(tblBody); // appends <table> into <body> body.appendChild(tbl); // sets the border attribute of tbl to 2; tbl.setAttribute("border", "1"); } } xhr.open("GET","fstatus.php",true); xhr.send(null); } </head> <body > <h1> Create an Item </h1> <form method="post"> <table align="center" border = "2" cellspacing ="0" cellpadding="3" id="table"> <tr><td><b>Functionality Name:</b></td> <td><b>Description:</b></td> <td><b>Status:</b></td> <td><input type="button" Name= "Ajouter" Value="Ajouter" onclick="go()"></td></tr> </table> </form> </body> </html> Now, I would like to use the href [Delete] to delete one particular row. I wrote this: <script type="text/javascript"> function deleteRow(r){ var i=r.parentNode.parentNode.rowIndex; document.getElementById('table').deleteRow(i); } </script> When I change the first code like this: cell4.setAttribute("href","javascrit:deleteRow(this);"); I got an error: The page cannot be displayed. I am redirected to a new pagewhich can not be displayed. How could I delete my row by using the function deleteRow(r)? table is the id of my table Thanks. Billy85

    Read the article

  • Choosing a scripting language for game and implementing it

    - by Radius
    Hello, I am currently developing a 3D Action/RPG game in C++, and I would like some advice in choosing a scripting language to program the AI of the game. My team comes from a modding background, and in fact we are still finishing work on a mod of the game Gothic. In that game (which we also got our inspiration from) the language DAEDALUS (created by Piranha Bytes, the makers of the game) is used. Here is a full description of said language. The main thing to notice about this is that it uses instances moreso than classes. The game engine is closed, and so one can only guess about the internal implementation of this language, but the main thing I am looking for in a scripting language (which ideally would be quite similar but preferably also more powerful than DAEDALUS) is the fact that there are de facto 3 'separations' of classes - ie classes, instances and (instances of instances?). I think it will be easier to understand what I want if I provide an example. Take a regular NPC. First of all you have a class defined which (I understand) mirrors the (class or structure) inside the engine: CLASS C_NPC { VAR INT id ; // absolute ID des NPCs VAR STRING name [5] ; // Namen des NPC VAR STRING slot ; VAR INT npcType ; VAR INT flags ; VAR INT attribute [ATR_INDEX_MAX] ; VAR INT protection [PROT_INDEX_MAX]; VAR INT damage [DAM_INDEX_MAX] ; VAR INT damagetype ; VAR INT guild,level ; VAR FUNC mission [MAX_MISSIONS] ; var INT fight_tactic ; VAR INT weapon ; VAR INT voice ; VAR INT voicePitch ; VAR INT bodymass ; VAR FUNC daily_routine ; // Tagesablauf VAR FUNC start_aistate ; // Zustandsgesteuert // ********************** // Spawn // ********************** VAR STRING spawnPoint ; // Beim Tod, wo respawnen ? VAR INT spawnDelay ; // Mit Delay in (Echtzeit)-Sekunden // ********************** // SENSES // ********************** VAR INT senses ; // Sinne VAR INT senses_range ; // Reichweite der Sinne in cm // ********************** // Feel free to use // ********************** VAR INT aivar [50] ; VAR STRING wp ; // ********************** // Experience dependant // ********************** VAR INT exp ; // EXerience Points VAR INT exp_next ; // EXerience Points needed to advance to next level VAR INT lp ; // Learn Points }; Then, you can also define prototypes (which set some default values). But how you actually define an NPC is like this: instance BAU_900_Ricelord (Npc_Default) //Inherit from prototype Npc_Default { //-------- primary data -------- name = "Ryzowy Ksiaze"; npctype = NPCTYPE_GUARD; guild = GIL_BAU; level = 10; voice = 12; id = 900; //-------- abilities -------- attribute[ATR_STRENGTH] = 50; attribute[ATR_DEXTERITY] = 10; attribute[ATR_MANA_MAX] = 0; attribute[ATR_MANA] = 0; attribute[ATR_HITPOINTS_MAX]= 170; attribute[ATR_HITPOINTS] = 170; //-------- visuals -------- // animations Mdl_SetVisual (self,"HUMANS.MDS"); Mdl_ApplyOverlayMds (self,"Humans_Arrogance.mds"); Mdl_ApplyOverlayMds (self,"HUMANS_DZIDA.MDS"); // body mesh ,bdytex,skin,head mesh ,headtex,teethtex,ruestung Mdl_SetVisualBody (self,"Hum_Body_CookSmith",1,1,"Hum_Head_FatBald",91 , 0,-1); B_Scale (self); Mdl_SetModelFatness(self,2); fight_tactic = FAI_HUMAN_STRONG; //-------- Talente -------- Npc_SetTalentSkill (self,NPC_TALENT_1H,1); //-------- inventory -------- CreateInvItems (self, ItFoRice,10); CreateInvItem (self, ItFoWine); CreateInvItems(self, ItMiNugget,40); EquipItem (self, Heerscherstab); EquipItem (self, MOD_AMULETTDESREISLORDS); CreateInvItem (self, ItMi_Alchemy_Moleratlubric_01); //CreateInvItem (self,ItKey_RB_01); EquipItem (self, Ring_des_Lebens); //-------------Daily Routine------------- daily_routine = Rtn_start_900; }; FUNC VOID Rtn_start_900 () { TA_Boss (07,00,20,00,"NC_RICELORD"); TA_SitAround (20,00,24,00,"NC_RICELORD_SIT"); TA_Sleep (24,00,07,00,"NC_RICEBUNKER_10"); }; As you can see, the instance declaration is more like a constructor function, setting values and calling functions from within. This still wouldn't pose THAT much of a problem, if not for one more thing: multiple copies of this instance. For example, you can spawn multiple BAU_900_Ricelord's, and each of them keeps track of its own AI state, hitpoints etc. Now I think the instances are represented as ints (maybe even as the id of the NPC) inside the engine, as whenever (inside the script) you use the expression BAU_900_Ricelord it can be only assigned to an int variable, and most functions that operate on NPCs take that int value. However to directly modify its hitpoints etc you have to do something like var C_NPC npc = GetNPC(Bau_900_Ricelord); npc.attribute[ATR_HITPOINTS] = 10; ie get the actual C_NPC object that represents it. To finally recap - is it possible to get this kind of behaviour in any scripting languages you know of, or am I stuck with having to make my own? Or maybe there is an even better way of representing NPC's and their behaviours that way. The IDEAL language for scripting for me would be C#, as I simply adore that language, but somehow I doubt it is possible or indeed feasible to try and implement a similar kind of behaviour in C#. Many thanks

    Read the article

  • Finding the heaviest length-constrained path in a weighted Binary Tree

    - by Hristo
    UPDATE I worked out an algorithm that I think runs in O(n*k) running time. Below is the pseudo-code: routine heaviestKPath( T, k ) // create 2D matrix with n rows and k columns with each element = -8 // we make it size k+1 because the 0th column must be all 0s for a later // function to work properly and simplicity in our algorithm matrix = new array[ T.getVertexCount() ][ k + 1 ] (-8); // set all elements in the first column of this matrix = 0 matrix[ n ][ 0 ] = 0; // fill our matrix by traversing the tree traverseToFillMatrix( T.root, k ); // consider a path that would arc over a node globalMaxWeight = -8; findArcs( T.root, k ); return globalMaxWeight end routine // node = the current node; k = the path length; node.lc = node’s left child; // node.rc = node’s right child; node.idx = node’s index (row) in the matrix; // node.lc.wt/node.rc.wt = weight of the edge to left/right child; routine traverseToFillMatrix( node, k ) if (node == null) return; traverseToFillMatrix(node.lc, k ); // recurse left traverseToFillMatrix(node.rc, k ); // recurse right // in the case that a left/right child doesn’t exist, or both, // let’s assume the code is smart enough to handle these cases matrix[ node.idx ][ 1 ] = max( node.lc.wt, node.rc.wt ); for i = 2 to k { // max returns the heavier of the 2 paths matrix[node.idx][i] = max( matrix[node.lc.idx][i-1] + node.lc.wt, matrix[node.rc.idx][i-1] + node.rc.wt); } end routine // node = the current node, k = the path length routine findArcs( node, k ) if (node == null) return; nodeMax = matrix[node.idx][k]; longPath = path[node.idx][k]; i = 1; j = k-1; while ( i+j == k AND i < k ) { left = node.lc.wt + matrix[node.lc.idx][i-1]; right = node.rc.wt + matrix[node.rc.idx][j-1]; if ( left + right > nodeMax ) { nodeMax = left + right; } i++; j--; } // if this node’s max weight is larger than the global max weight, update if ( globalMaxWeight < nodeMax ) { globalMaxWeight = nodeMax; } findArcs( node.lc, k ); // recurse left findArcs( node.rc, k ); // recurse right end routine Let me know what you think. Feedback is welcome. I think have come up with two naive algorithms that find the heaviest length-constrained path in a weighted Binary Tree. Firstly, the description of the algorithm is as follows: given an n-vertex Binary Tree with weighted edges and some value k, find the heaviest path of length k. For both algorithms, I'll need a reference to all vertices so I'll just do a simple traversal of the Tree to have a reference to all vertices, with each vertex having a reference to its left, right, and parent nodes in the tree. Algorithm 1 For this algorithm, I'm basically planning on running DFS from each node in the Tree, with consideration to the fixed path length. In addition, since the path I'm looking for has the potential of going from left subtree to root to right subtree, I will have to consider 3 choices at each node. But this will result in a O(n*3^k) algorithm and I don't like that. Algorithm 2 I'm essentially thinking about using a modified version of Dijkstra's Algorithm in order to consider a fixed path length. Since I'm looking for heaviest and Dijkstra's Algorithm finds the lightest, I'm planning on negating all edge weights before starting the traversal. Actually... this doesn't make sense since I'd have to run Dijkstra's on each node and that doesn't seem very efficient much better than the above algorithm. So I guess my main questions are several. Firstly, do the algorithms I've described above solve the problem at hand? I'm not totally certain the Dijkstra's version will work as Dijkstra's is meant for positive edge values. Now, I am sure there exist more clever/efficient algorithms for this... what is a better algorithm? I've read about "Using spine decompositions to efficiently solve the length-constrained heaviest path problem for trees" but that is really complicated and I don't understand it at all. Are there other algorithms that tackle this problem, maybe not as efficiently as spine decomposition but easier to understand? Thanks.

    Read the article

  • Having trouble on mouse over tabs

    - by user225269
    I downloaded a webpage template from the internet because I don't know how to design webpage on photoshop. This was the one I downloaded: http://www.freewebtemplates.com/download/templates/9839 And modified it. And I have this code for mouse over tabs from dynamic drive. But doesn't seem to be working with the template that I downloaded. Here is my current code: <script src="mouseovertabs.js" type="text/javascript"> </script> <meta http-equiv="content-type" content="text/html; charset=utf-8" /> <title>Designed by Web Page Templates</title> <meta name="keywords" content="" /> <meta name="description" content="" /> <link href="default.css" rel="stylesheet" type="text/css" /> </head> <body> <table border="0" align="center" cellpadding="0" cellspacing="0" class="bg1"> <tr> <td class="text1" style="height: 50px;">xd627 information management system</td> </tr> <tr> <div id="mytabsmenu" class="tabsmenuclass"> <td class="bg5"><table border="0" cellspacing="0" cellpadding="0" style="height: 62px; padding-top: 15px;"> <tr align="center"> <td><ul><li><a href="index.html" class="link1">Homepage</a></li></td> <td><li><a href="RegStuds.php" class="link1">Database</a></li></td> <td><li><a href="#" class="link1">About</a></li> </ul></td> <a href="submenucontents.htm" style="visibility:hidden">Sub Menu contents</a> <div id="mysubmenuarea" class="tabsmenucontentclass"> <!--1st link within submenu container should point to the external submenu contents file--> <a href="submenucontents.htm" style="visibility:hidden">Sub Menu contents</a> </div> <script type="text/javascript"> //mouseovertabsmenu.init("tabs_container_id", "submenu_container_id", "bool_hidecontentsmouseout") mouseovertabsmenu.init("mytabsmenu", "mysubmenuarea", true) </script> </div> What might be wrong here,its working perfectly with my previous one, but with no layout at all: <script src="mouseovertabs.js" type="text/javascript"> /*********************************************** * Mouseover Tabs Menu- (c) Dynamic Drive DHTML code library (www.dynamicdrive.com) * This notice MUST stay intact for legal use * Visit Dynamic Drive at http://www.dynamicdrive.com/ for this script and 100s more ***********************************************/ </script> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <title>Untitled Document</title> </head> <body> <div id="mytabsmenu" class="tabsmenuclass"> <ul> <li><a href="" rel="gotsubmenu[selected]">Database Manipulation</a></li> <li><a href="" rel="gotsubmenu" >Register User</a></li> <li><a href="loginform2.php" rel="gotsubmenu" >Logout</a></li> <li><a href=""></a></li> </ul> </div> <div id="mysubmenuarea" class="tabsmenucontentclass"> <!--1st link within submenu container should point to the external submenu contents file--> <a href="submenucontents.htm" style="visibility:hidden">Sub Menu contents</a> </div> <script type="text/javascript"> //mouseovertabsmenu.init("tabs_container_id", "submenu_container_id", "bool_hidecontentsmouseout") mouseovertabsmenu.init("mytabsmenu", "mysubmenuarea", true) </script> </body> </html>

    Read the article

  • problem processing xml in flex3

    - by john
    Hi All, First time here asking a question and still learning on how to format things better... so sorry about the format as it does not look too well. I have started learning flex and picked up a book and tried to follow the examples in it. However, I got stuck with a problem. I have a jsp page which returns xml which basically have a list of products. I am trying to parse this xml, in other words go through products, and create Objects for each product node and store them in an ArrayCollection. The problem I believe I am having is I am not using the right way of navigating through xml. The xml that is being returned from the server looks like this: <?xml version="1.0" encoding="ISO-8859-1"?><result type="success"> <products> <product> <id>6</id> <cat>electronics</cat> <name>Plasma Television</name> <desc>65 inch screen with 1080p</desc> <price>$3000.0</price> </product> <product> <id>7</id> <cat>electronics</cat> <name>Surround Sound Stereo</name> <desc>7.1 surround sound receiver with wireless speakers</desc> <price>$1000.0</price> </product> <product> <id>8</id> <cat>appliances</cat> <name>Refrigerator</name> <desc>Bottom drawer freezer with water and ice on the door</desc> <price>$1200.0</price> </product> <product> <id>9</id> <cat>appliances</cat> <name>Dishwasher</name> <desc>Large capacity with water saver setting</desc> <price>$500.0</price> </product> <product> <id>10</id> <cat>furniture</cat> <name>Leather Sectional</name> <desc>Plush leather with room for 6 people</desc> <price>$1500.0</price> </product> </products></result> And I have flex code that tries to iterate over products like following: private function productListHandler(e:JavaFlexStoreEvent):void { productData = new ArrayCollection(); trace(JavaServiceHandler(e.currentTarget).response); for each (var item:XML in JavaServiceHandler(e.currentTarget).response..product ) { productData.addItem( { id:item.id, item:item.name, price:item.price, description:item.desc }); } } with trace, I can see the xml being returned from the server. However, I cannot get inside the loop as if the xml was empty. In other words, JavaServiceHandler(e.currentTarget).response..product must be returning nothing. Can someone please help/point out what I could be doing wrong. My JavaServiceHandler class looks like this: package com.wiley.jfib.store.data { import com.wiley.jfib.store.events.JavaFlexStoreEvent; import flash.events.Event; import flash.events.EventDispatcher; import flash.net.URLLoader; import flash.net.URLRequest; public class JavaServiceHandler extends EventDispatcher { public var serviceURL:String = ""; public var response:XML; public function JavaServiceHandler() { } public function callServer():void { if(serviceURL == "") { throw new Error("serviceURL is a required parameter"); return; } var loader:URLLoader = new URLLoader(); loader.addEventListener(Event.COMPLETE, handleResponse); loader.load(new URLRequest(serviceURL)); // var httpService:HTTPService = new HTTPService(); // httpService.url = serviceURL; // httpService.resultFormat = "e4x"; // httpService.addEventListener(Event.COMPLETE, handleResponse); // httpService.send(); } private function handleResponse(e:Event):void { var loader:URLLoader = URLLoader(e.currentTarget); response = XML(loader.data); dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); // var httpService:HTTPService = HTTPService(e.currentTarget); // response = httpService.lastResult.product; // dispatchEvent(new JavaFlexStoreEvent(JavaFlexStoreEvent.DATA_LOADED) ); } } } Even though I refer to this as mine and it is not in reality. This is from a Flex book as a code sample which does not work, go figure. Any help is appreciated. Thanks john

    Read the article

  • How should I model the database for this problem? And which ORM can handle it?

    - by Kristof Claes
    I need to build some sort of a custom CMS for a client of ours. These are some of the functional requirements: Must be able to manage the list of Pages in the site Each Page can contain a number of ColumnGroups A ColumnGroup is nothing more than a list of Columns in a certain ColumnGroupLayout. For example: "one column taking up the entire width of the page", "two columns each taking up half of the width", ... Each Column can contain a number ContentBlocks Examples of a ContentBlock are: TextBlock, NewsBlock, PictureBlock, ... ContentBlocks can be given a certain sorting within a Column A ContentBlock can be put in different Columns so that content can be reused without having to be duplicated. My first quick draft of how this could look like in C# code (we're using ASP.NET 4.0 to develop the CMS) can be found at the bottom of my question. One of the technical requirements is that it must be as easy as possible to add new types of ContentBlocks to the CMS. So I would like model everything as flexible as possible. Unfortunately, I'm already stuck at trying to figure out how the database should look like. One of the problems I'm having has to do with sorting different types of ContentBlocks in a Column. I guess each type of ContentBlock (like TextBlock, NewsBlock, PictureBlock, ...) should have it's own table in the database because each has it's own different fields. A TextBlock might only have a field called Text whereas a NewsBlock might have fields for the Text, the Summary, the PublicationDate, ... Since one Column can have ContentBlocks located in different tables, I guess I'll have to create a many-to-many association for each type of ContentBlock. For example: ColumnTextBlocks, ColumnNewsBlocks and ColumnPictureBlocks. The problem I have with this setup is the sorting of the different ContentBlocks in a column. This could be something like this: TextBlock NewsBlock TextBlock TextBlock PictureBlock Where do I store the sorting number? If I store them in the associaton tables, I'll have to update a lot of tables when changing the sorting order of ContentBlocks in a Column. Is this a good approach to the problem? Basically, my question is: What is the best way to model this keeping in mind that it should be easy to add new types of ContentBlocks? My next question is: What ORM can deal with that kind of modeling? To be honest, we are ORM-virgins at work. I have been reading a bit about Linq-to-SQL and NHibernate, but we have no experience with them. Because of the IList in the Column class (see code below) I think we can rule out Linq-to-SQL, right? Can NHibernate handle the mapping of data from many different tables to one IList? Also keep in mind that this is just a very small portion of the domain. Other parts are Users belonging to a certain UserGroup having certain Permissions on Pages, ColumnGroups, Columns and ContentBlocks. The code (just a quick first draft): public class Page { public int PageID { get; set; } public string Title { get; set; } public string Description { get; set; } public string Keywords { get; set; } public IList<ColumnGroup> ColumnGroups { get; set; } } public class ColumnGroup { public enum ColumnGroupLayout { OneColumn, HalfHalf, NarrowWide, WideNarrow } public int ColumnGroupID { get; set; } public ColumnGroupLayout Layout { get; set; } public IList<Column> Columns { get; set; } } public class Column { public int ColumnID { get; set; } public IList<IContentBlock> ContentBlocks { get; set; } } public interface IContentBlock { string GetSummary(); } public class TextBlock : IContentBlock { public string GetSummary() { return "I am a piece of text."; } } public class NewsBlock : IContentBlock { public string GetSummary() { return "I am a news item."; } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • i have made a from and want to connect it to a oracle 10g data base using php.can you please assume

    - by nachiket-panse
    http://www.freecsstemplates.org Released for free under a Creative Commons Attribution 2.5 License -- Sitename.com by Free Css Templates MANAGEMEINT INFORMATION SYSTEM   <p class="style2">&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;REGISTRY ENTRY FORM </p> <form id="form2" method="post" action=""> <p align="center">&nbsp;</p> <p align="center"><span class="style3">JOB DESCRIPTION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <textarea name="textarea"></textarea> </p> <p align="center"><span class="style3">QUANTITY :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield5" /> </p> <p align="center">&nbsp;<span class="style3">CONTACT PERSON </span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield3" /> </p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">DIVISION CODE: <textarea name="textarea3"></textarea> </span></p> <p align="center"><span class="style3">ACCEPTANCE DATE </span>: <input type="text" name="textfield4" /> </p> <p align="center"><span class="style3">REFERENCE NUMBER :</span> <input type="text" name="textfield2" /> </p> <p align="center"><span class="style3">CLASSIFICATION :</span>&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp; <input type="text" name="textfield" /></p> <p align="center">&nbsp;</p> <p align="center"><span class="style3">CUMULATIVE COST: </span> <select name="select"> </select> </p> <p align="center"><span class="style3">PLANNING ENGR: </span> <textarea name="textarea2"></textarea> </p> <p align="center"><span class="style3">PLANNING: </span> <input type="text" name="textfield6" /> </p> <p align="center"> <span class="style3">FILL THE COMPLETION DATE: </span> <input type="text" name="textfield7" /> </p> <p align="center"><span class="style3">REMARKS: </span> <input type="text" name="textfield8" /> </p> <p align="center">&nbsp;</p> <p align="center"> <input type="submit" name="SAVE" value="SAVE" /> <input type="submit" name="Submit2" value="LIST" /> <input type="submit" name="Submit" value="ADD" /> <input type="submit" name="Submit3" value="CANCEL" /> <input type="submit" name="BACK" value="BACK" /></p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> <p align="center">&nbsp;</p> </form> <p align="center" class="style2">&nbsp;</p>

    Read the article

< Previous Page | 252 253 254 255 256 257 258 259 260 261 262 263  | Next Page >