Search Results

Search found 21005 results on 841 pages for 'disk format'.

Page 281/841 | < Previous Page | 277 278 279 280 281 282 283 284 285 286 287 288  | Next Page >

  • transition of x-axis results in overflow

    - by peter
    First of all, no: this question is not about the (yet) ugly transition of the lines (I might open another one for that, though..). I'm displaying data in line charts and the user can select the time horizon. The x-axis then correspondingly transitions so as to fit to the changed time horizon. In attached image, e.g., the time horizon was 1 week and then I switched to 4 weeks. The number of ticks on the x-axis increases from 7 to 28, correspondingly. Question: How can I prevent the x-axis animation to display outside the svg container? As you can see, the additional dates fly in from the left and they are being animated far far outside the container. Any ideas? Right now, the transition works probably in the most simple way it could: // format for x-axis var xAxis = d3.svg.axis() .scale(x) .orient("bottom") .tickFormat(d3.time.format("%d.%m")) .ticks(d3.time.days, 1) .tickSubdivide(0); // Update x-axis svg.select(".x") .transition() .duration(500) .call(xAxis);

    Read the article

  • Manipulating pixels using only toDataURL

    - by Chris
    The problem I have is this: I need to be able to dynamically tint an image using Javascript, but I cannot access pixel data via the canvas. I can, however, store the dataURL (or any other text-based data format) and include that with the code, manipulate that data, and then create an image object using that dataURL. My question is, how can I access the RGBA value of each pixel, given only the dataURL. I assume I need to decode the base64 url, but into what format in order to manipulate on the pixel level? And then would be it be as trivial as re-encoding it as base64, slapping it in a url, and the passing to an image? Thanks.

    Read the article

  • How to do client callback for each item in a foreach statement using c#?

    - by Mike108
    I want to show each item Id that is doing now dynamically in a foreach statement. How to do some kind of client callback to show the item Id in a foreach statement? <asp:Label ID="Label1" runat="server" Text="Label"></asp:Label> <asp:Button ID="Button1" runat="server" onclick="Button1_Click" Text="Button" /> . protected void Button1_Click(object sender, EventArgs e) { List<int> list = new List<int>() { 1,2,3,4,5 }; foreach (var item in list) { Label1.Text = string.Format("I'm doing item {0} now.", item.ToString()); Page.RegisterStartupScript("", string.Format("<script>alert('doing item {0} now')</script>", item.ToString())); Thread.Sleep(1 * 1000); } }

    Read the article

  • How to make Date locale-independent? (GMT timezone newbie question)

    - by folone
    I have a db, that stores dates in OleDateTime format, in GMT timezone. I've implemented a class, extending Date in java to represent that in classic date format. But my class is locale-dependent (I'm in GMT+2). Therefore, it converts the date in the db as date - 2 hours. How do I make it convert the date correctly? I want my class to be locale-independent, always using GMT timezone. Actually, the question is: class MyOleDateTime extends Date { static { Locale.setDefault(WhatGoesHere?) } // ... some constructors // ... some methods }

    Read the article

  • Can I use ANTLR for both two-way parsing/generating?

    - by Mike Q
    Hi all, I need to both parse incoming messages and generate outgoing messages in EDIFACT format (basically a structured delimited format). I would like to have a Java model that will be generated by parsing a message. Then I would like to use the same model to create an instance and generate a message. The first half is fine, I've used ANTLR before to go from raw - Java objects. But I've never done the reverse, or if I have it's been custom. Does ANTLR support generating using a grammar or is it really just a parse-only tool?

    Read the article

  • Webservice won't accept JSON requests

    - by V-Man
    Hi, The main issue is that I cannot run a webservice that accepts requests in JSON format. I keep getting a 500 Server error stating that the "request format is invalid." My ASP.NET AJAX extensions are installed. My server is running Plesk Control Panel 8.6 which is undoubtedly causing these problems. The default handler for this specified extension is shown in the web.config like so: For my applications webservice to handle JSON it needs to have this reference: <add name="ScriptHandlerFactory" verb="*" path="*.asmx" preCondition="integratedMode" type="System.Web.Script.Services.ScriptHandlerFactory, System.Web.Extensions, Version=3.5.0.0, Culture=neutral, PublicKeyToken=31BF3856AD364E35"/> Plesk is not allowing the request to be handled properly. I need to know the correct http directive(s) to put into the web.config to properly handle JSON webservices. I tried posting to the Plesk forum two days ago but no response yet. Any insight would be great =)

    Read the article

  • cannot access new drive through nfs

    - by l.thee.a
    I am running nfs-kernel-server to access my files on my linux machine(ubuntu - /share). The disk I have been using is full. So I have added a new disk and mounted it to /share/data. My other pc mounts the /share folder to /mnt/nfs; but cannot see the contents of /mnt/nfs/data. I have tried adding /share/data to /etc/exports, but it did not help. What do I do?

    Read the article

  • Android PixelFormat per device

    - by Tobias Domhan
    analogous to this thread: stackoverflow.com/questions/2093594/opengl-extensions-available-on-different-android-devices I would like to collect the different PixelFormats the android devices use. To find out you must do the following: Parameters camParams = camera.getParameters(); int format = camParams.getPreviewFormat(); Now you got to find the number in the following list: developer.android.com/reference/android/graphics/PixelFormat.html#A_8 How to generally open the camera is described here: developer.android.com/resources/samples/ApiDemos/src/com/example/android/apis/graphics/CameraPreview.html I'll have a start: device: T-mobile G1 / HTC Dream android: 1.6 (cyanogen mod) format: YCbCr_420_SP so what formats do your android phones use? thanks in advance :D

    Read the article

  • Why I get different date formats when I run my application through IIS and Visual Studio's web serve

    - by Puneet Dudeja
    I get the same culture i.e. "en-US" while running the website from both IIS and Visual Studio's web server. But I get a different date format as follows, when I run the following code: HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.ToString()); HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.DateTimeFormat.ShortDatePattern); On Visual Studio's web server: dd/MM/yyyy en-US On IIS: M/d/yyyy en-US Does "Regional and Language Options" in "Control Panel" play any role in this ? If I change the date format there in "Regional and Language Options", I see no effect in my application.

    Read the article

  • Is it possible to temporarily disable Python's string interpolation?

    - by dangerouslyfacetious
    I have a python logger set up, using python's logging module. I want to store the string I'm using with the logging Formatter object in a configuration file using the ConfigParser module. The format string is stored in a dictionary of settings in a separate file that handles the reading and writing of the config file. The problem I have is that python still tries to format the file and falls over when it reads all the logging-module-specific formatting flags. { "log_level":logging.debug, "log_name":"C:\\Temp\\logfile.log", "format_string": "%(asctime)s %(levelname)s: %(module)s, line %(lineno)d - %(message)s" } My question is simple: how can I disable the formatting functionality here while keeping it elsewhere. My initial reaction was copious use of the backslash to escape the various percent symbols, but that of course permanently breaks the formatting such that it wont work even when I need it to. Also, general pointers on good settings-file practices would be nice. This is the first time I've done anything significant with ConfigParser (or logging for that matter). Thanks in advance, Dominic

    Read the article

  • How can I put rows of MySQL data under the appropriate titles using PHP?

    - by sfarbota
    I have the following MySQL table structure: num field company phone website 1 Gas abcd 123456789 abcd.com 2 Water efgh 987654321 efgh.com 3 Water ijkl 321654987 ijkl.com 4 Heat mnop 987654321 mnop.com 5 Gas qrst 123789654 qrst.com ... Is it possible with PHP (maybe using some mixture of GROUP_BY and ORDER_BY) to echo the data to the screen in the following format: Gas: abcd qrst 123456789 123789654 abcd.com qrst.com Water: efgh ijkl 987654321 321654987 efgh.com ijkl.com Heat: mnop 321654987 mnop.com The exact format of it isn't important. I just need for the different rows of data to be listed under the appropriate field with none of the fields repeated. I've been trying to figure this out for a while now, but I'm new to PHP and I can't seem to figure out how to do this, if it's even possible, or if there's a better way to organize my data to make it easier.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Random access gzip stream

    - by jkff
    I'd like to be able to do random access into a gzipped file. I can afford to do some preprocessing on it (say, build some kind of index), provided that the result of the preprocessing is much smaller than the file itself. Any advice? My thoughts were: Hack on an existing gzip implementation and serialize its decompressor state every, say, 1 megabyte of compressed data. Then to do random access, deserialize the decompressor state and read from the megabyte boundary. This seems hard, especially since I'm working with Java and I couldn't find a pure-java gzip implementation :( Re-compress the file in chunks of 1Mb and do same as above. This has the disadvantage of doubling the required disk space. Write a simple parser of the gzip format that doesn't do any decompressing and only detects and indexes block boundaries (if there even are any blocks: I haven't yet read the gzip format description)

    Read the article

  • Using Rails 3 and Haml 3, how do I configure Haml?

    - by dpogg1
    I'm using Rails 3.0.0.beta3 and Haml 3.0.0.rc.2, and I can't find where I need to place the configuration lines for Haml (nor what they are in the new version, for that matter). Using Rails 2.3.5 and Haml 2, I would do Haml::Template.options[:format] = :html5 in environment.rb. Or, in Sinatra, set :haml, {:format => :html5} in my main file. But in Rails 3 everything's been changed around, and no matter where I put that configuration line, I get an undefined method or undefined object error.

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • Fully automated SQL Server Restore

    - by hasen j
    I'm not very fluent with SQL Server commands. I need a script to restore a database from a .bak file and move the logical_data and logical_log files to a specific path. I can do: restore filelistonly from disk='D:\backups\my_backup.bak' This will give me a result set with a column LogicalName, next I need to use the logical names from the result set in the restore command: restore database my_db_name from disk='d:\backups\my_backups.bak' with file=1, move 'logical_data_file' to 'd:\data\mydb.mdf', move 'logical_log_file' to 'd:\data\mylog.ldf' How do I capture the logical names from the first result set into variables that can be supplied to the "move" command? I think the solution might be trivial, but I'm pretty new to SQL Server.

    Read the article

  • Best tool to check and ensure PDF/A compatibility under Linux

    - by Sven Lilienthal
    I am working on an online portal, where researchers can upload their research papers. One requirement is, that all PDFs are stored in PDF/A-format. As I can't rely on the users to generate PDF/A conforming documents, I need a tool to check and convert standard PDFs into PDF/A format. What is the best tool you know of? Price Quality Speed Available APIs Open-source tools would be prefered, but a search revealed none. iText can create PDF/a, but converting isn't easy to do, as you have to read every page and copy it to a new document, losing all bookmarks and annotations in this process. (At least as far as I know, if you know of an easy solution, let me know). APIs should be available for either PHP, Java or a command-line-tool should be provided. Please do not list either GUI-only or Online-only solutions.

    Read the article

  • Rails: Need a helping hand to finish this Jquery/Ajax problem.

    - by DJTripleThreat
    Here's my problem: I have a combo box that when its index changes I want a div tag with the id="services" to repopulate with checkboxes based on that comboboxes value. I want this to be done using ajax. This is my first time working with ajax for rails so I need a helping hand. Here is what I have so far: My application.js file. Something that Ryan uses in one of his railscasts. This is supposed to be a helper method for handling ajax requests. Is this useful? Should I be using this?: //<![CDATA[ $.ajaxSetup({ 'beforeSend': function(xhr) {xhr.setRequestHeader("Accept","text/javascript")} }); // This function doesn't return any results. How might I change that? Or // should I have another function to do that? $.fn.submitWithAjax = function() { this.submit(function() { $.post($(this).attr("action"), $(this).serialize(), null, "script"); return true; }); }; //]]> An external javascript file for this template (/public/javascripts/combo_box.js): //<![CDATA[ $(document).ready(function(){ $('#event_service_time_allotment').change(function () { // maybe I should be using submitWithAjax(); ?? $(this).parent().submit(); }); }); //]]> My ???.js.erb file. I'm not sure where this file should go. Should I make an ajax controller?? Someone help me out with that part please. I can write this code no problem, I just need to know where it should go and what the file name should be called (best practices etc): // new.js.erb: dynamic choices... expecting a time_allotment alert('test'); // TODO: Return a json object or something with a result set of services // I should be expecting something like: // params[:event_service][:time_allotment] i think which I should use // to return a json object (??) to be parsed or rendered html // for the div#services. Here is my controller's new action. Am I supposed to respond to javascript here? Should I make an ajax controller instead? What's the best way to do this?: # /app/controllers/event_services_controller.rb def new @event_service = EventService.new respond_to do |format| format.html # new.html.erb format.xml { render :xml => @event_service } format.js # should I have a javascript handler here? i'm lost! end end My /app/views/event_service/new.html.erb. My ajax call I think should be a different action then the form: <% content_for :head do %> <%= javascript_include_tag '/javascripts/combo_box.js' %> <% end %> <% form_for @event_service, :url => admin_events_path, :html => {:method => :post} do |f| %> <!-- TimeAllotment is a tabless model which is why this is done like so... --> <!-- This select produces an id of: "event_service_time_allotment" and a name of: "event_service[time_allotment]" --> <%= select("event_service", "time_allotment", TimeAllotment.all.collect {|ta| [ta.title, ta.value]}, {:prompt => true}) %> Services: <!-- this div right here needs to be repopulated when the above select changes. --> <div id="services"> <% for service_type in ServiceType.all %> <div> <%= check_box_tag "event_service[service_type_ids][]", service_type.id, false %> <%=h service_type.title %> </div> <% end %> </div> <% end %> ok so right now ALL of the services are there to be chosen from. I want them to change based on what is selected in the combobox event_service_time_allotment. Thanks, I know this is super complicated so any helpful answers will get an upvote.

    Read the article

  • How to convert raw_input() into a directory?

    - by Azeworai
    Hi everyone, I just picked up IronPython and I've been trying to get this IronPython script going but I'm stuck at trying to get a Path input from raw_input to be a directory path. The first block of code is the broken one that I'm working on. import System from System import * from System.IO import * from System.Diagnostics import * inputDirectory = raw_input("Enter Input Directory's full path [eg. c:\\vid\\]: ") print ("In: "+inputDirectory) outputDirectory = inputDirectory +"ipod\\" print ("Out: "+outputDirectory) #create the default output directory for s in DirectoryInfo(inputDirectory).GetFiles("*.avi"): print s.FullName arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, outputDirectory + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() The following code block is what I have working at the moment. import System from System import * from System.IO import * from System.Diagnostics import * for s in DirectoryInfo("F:\\Tomorrow\\").GetFiles("*.avi"): arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, "F:\\Tomorrow\\ipod\\" + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() PS: Credit for the above working code goes to Joseph at jcooney.net

    Read the article

  • Wrap link around links in tweets with php preg_replace

    - by Ben Paton
    Hello I'm trying to display the latest tweet using the code below. This preg_replace works great for wrapping a link round twitter @usernames but doesn't work for web addresses in tweets. How do I get this code to wrap links around urls in tweets. <?php /** Script to pull in the latest tweet */ $username='fairgroceruk'; $format = 'json'; $tweet = json_decode(file_get_contents("http://api.twitter.com/1/statuses/user_timeline/{$username}.{$format}")); $latestTweet = htmlentities($tweet[0]->text, ENT_QUOTES); $latestTweet = preg_replace('/@([a-z0-9_]+)/i', '<a href="http://twitter.com/$1" target="_blank">@$1</a>', $latestTweet); $latestTweet = preg_replace('/http://([a-z0-9_]+)/i', '<a href="http://$1" target="_blank">http://$1</a>', $latestTweet); echo $latestTweet; ?> Thanks for the help, Ben

    Read the article

  • Convert Date to Datetime field.

    - by infant programmer
    The argument my C# function is getting is a string which is merely a Date or a DateTime. I am suppose to convert this String to DateTime, to carry on furthure calculation. Now I need to test whether the incoming data is a Date, if it is date(examle:"12/31/2009"), then I need to add "00:00:00" (24 hours format) to it, so that it will become "12/31/2009 00:00:00". If string manipulation is one possible way, I want to confirm whether there is some other way where we can automate the testing and conversion within DateTime.TryParseExact() method. This is my sample C# code : (which is now only able to convert string of format "MM/dd/yyyy HH:mm:ss" to DateTime.) private static string[] formats = new string[] { "MM/dd/yyyy HH:mm:ss" }; public string date_conv(string date_str) { DateTime date_value; DateTime.TryParseExact(date_str, formats, new global::System.Globalization.CultureInfo("en-US"), global::System.Globalization.DateTimeStyles.None, out date_value); /*Some useful instruction to use date_value*/ return(date_value.ToString("MM/dd/yyyy HH:mm:ss")); }

    Read the article

  • Convert any currency string to double

    - by James
    I need to store multiple currencies in SQL server. I understand that SQL won't support all different types of currencies (unless I store it as a string, but I don't want to do that). My idea was to convert all the values from their currency format to a standard double and store that instead. Then just re-format based on the culture info when displaying. However, I have tried doing something like e.g. var cultureInfo = new System.Globalization.CultureInfo("en-US"); double plain = return Double.Parse("$20,000.00", cultureInfo); This doesn't ever seem to work it always throws a FormatException. Even removing the currency symbol and just trying to do this based on the number alone does the same thing. This is just an example I want to support pretty much any type of currency. Is there a standard way of stripping out currency and getting the value as a double?

    Read the article

< Previous Page | 277 278 279 280 281 282 283 284 285 286 287 288  | Next Page >