Search Results

Search found 21005 results on 841 pages for 'disk format'.

Page 281/841 | < Previous Page | 277 278 279 280 281 282 283 284 285 286 287 288  | Next Page >

  • How to have localized style when writing cell with xlwt

    - by lfagundes
    I'm writing an Excel spreadsheet with Python's xlwt and I need numbers to be formatted using "." as thousands separator, as it is in brazilian portuguese language. I have tried: style.num_format_str = r'#,##0' And it sets the thousands separator as ','. If I try setting num_format_str to '#.##0', I'll get number formatted as 1234.000 instead of 1.234. And if I open document in OpenOffice and format cells, I can set the language of the cell to "Portuguese (Brazil)" and then OpenOffice will show the format code as being "#.##0", but I don't find a way to set the cell's language to brazilian portuguese. Any ideas?

    Read the article

  • Direct3D 11 effect files deprecated?

    - by Toji
    I've been playing around with Direct3D 11 a little bit lately and have been frustrated by the lack of documentation on the basics of the API (such as simple geometry rendering). One of the points of confusion brought on by the sparse documentation is the (apparent) move away from the use of effects for shaders. In D3D11 all of the effect (.fx) support has been removed from the D3DX libraries and buried away in a hard to find (sparsely documented, of course) shared source library. None of the included examples use it, preferring instead to compile HLSL files directly. All of this says to me that Microsoft is trying to get people to stop using the effect file format. Is that true? Is there any documentation of any kind that states that? I'm fine doing it either way, but for years now they've been promoting the .fx format so it seems odd that they would suddenly decide to drop it.

    Read the article

  • How to conditionally execute a jquery validation?

    - by Pandiya Chendur
    I am validating form using jquery validation plugin...... rules: { Name: "required", MobileNo: { required: true, minlength: 10, remote: '<%=Url.Action("getClientMobNo", "Clients") %>' }, Address: "required" }, messages: { Name: "please provide a client name", MobileNo: { required: "Please provide a mobile phone no", rangelength: jQuery.format("Enter at least {0} characters"), remote: jQuery.format("This MobileNo is already in use") }, Address: "please provide client address" }, This works pretty well on add form validation but i use the same form for edit here they can use the same mobile no,but my plugin validates that mobileno saying there is already a mobileno... But how to execute remote attribute based on a condition, MobileNo: { required: true, minlength: 10, if($("#HfId").val() == ""){ remote: '<%=Url.Action("getClientMobNo", "Clients") %>' } }, Is this a valid jquery conditional validation statement.... How to skip remote attribute based on a condition....

    Read the article

  • How to make Date locale-independent? (GMT timezone newbie question)

    - by folone
    I have a db, that stores dates in OleDateTime format, in GMT timezone. I've implemented a class, extending Date in java to represent that in classic date format. But my class is locale-dependent (I'm in GMT+2). Therefore, it converts the date in the db as date - 2 hours. How do I make it convert the date correctly? I want my class to be locale-independent, always using GMT timezone. Actually, the question is: class MyOleDateTime extends Date { static { Locale.setDefault(WhatGoesHere?) } // ... some constructors // ... some methods }

    Read the article

  • transition of x-axis results in overflow

    - by peter
    First of all, no: this question is not about the (yet) ugly transition of the lines (I might open another one for that, though..). I'm displaying data in line charts and the user can select the time horizon. The x-axis then correspondingly transitions so as to fit to the changed time horizon. In attached image, e.g., the time horizon was 1 week and then I switched to 4 weeks. The number of ticks on the x-axis increases from 7 to 28, correspondingly. Question: How can I prevent the x-axis animation to display outside the svg container? As you can see, the additional dates fly in from the left and they are being animated far far outside the container. Any ideas? Right now, the transition works probably in the most simple way it could: // format for x-axis var xAxis = d3.svg.axis() .scale(x) .orient("bottom") .tickFormat(d3.time.format("%d.%m")) .ticks(d3.time.days, 1) .tickSubdivide(0); // Update x-axis svg.select(".x") .transition() .duration(500) .call(xAxis);

    Read the article

  • Android PixelFormat per device

    - by Tobias Domhan
    analogous to this thread: stackoverflow.com/questions/2093594/opengl-extensions-available-on-different-android-devices I would like to collect the different PixelFormats the android devices use. To find out you must do the following: Parameters camParams = camera.getParameters(); int format = camParams.getPreviewFormat(); Now you got to find the number in the following list: developer.android.com/reference/android/graphics/PixelFormat.html#A_8 How to generally open the camera is described here: developer.android.com/resources/samples/ApiDemos/src/com/example/android/apis/graphics/CameraPreview.html I'll have a start: device: T-mobile G1 / HTC Dream android: 1.6 (cyanogen mod) format: YCbCr_420_SP so what formats do your android phones use? thanks in advance :D

    Read the article

  • How to convert raw_input() into a directory?

    - by Azeworai
    Hi everyone, I just picked up IronPython and I've been trying to get this IronPython script going but I'm stuck at trying to get a Path input from raw_input to be a directory path. The first block of code is the broken one that I'm working on. import System from System import * from System.IO import * from System.Diagnostics import * inputDirectory = raw_input("Enter Input Directory's full path [eg. c:\\vid\\]: ") print ("In: "+inputDirectory) outputDirectory = inputDirectory +"ipod\\" print ("Out: "+outputDirectory) #create the default output directory for s in DirectoryInfo(inputDirectory).GetFiles("*.avi"): print s.FullName arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, outputDirectory + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() The following code block is what I have working at the moment. import System from System import * from System.IO import * from System.Diagnostics import * for s in DirectoryInfo("F:\\Tomorrow\\").GetFiles("*.avi"): arg = String.Format('-i "{0}" -t 1 -c 1 -o "{1}" --preset="iPod"' , s.FullName, "F:\\Tomorrow\\ipod\\" + s.Name.Replace(".avi", ".mp4")) print arg proc = Process.Start("C:\\Program Files\\Handbrake\\HandBrakeCLI.exe", arg) #path to handbrake goes here proc.WaitForExit() PS: Credit for the above working code goes to Joseph at jcooney.net

    Read the article

  • Why the current working directory changes when use the Open file dialog in XP?

    - by RRUZ
    I have found an strange behavior when use the open file dialog in c#. If use this code in Windows XP the current working directory changes to the path of the selected file, however if you run this code in windows 7 the current working directory does not change. private void button1_Click(object sender, EventArgs e) { MessageBox.Show(string.Format("Current Directory {0}",Directory.GetCurrentDirectory()), "My Application",MessageBoxButtons.OK, MessageBoxIcon.Asterisk); DialogResult result = openFileDialog1.ShowDialog(); // Show the dialog and get result. if (result == DialogResult.OK) { } MessageBox.Show(string.Format("Current Directory {0}", Directory.GetCurrentDirectory()), "My Application", MessageBoxButtons.OK, MessageBoxIcon.Asterisk); } Anybody know the reason for this behavior? Why the current directoiry changes in XP and not in windows 7?

    Read the article

  • Best tool to check and ensure PDF/A compatibility under Linux

    - by Sven Lilienthal
    I am working on an online portal, where researchers can upload their research papers. One requirement is, that all PDFs are stored in PDF/A-format. As I can't rely on the users to generate PDF/A conforming documents, I need a tool to check and convert standard PDFs into PDF/A format. What is the best tool you know of? Price Quality Speed Available APIs Open-source tools would be prefered, but a search revealed none. iText can create PDF/a, but converting isn't easy to do, as you have to read every page and copy it to a new document, losing all bookmarks and annotations in this process. (At least as far as I know, if you know of an easy solution, let me know). APIs should be available for either PHP, Java or a command-line-tool should be provided. Please do not list either GUI-only or Online-only solutions.

    Read the article

  • Random access gzip stream

    - by jkff
    I'd like to be able to do random access into a gzipped file. I can afford to do some preprocessing on it (say, build some kind of index), provided that the result of the preprocessing is much smaller than the file itself. Any advice? My thoughts were: Hack on an existing gzip implementation and serialize its decompressor state every, say, 1 megabyte of compressed data. Then to do random access, deserialize the decompressor state and read from the megabyte boundary. This seems hard, especially since I'm working with Java and I couldn't find a pure-java gzip implementation :( Re-compress the file in chunks of 1Mb and do same as above. This has the disadvantage of doubling the required disk space. Write a simple parser of the gzip format that doesn't do any decompressing and only detects and indexes block boundaries (if there even are any blocks: I haven't yet read the gzip format description)

    Read the article

  • Fully automated SQL Server Restore

    - by hasen j
    I'm not very fluent with SQL Server commands. I need a script to restore a database from a .bak file and move the logical_data and logical_log files to a specific path. I can do: restore filelistonly from disk='D:\backups\my_backup.bak' This will give me a result set with a column LogicalName, next I need to use the logical names from the result set in the restore command: restore database my_db_name from disk='d:\backups\my_backups.bak' with file=1, move 'logical_data_file' to 'd:\data\mydb.mdf', move 'logical_log_file' to 'd:\data\mylog.ldf' How do I capture the logical names from the first result set into variables that can be supplied to the "move" command? I think the solution might be trivial, but I'm pretty new to SQL Server.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Is it possible to temporarily disable Python's string interpolation?

    - by dangerouslyfacetious
    I have a python logger set up, using python's logging module. I want to store the string I'm using with the logging Formatter object in a configuration file using the ConfigParser module. The format string is stored in a dictionary of settings in a separate file that handles the reading and writing of the config file. The problem I have is that python still tries to format the file and falls over when it reads all the logging-module-specific formatting flags. { "log_level":logging.debug, "log_name":"C:\\Temp\\logfile.log", "format_string": "%(asctime)s %(levelname)s: %(module)s, line %(lineno)d - %(message)s" } My question is simple: how can I disable the formatting functionality here while keeping it elsewhere. My initial reaction was copious use of the backslash to escape the various percent symbols, but that of course permanently breaks the formatting such that it wont work even when I need it to. Also, general pointers on good settings-file practices would be nice. This is the first time I've done anything significant with ConfigParser (or logging for that matter). Thanks in advance, Dominic

    Read the article

  • Defining a dd/mm/yyyy field within an abstract table model

    - by Simon Andi
    I have defined an abstract table model but one of the columns should house date values as dd/mm/yyyy format not sure how to do this. I have a external global file and have hard coded the dates as dd/mm/yyyy. How can I define this column within my abstract table model so that to only allow only dates having dd/mm/yyyy format. public class OptraderGlobalParameters { public static boolean DEBUG = true; //Set DEBUG = true for Debugging /*=========================*/ /*Table Array For Dividends*/ /*=========================*/ public static String[] columnNames = {"Date", "Dividend", "Actual", "Yield (%)" }; public static Object[][] data = { {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, {"dd/mm/yyyy", new Double(5), new Boolean(false), new Boolean(false)}, }; }

    Read the article

  • Wrap link around links in tweets with php preg_replace

    - by Ben Paton
    Hello I'm trying to display the latest tweet using the code below. This preg_replace works great for wrapping a link round twitter @usernames but doesn't work for web addresses in tweets. How do I get this code to wrap links around urls in tweets. <?php /** Script to pull in the latest tweet */ $username='fairgroceruk'; $format = 'json'; $tweet = json_decode(file_get_contents("http://api.twitter.com/1/statuses/user_timeline/{$username}.{$format}")); $latestTweet = htmlentities($tweet[0]->text, ENT_QUOTES); $latestTweet = preg_replace('/@([a-z0-9_]+)/i', '<a href="http://twitter.com/$1" target="_blank">@$1</a>', $latestTweet); $latestTweet = preg_replace('/http://([a-z0-9_]+)/i', '<a href="http://$1" target="_blank">http://$1</a>', $latestTweet); echo $latestTweet; ?> Thanks for the help, Ben

    Read the article

  • cannot access new drive through nfs

    - by l.thee.a
    I am running nfs-kernel-server to access my files on my linux machine(ubuntu - /share). The disk I have been using is full. So I have added a new disk and mounted it to /share/data. My other pc mounts the /share folder to /mnt/nfs; but cannot see the contents of /mnt/nfs/data. I have tried adding /share/data to /etc/exports, but it did not help. What do I do?

    Read the article

  • mdadm: Win7-install created a boot partition on one of my RAID6 drives. How to rebuild?

    - by EXIT_FAILURE
    My problem happened when I attempted to install Windows 7 on it's own SSD. The Linux OS I used which has knowledge of the software RAID system is on a SSD that I disconnected prior to the install. This was so that windows (or I) wouldn't inadvertently mess it up. However, and in retrospect, foolishly, I left the RAID disks connected, thinking that windows wouldn't be so ridiculous as to mess with a HDD that it sees as just unallocated space. Boy was I wrong! After copying over the installation files to the SSD (as expected and desired), it also created an ntfs partition on one of the RAID disks. Both unexpected and totally undesired! . I changed out the SSDs again, and booted up in linux. mdadm didn't seem to have any problem assembling the array as before, but if I tried to mount the array, I got the error message: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I then used qparted to delete the newly created ntfs partition on /dev/sdd so that it matched the other three /dev/sd{b,c,e}, and requested a resync of my array with echo repair > /sys/block/md0/md/sync_action This took around 4 hours, and upon completion, dmesg reports: md: md0: requested-resync done. A bit brief after a 4-hour task, though I'm unsure as to where other log files exist (I also seem to have messed up my sendmail configuration). In any case: No change reported according to mdadm, everything checks out. mdadm -D /dev/md0 still reports: Version : 1.2 Creation Time : Wed May 23 22:18:45 2012 Raid Level : raid6 Array Size : 3907026848 (3726.03 GiB 4000.80 GB) Used Dev Size : 1953513424 (1863.02 GiB 2000.40 GB) Raid Devices : 4 Total Devices : 4 Persistence : Superblock is persistent Update Time : Mon May 26 12:41:58 2014 State : clean Active Devices : 4 Working Devices : 4 Failed Devices : 0 Spare Devices : 0 Layout : left-symmetric Chunk Size : 4K Name : okamilinkun:0 UUID : 0c97ebf3:098864d8:126f44e3:e4337102 Events : 423 Number Major Minor RaidDevice State 0 8 16 0 active sync /dev/sdb 1 8 32 1 active sync /dev/sdc 2 8 48 2 active sync /dev/sdd 3 8 64 3 active sync /dev/sde Trying to mount it still reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so and dmesg: EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! EXT4-fs (md0): group descriptors corrupted! I'm a bit unsure where to proceed from here, and trying stuff "to see if it works" is a bit too risky for me. This is what I suggest I should attempt to do: Tell mdadm that /dev/sdd (the one that windows wrote into) isn't reliable anymore, pretend it is newly re-introduced to the array, and reconstruct its content based on the other three drives. I also could be totally wrong in my assumptions, that the creation of the ntfs partition on /dev/sdd and subsequent deletion has changed something that cannot be fixed this way. My question: Help, what should I do? If I should do what I suggested , how do I do that? From reading documentation, etc, I would think maybe: mdadm --manage /dev/md0 --set-faulty /dev/sdd mdadm --manage /dev/md0 --remove /dev/sdd mdadm --manage /dev/md0 --re-add /dev/sdd However, the documentation examples suggest /dev/sdd1, which seems strange to me, as there is no partition there as far as linux is concerned, just unallocated space. Maybe these commands won't work without. Maybe it makes sense to mirror the partition table of one of the other raid devices that weren't touched, before --re-add. Something like: sfdisk -d /dev/sdb | sfdisk /dev/sdd Bonus question: Why would the Windows 7 installation do something so st...potentially dangerous? Update I went ahead and marked /dev/sdd as faulty, and removed it (not physically) from the array: # mdadm --manage /dev/md0 --set-faulty /dev/sdd # mdadm --manage /dev/md0 --remove /dev/sdd However, attempting to --re-add was disallowed: # mdadm --manage /dev/md0 --re-add /dev/sdd mdadm: --re-add for /dev/sdd to /dev/md0 is not possible --add, was fine. # mdadm --manage /dev/md0 --add /dev/sdd mdadm -D /dev/md0 now reports the state as clean, degraded, recovering, and /dev/sdd as spare rebuilding. /proc/mdstat shows the recovery progress: md0 : active raid6 sdd[4] sdc[1] sde[3] sdb[0] 3907026848 blocks super 1.2 level 6, 4k chunk, algorithm 2 [4/3] [UU_U] [>....................] recovery = 2.1% (42887780/1953513424) finish=348.7min speed=91297K/sec nmon also shows expected output: ¦sdb 0% 87.3 0.0| > |¦ ¦sdc 71% 109.1 0.0|RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR > |¦ ¦sdd 40% 0.0 87.3|WWWWWWWWWWWWWWWWWWWW > |¦ ¦sde 0% 87.3 0.0|> || It looks good so far. Crossing my fingers for another five+ hours :) Update 2 The recovery of /dev/sdd finished, with dmesg output: [44972.599552] md: md0: recovery done. [44972.682811] RAID conf printout: [44972.682815] --- level:6 rd:4 wd:4 [44972.682817] disk 0, o:1, dev:sdb [44972.682819] disk 1, o:1, dev:sdc [44972.682820] disk 2, o:1, dev:sdd [44972.682821] disk 3, o:1, dev:sde Attempting mount /dev/md0 reports: mount: wrong fs type, bad option, bad superblock on /dev/md0, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so And on dmesg: [44984.159908] EXT4-fs (md0): ext4_check_descriptors: Block bitmap for group 0 not in group (block 1318081259)! [44984.159912] EXT4-fs (md0): group descriptors corrupted! I'm not sure what do do now. Suggestions? Output of dumpe2fs /dev/md0: dumpe2fs 1.42.8 (20-Jun-2013) Filesystem volume name: Atlas Last mounted on: /mnt/atlas Filesystem UUID: e7bfb6a4-c907-4aa0-9b55-9528817bfd70 Filesystem magic number: 0xEF53 Filesystem revision #: 1 (dynamic) Filesystem features: has_journal ext_attr resize_inode dir_index filetype extent flex_bg sparse_super large_file huge_file uninit_bg dir_nlink extra_isize Filesystem flags: signed_directory_hash Default mount options: user_xattr acl Filesystem state: clean Errors behavior: Continue Filesystem OS type: Linux Inode count: 244195328 Block count: 976756712 Reserved block count: 48837835 Free blocks: 92000180 Free inodes: 243414877 First block: 0 Block size: 4096 Fragment size: 4096 Reserved GDT blocks: 791 Blocks per group: 32768 Fragments per group: 32768 Inodes per group: 8192 Inode blocks per group: 512 RAID stripe width: 2 Flex block group size: 16 Filesystem created: Thu May 24 07:22:41 2012 Last mount time: Sun May 25 23:44:38 2014 Last write time: Sun May 25 23:46:42 2014 Mount count: 341 Maximum mount count: -1 Last checked: Thu May 24 07:22:41 2012 Check interval: 0 (<none>) Lifetime writes: 4357 GB Reserved blocks uid: 0 (user root) Reserved blocks gid: 0 (group root) First inode: 11 Inode size: 256 Required extra isize: 28 Desired extra isize: 28 Journal inode: 8 Default directory hash: half_md4 Directory Hash Seed: e177a374-0b90-4eaa-b78f-d734aae13051 Journal backup: inode blocks dumpe2fs: Corrupt extent header while reading journal super block

    Read the article

  • Using Rails 3 and Haml 3, how do I configure Haml?

    - by dpogg1
    I'm using Rails 3.0.0.beta3 and Haml 3.0.0.rc.2, and I can't find where I need to place the configuration lines for Haml (nor what they are in the new version, for that matter). Using Rails 2.3.5 and Haml 2, I would do Haml::Template.options[:format] = :html5 in environment.rb. Or, in Sinatra, set :haml, {:format => :html5} in my main file. But in Rails 3 everything's been changed around, and no matter where I put that configuration line, I get an undefined method or undefined object error.

    Read the article

  • How can I put rows of MySQL data under the appropriate titles using PHP?

    - by sfarbota
    I have the following MySQL table structure: num field company phone website 1 Gas abcd 123456789 abcd.com 2 Water efgh 987654321 efgh.com 3 Water ijkl 321654987 ijkl.com 4 Heat mnop 987654321 mnop.com 5 Gas qrst 123789654 qrst.com ... Is it possible with PHP (maybe using some mixture of GROUP_BY and ORDER_BY) to echo the data to the screen in the following format: Gas: abcd qrst 123456789 123789654 abcd.com qrst.com Water: efgh ijkl 987654321 321654987 efgh.com ijkl.com Heat: mnop 321654987 mnop.com The exact format of it isn't important. I just need for the different rows of data to be listed under the appropriate field with none of the fields repeated. I've been trying to figure this out for a while now, but I'm new to PHP and I can't seem to figure out how to do this, if it's even possible, or if there's a better way to organize my data to make it easier.

    Read the article

  • Why I get different date formats when I run my application through IIS and Visual Studio's web serve

    - by Puneet Dudeja
    I get the same culture i.e. "en-US" while running the website from both IIS and Visual Studio's web server. But I get a different date format as follows, when I run the following code: HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.ToString()); HttpContext.Current.Response.Write(System.Threading.Thread.CurrentThread.CurrentCulture.DateTimeFormat.ShortDatePattern); On Visual Studio's web server: dd/MM/yyyy en-US On IIS: M/d/yyyy en-US Does "Regional and Language Options" in "Control Panel" play any role in this ? If I change the date format there in "Regional and Language Options", I see no effect in my application.

    Read the article

  • java version of python-dateutil

    - by elhefe
    Python has a very handy package that can parse nearly any unambiguous date and provides helpful error messages on a parse failure, python-dateutil. Comparison to the SimpleDateFormat class is not favorable - AFAICT SimpleDateFormat can only handle one exact date format and the error messages have no granularity. I've looked through the Joda API but it appears Joda is the same way - only one explicit format can be parsed at a time. Is there any package or library that reproduces the python-dateutil behavior? Or am I missing something WRT Joda/SimpleDateFormat?

    Read the article

  • Convert any currency string to double

    - by James
    I need to store multiple currencies in SQL server. I understand that SQL won't support all different types of currencies (unless I store it as a string, but I don't want to do that). My idea was to convert all the values from their currency format to a standard double and store that instead. Then just re-format based on the culture info when displaying. However, I have tried doing something like e.g. var cultureInfo = new System.Globalization.CultureInfo("en-US"); double plain = return Double.Parse("$20,000.00", cultureInfo); This doesn't ever seem to work it always throws a FormatException. Even removing the currency symbol and just trying to do this based on the number alone does the same thing. This is just an example I want to support pretty much any type of currency. Is there a standard way of stripping out currency and getting the value as a double?

    Read the article

< Previous Page | 277 278 279 280 281 282 283 284 285 286 287 288  | Next Page >